Citrus Sinensis ID: 030369
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 178 | ||||||
| 224054220 | 178 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.876 | 2e-88 | |
| 357491793 | 178 | Armadillo repeat-containing protein [Med | 0.994 | 0.994 | 0.802 | 3e-81 | |
| 225466251 | 177 | PREDICTED: armadillo repeat-containing p | 0.988 | 0.994 | 0.806 | 5e-81 | |
| 15240175 | 180 | armadillo/beta-catenin-like repeat-conta | 0.994 | 0.983 | 0.810 | 3e-80 | |
| 21618145 | 180 | unknown [Arabidopsis thaliana] | 0.994 | 0.983 | 0.810 | 4e-80 | |
| 297805232 | 180 | armadillo/beta-catenin repeat family pro | 0.994 | 0.983 | 0.804 | 1e-79 | |
| 363807054 | 178 | uncharacterized protein LOC100790639 [Gl | 0.994 | 0.994 | 0.779 | 2e-79 | |
| 255564444 | 172 | Armadillo repeat-containing protein, put | 0.966 | 1.0 | 0.788 | 2e-78 | |
| 186527111 | 179 | armadillo/beta-catenin-like repeat-conta | 0.988 | 0.983 | 0.804 | 3e-78 | |
| 242034989 | 176 | hypothetical protein SORBIDRAFT_01g02830 | 0.977 | 0.988 | 0.793 | 4e-78 |
| >gi|224054220|ref|XP_002298151.1| predicted protein [Populus trichocarpa] gi|222845409|gb|EEE82956.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 329 bits (844), Expect = 2e-88, Method: Compositional matrix adjust.
Identities = 156/178 (87%), Positives = 170/178 (95%)
Query: 1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLR 60
MFTNNQRQEERTG+ GTPRLQYLQELV+QFQN+ DEERKE+IVANLANFAYDPYNYTFLR
Sbjct: 1 MFTNNQRQEERTGKYGTPRLQYLQELVNQFQNAADEERKERIVANLANFAYDPYNYTFLR 60
Query: 61 QLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNT 120
QLNVLELFLDCITEPNEKLVEFG+GGICN+ DPANAAIIT+SGGIPL I+CLSSPVRNT
Sbjct: 61 QLNVLELFLDCITEPNEKLVEFGIGGICNSCDDPANAAIITQSGGIPLTIQCLSSPVRNT 120
Query: 121 VNHALGALYYLCSMSTKEEILKPEVVDVIRRYAAAESVNVSFSNLAKAFLDKHVTENK 178
VN+ALG+LYYLC+ STKEEILKPEV+DVI+RYAA E+VNVSFSNLAKAFLDKHV ENK
Sbjct: 121 VNYALGSLYYLCNSSTKEEILKPEVLDVIKRYAACETVNVSFSNLAKAFLDKHVYENK 178
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357491793|ref|XP_003616184.1| Armadillo repeat-containing protein [Medicago truncatula] gi|355517519|gb|AES99142.1| Armadillo repeat-containing protein [Medicago truncatula] gi|388504388|gb|AFK40260.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225466251|ref|XP_002270403.1| PREDICTED: armadillo repeat-containing protein 7 [Vitis vinifera] gi|297738150|emb|CBI27351.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15240175|ref|NP_198545.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|9758715|dbj|BAB09101.1| unnamed protein product [Arabidopsis thaliana] gi|98960935|gb|ABF58951.1| At5g37290 [Arabidopsis thaliana] gi|332006778|gb|AED94161.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21618145|gb|AAM67195.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297805232|ref|XP_002870500.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297316336|gb|EFH46759.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|363807054|ref|NP_001242327.1| uncharacterized protein LOC100790639 [Glycine max] gi|255647064|gb|ACU24000.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255564444|ref|XP_002523218.1| Armadillo repeat-containing protein, putative [Ricinus communis] gi|223537514|gb|EEF39139.1| Armadillo repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|186527111|ref|NP_001119321.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|332006779|gb|AED94162.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|242034989|ref|XP_002464889.1| hypothetical protein SORBIDRAFT_01g028300 [Sorghum bicolor] gi|241918743|gb|EER91887.1| hypothetical protein SORBIDRAFT_01g028300 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 178 | ||||||
| TAIR|locus:2169165 | 180 | AT5G37290 [Arabidopsis thalian | 0.994 | 0.983 | 0.810 | 1.9e-74 | |
| RGD|1310043 | 198 | Armc7 "armadillo repeat contai | 0.848 | 0.762 | 0.483 | 5.2e-33 | |
| MGI|MGI:2679719 | 198 | Armc7 "armadillo repeat contai | 0.848 | 0.762 | 0.470 | 1.4e-32 | |
| ZFIN|ZDB-GENE-060929-288 | 192 | armc7 "armadillo repeat contai | 0.910 | 0.843 | 0.457 | 1.8e-32 | |
| FB|FBgn0038425 | 286 | CG14881 [Drosophila melanogast | 0.842 | 0.524 | 0.269 | 1.9e-14 |
| TAIR|locus:2169165 AT5G37290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 751 (269.4 bits), Expect = 1.9e-74, P = 1.9e-74
Identities = 145/179 (81%), Positives = 162/179 (90%)
Query: 1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLR 60
MFTNNQRQEERTG+ GTPRLQYLQELVSQFQN+TDEE KE+IVANLANFAYDPYNYT LR
Sbjct: 1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDEETKERIVANLANFAYDPYNYTILR 60
Query: 61 QLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNT 120
QLNVLELF+DCITEPNEKLVEFG+GGICNA +P N A I ++ GIPLII+ LSSPVRNT
Sbjct: 61 QLNVLELFVDCITEPNEKLVEFGIGGICNACAEPKNVATIVEADGIPLIIKSLSSPVRNT 120
