Citrus Sinensis ID: 030372

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MVAVCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEETVKRPCSP

ccccccccccccccccccccccEEEEEEEEEEEEcccccccccccEEEEEEEEEcccccEEEccccccccccHHHHHHHHHHHHHccccccccccEEEEEEEcccccEEEEEEEEEEEEccccccccccccEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccc

ccEEEEEEccccccEEEcccccEEEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEccccccccccHHHHHHHHHHHHcccEEEEEccccEEEcccccccccEEEEEEEEEEEHHHHcccHHcccccEEEcHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccc

MVAVCLvsrtgrqlqrydnmgrrqvvgcvpyryktgdgagnvvDDIEVLVITSqkgsqgmmfpkggwelDETVKEAALRESFEeagvmgnvehelgkwnflsksrgtfyegymfpLLVTEQlelwpekdvrQRIWMSVAEAREACRHGWMKEALDILVERLSSRVqqkeetvkrpcsp

mvavclvsrtgrqlqrydnmgrrqvvGCVPYRYKTgdgagnvvdDIEVLVITsqkgsqgmmfpkgGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLssrvqqkeetvkrpcsp

MVAVCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEETVKRPCSP

**AVCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVER******************

****************YDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILV********************

MVAVCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSR**************

*VAVCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSR**************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVAVCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMxxxxxxxxxxxxxxxxxxxxxVKRPCSP

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		178	2.2.26 [Sep-21-2011