Query: 121 VNHALGALYYLC--SMSTKEEILKPEVVDVIRRYAAAESVNVSFSNLAKAFLDKHVTEN 177
VN+ALGALYY+C + +T+EEIL+PEVVD+I RYAAAESV+VSFSNLAKAFLDKHV N
Sbjct: 121 VNYALGALYYMCDYNRATREEILRPEVVDLIERYAAAESVSVSFSNLAKAFLDKHVHAN 179
|
|
| RGD|1310043 Armc7 "armadillo repeat containing 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2679719 Armc7 "armadillo repeat containing 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-288 armc7 "armadillo repeat containing 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038425 CG14881 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 178 | |||
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 1e-09 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 1e-07 | |
| pfam00514 | 41 | pfam00514, Arm, Armadillo/beta-catenin-like repeat | 3e-05 | |
| smart00185 | 41 | smart00185, ARM, Armadillo/beta-catenin-like repea | 4e-04 |
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
Score = 53.5 bits (129), Expect = 1e-09
Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
Query: 23 LQELVSQFQNSTDEERKE--KIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLV 80
L LVS +S + ++E ++NL+ D N + + L + + +E++V
Sbjct: 9 LPALVSLLSSSDENVQREAAWALSNLSAGNND--NIQAVVEAGGLPALVQLLKSEDEEVV 66
Query: 81 EFGVGGICN-ASVDPANAAIITKSGGIPLIIECLSSPVRNTVNHALGAL 128
+ + + N A+ N I+ ++GG+P ++ L S + +A GAL
Sbjct: 67 KAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGAL 115
|
An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120 |
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat | Back alignment and domain information |
|---|
| >gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| KOG4646 | 173 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 99.44 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 99.18 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 99.14 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.98 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.96 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 98.93 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 98.87 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 98.85 | |
| KOG1206 | 272 | consensus Peroxisomal multifunctional beta-oxidati | 98.47 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 98.37 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 98.34 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 98.28 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 98.2 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 98.12 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 98.11 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 98.1 | |
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 97.9 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 97.75 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 97.71 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 97.68 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 97.68 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 97.34 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 97.32 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 97.31 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 97.25 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 97.09 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 97.08 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 97.01 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 96.92 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 96.86 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 96.82 | |
| KOG4646 | 173 | consensus Uncharacterized conserved protein, conta | 96.75 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.27 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 96.25 | |
| PF05536 | 543 | Neurochondrin: Neurochondrin | 96.21 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 96.21 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 96.17 | |
| PF08045 | 257 | CDC14: Cell division control protein 14, SIN compo | 96.06 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 95.87 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 95.69 | |
| PRK09687 | 280 | putative lyase; Provisional | 95.18 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 94.87 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 94.67 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 94.54 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 94.47 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 94.38 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 93.96 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 93.79 | |
| PF11841 | 160 | DUF3361: Domain of unknown function (DUF3361) | 93.54 | |
| PF07814 | 361 | WAPL: Wings apart-like protein regulation of heter | 93.22 | |
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 92.74 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 92.55 | |
| PF11701 | 157 | UNC45-central: Myosin-binding striated muscle asse | 92.3 | |
| PF12719 | 298 | Cnd3: Nuclear condensing complex subunits, C-term | 91.29 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 91.24 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 91.05 | |
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 91.04 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 90.77 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 90.41 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 89.91 | |
| PF06371 | 187 | Drf_GBD: Diaphanous GTPase-binding Domain; InterPr | 89.82 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 89.06 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 88.53 | |
| COG5369 | 743 | Uncharacterized conserved protein [Function unknow | 88.32 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 88.1 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 87.71 | |
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 86.98 | |
| PF14663 | 115 | RasGEF_N_2: Rapamycin-insensitive companion of mTO | 86.15 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 86.0 | |
| PF06025 | 379 | DUF913: Domain of Unknown Function (DUF913); Inter | 85.93 | |
| KOG2023 | 885 | consensus Nuclear transport receptor Karyopherin-b | 84.37 | |
| PF14664 | 371 | RICTOR_N: Rapamycin-insensitive companion of mTOR, | 84.26 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 83.84 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 83.39 | |
| PF12460 | 415 | MMS19_C: RNAPII transcription regulator C-terminal | 82.04 | |
| PF04063 | 192 | DUF383: Domain of unknown function (DUF383); Inter | 81.97 | |
| PF08045 | 257 | CDC14: Cell division control protein 14, SIN compo | 81.03 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 80.73 |
| >KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.2e-70 Score=434.50 Aligned_cols=171 Identities=50% Similarity=0.753 Sum_probs=164.7
Q ss_pred HHHHHhhCCCCCChHHHHHHHHHHhhcCChHHHHHHHHHHhhhhccCcccHHHhhhccChHHHHhhhcCCcHHHHHHHHH
Q 030369 6 QRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVG 85 (178)
Q Consensus 6 ~~l~~rt~~~g~~R~~ylq~LV~efq~t~~~e~keqvlanLaNfAyDP~N~~~LrqL~vidlfld~L~~~n~~l~EfAig 85 (178)
+++++|||++|+||+||||+||+|||+|+++|+||||+||||||||||+||.||||++|+|+|+|+|+++|+.|+|||||
T Consensus 1 ~~qk~rt~~hgi~Rl~Ylq~LV~efq~tt~~eakeqv~ANLANFAYDP~Nys~Lrql~vLdlFvdsl~e~ne~LvefgIg 80 (173)
T KOG4646|consen 1 RTQKRRTPAHGIDRLEYLQHLVDEFQTTTNIEAKEQVTANLANFAYDPINYSHLRQLDVLDLFVDSLEEQNELLVEFGIG 80 (173)
T ss_pred CCcccCCCCccCcHHHHHHHHHHHHHHhccHHHHHHHHHHHHhhccCcchHHHHHHhhHHHHHHHHhhcccHHHHHHhHH
Confidence 36899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhhcCCchhhHHhhhcCChhHHHHhhcCCchhHHHHHHHHHHHhcCC--cccccccchHHHHHHHHhhhhcccchhHH
Q 030369 86 GICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNHALGALYYLCSM--STKEEILKPEVVDVIRRYAAAESVNVSFS 163 (178)
Q Consensus 86 gLcNL~~D~~nk~~I~~~gGi~~li~lLsS~~~evv~~AlttL~~L~~~--~sr~~I~~p~ll~ll~~~~~~~~~~~~~~ 163 (178)
||||+|+|++|+++|.+.+|||+||.|||||.+++|.+|++++|+|+.+ +.|.++++|+|+++|+||+. +++.+++
T Consensus 81 glCNlC~d~~n~~~I~ea~g~plii~~lssp~e~tv~sa~~~l~~l~~~~Rt~r~ell~p~Vv~~v~r~~~--s~s~~~r 158 (173)
T KOG4646|consen 81 GLCNLCLDKTNAKFIREALGLPLIIFVLSSPPEITVHSAALFLQLLEFGERTERDELLSPAVVRTVQRWRE--SKSHDER 158 (173)
T ss_pred HHHhhccChHHHHHHHHhcCCceEEeecCCChHHHHHHHHHHHHHhcCcccchhHHhccHHHHHHHHHHHH--HhhHHHH
Confidence 9999999999999999999999999999999999999999999999988 47999999999999999996 4467999
Q ss_pred HhHHHHHHhhccCCC
Q 030369 164 NLAKAFLDKHVTENK 178 (178)
Q Consensus 164 nla~~fL~~~~~~~~ 178 (178)
|||++||++||++|.
T Consensus 159 nLa~~fl~~~~~~~~ 173 (173)
T KOG4646|consen 159 NLASAFLDKHVHANT 173 (173)
T ss_pred HHHHHHHHhhcccCC
Confidence 999999999999874
|
|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1206 consensus Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05536 Neurochondrin: Neurochondrin | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PF11841 DUF3361: Domain of unknown function (DUF3361) | Back alignment and domain information |
|---|
| >PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle | Back alignment and domain information |
|---|
| >PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >COG5369 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >PF14663 RasGEF_N_2: Rapamycin-insensitive companion of mTOR RasGEF_N domain | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing | Back alignment and domain information |
|---|
| >KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins | Back alignment and domain information |
|---|
| >PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function | Back alignment and domain information |
|---|
| >PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 178 | |||
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 2e-14 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 9e-12 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 4e-11 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 6e-10 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 7e-08 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 1e-07 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 2e-14 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 3e-11 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 4e-11 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 1e-10 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 5e-10 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 8e-07 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 3e-14 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-11 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-11 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 3e-11 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 3e-10 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 4e-10 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 3e-07 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 1e-04 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 4e-11 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 1e-07 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 9e-07 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 2e-06 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 1e-05 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 8e-11 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 2e-10 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 3e-07 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 8e-06 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 2e-09 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 8e-08 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 3e-05 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 4e-09 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 1e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 4e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 9e-06 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 9e-06 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 6e-08 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 8e-08 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 3e-06 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 1e-06 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 2e-06 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 3e-06 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 2e-06 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 4e-06 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 1e-05 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 1e-05 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 4e-04 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 7e-04 |
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
Score = 69.7 bits (170), Expect = 2e-14
Identities = 28/129 (21%), Positives = 45/129 (34%), Gaps = 4/129 (3%)
Query: 14 RSGTPRLQYLQELVSQFQNSTDEERKEKIVAN----LANFAYDPYNYTFLRQLNVLELFL 69
Q + Q + R E+IV L A D +N +R LN + LF+
Sbjct: 540 VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEACTGALHILARDIHNRIVIRGLNTIPLFV 599
Query: 70 DCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNHALGALY 129
+ P E + G +C + D A I G + E L S +A L+
Sbjct: 600 QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF 659
Query: 130 YLCSMSTKE 138
+ ++
Sbjct: 660 RMSEDKPQD 668
|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.61 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.61 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.59 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.56 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.54 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.53 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.53 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.51 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.5 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.49 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.49 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.45 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.41 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.37 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.37 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.3 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.3 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.3 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.29 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.29 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.28 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.28 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.26 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.26 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.21 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.2 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.2 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.2 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.18 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.15 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.11 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.09 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.01 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.0 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 98.97 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 98.89 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 98.63 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 98.54 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 98.48 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 97.72 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.7 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.48 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.47 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.38 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 97.22 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 97.19 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.04 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 96.76 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 96.68 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 96.58 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.38 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.34 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 96.2 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 96.19 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.15 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 95.87 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 95.7 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.69 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 95.3 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 95.1 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 94.39 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 94.34 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 94.02 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 93.74 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 93.63 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 93.49 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 93.41 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 93.28 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 92.62 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 92.28 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 91.53 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 91.45 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 91.25 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 91.13 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 89.01 | |
| 3u0r_A | 507 | Apoptosis inhibitor 5; heat repeat, armadillo repe | 88.96 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 84.71 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 83.42 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 81.21 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 80.41 |
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
Probab=99.61 E-value=1.3e-14 Score=112.58 Aligned_cols=151 Identities=19% Similarity=0.284 Sum_probs=126.9
Q ss_pred HHHHHHHHhhcCChHHHHHHHHHHhhhhc-cCcccHHHhhhccChHHHHhhhcCCcHHHHHHHHHHHHhhcC-CchhhHH
Q 030369 22 YLQELVSQFQNSTDEERKEKIVANLANFA-YDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASV-DPANAAI 99 (178)
Q Consensus 22 ylq~LV~efq~t~~~e~keqvlanLaNfA-yDP~N~~~LrqL~vidlfld~L~~~n~~l~EfAiggLcNL~~-D~~nk~~ 99 (178)
-+..||.-.+. ++.+.+++++..|+|++ .+|.+...+.+.|+++.++..|..+++.+++.|+++|+|+|. ++..+..
T Consensus 55 ~i~~L~~lL~~-~~~~v~~~a~~~L~~l~~~~~~~~~~i~~~g~i~~L~~lL~~~~~~v~~~a~~~L~~l~~~~~~~~~~ 133 (210)
T 4db6_A 55 ALPALVQLLSS-PNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 (210)
T ss_dssp HHHHHHHHTTC-SCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHTTCSCHHHHHHHHHHHHHHTTSCHHHHHH
T ss_pred CHHHHHHHHcC-CCHHHHHHHHHHHHHHhcCCcHHHHHHHHCCCHHHHHHHHcCCcHHHHHHHHHHHHHHHcCCHHHHHH
Confidence 35567766655 48899999999999999 589999999999999999999999999999999999999995 5777788
Q ss_pred hhhcCChhHHHHhhcCCchhHHHHHHHHHHHhcCC--cccccccchHHHHHHHHhhhhcccchhHHHhHHHHHHhhcc
Q 030369 100 ITKSGGIPLIIECLSSPVRNTVNHALGALYYLCSM--STKEEILKPEVVDVIRRYAAAESVNVSFSNLAKAFLDKHVT 175 (178)
Q Consensus 100 I~~~gGi~~li~lLsS~~~evv~~AlttL~~L~~~--~sr~~I~~p~ll~ll~~~~~~~~~~~~~~nla~~fL~~~~~ 175 (178)
+.+.|+++.|+++|++++++++.+|+.+|.+|+.. ..+..+.....++.|.+.-.++ +++++..|...|...++
T Consensus 134 ~~~~~~i~~L~~ll~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~L~~ll~~~--~~~v~~~a~~aL~~l~~ 209 (210)
T 4db6_A 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHE--NEKIQKEAQEALEKLQS 209 (210)
T ss_dssp HHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHGGGCS--CHHHHHHHHHHHHHHCC
T ss_pred HHHcCcHHHHHHHHcCCCHHHHHHHHHHHHHHHcCCcHHHHHHHHCCCHHHHHHHHhCC--CHHHHHHHHHHHHHHhc
Confidence 99999999999999999999999999999999965 3455555444555555554544 57899999999987764
|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 178 | ||||
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 2e-12 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 7e-10 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 5e-09 | |
| d1xm9a1 | 457 | a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo | 2e-06 | |
| d1xqra1 | 264 | a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp | 9e-05 |
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: beta-Catenin species: Human (Homo sapiens) [TaxId: 9606]
Score = 62.6 bits (150), Expect = 2e-12
Identities = 28/122 (22%), Positives = 43/122 (35%), Gaps = 4/122 (3%)
Query: 14 RSGTPRLQYLQELVSQFQNSTDEERKEKIVAN----LANFAYDPYNYTFLRQLNVLELFL 69
Q + Q + R E+IV L A D +N +R LN + LF+
Sbjct: 407 VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV 466
Query: 70 DCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNHALGALY 129
+ P E + G +C + D A I G + E L S +A L+
Sbjct: 467 QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF 526
Query: 130 YL 131
+
Sbjct: 527 RM 528
|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.31 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.28 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.23 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.2 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.19 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 98.9 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.55 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 96.88 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 96.52 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 95.77 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 95.49 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 95.07 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 94.16 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 93.62 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 92.99 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 92.91 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 92.7 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 92.06 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 91.93 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 90.67 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 89.84 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 89.69 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 88.55 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 88.49 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 86.41 |
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Plakophilin 1 helical region domain: Plakophilin 1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.44 E-value=5.1e-13 Score=106.24 Aligned_cols=110 Identities=18% Similarity=0.224 Sum_probs=99.2
Q ss_pred HHHHHHhhcCChHHHHHHHHHHhhhhcc-CcccHHHhhhccChHHHHhhhcCCcHHHHHHHHHHHHhhcC-CchhhHHhh
Q 030369 24 QELVSQFQNSTDEERKEKIVANLANFAY-DPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASV-DPANAAIIT 101 (178)
Q Consensus 24 q~LV~efq~t~~~e~keqvlanLaNfAy-DP~N~~~LrqL~vidlfld~L~~~n~~l~EfAiggLcNL~~-D~~nk~~I~ 101 (178)
+.||.=. .+++++.|..+...|.|.++ |+.|+..+++.|+|+.++.+|.++++.+++.|+++|+||+. ++.++..|.
T Consensus 5 p~lv~~L-~~~~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~~i~ 83 (457)
T d1xm9a1 5 PKAVQYL-SSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETR 83 (457)
T ss_dssp HHHHHHH-HSSCTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHH
T ss_pred HHHHHHh-CCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCHHHHHHHH
Confidence 4455544 57789999999999999996 69999999999999999999999999999999999999995 688999999
Q ss_pred hcCChhHHHHhh-cCCchhHHHHHHHHHHHhcCC
Q 030369 102 KSGGIPLIIECL-SSPVRNTVNHALGALYYLCSM 134 (178)
Q Consensus 102 ~~gGi~~li~lL-sS~~~evv~~AlttL~~L~~~ 134 (178)
+.||++.+++++ ++.++++...|..+|.+|...
T Consensus 84 ~~g~v~~li~~l~~~~~~~~~~~a~~~l~~l~~~ 117 (457)
T d1xm9a1 84 RQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSST 117 (457)
T ss_dssp HTTCHHHHHHHHTTCCCHHHHHHHHHHHHHHHTS
T ss_pred HCCChHHHHHHHhccCcHHHHHHHHHHHHHHHhh
Confidence 999999999998 456788999999999999876
|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|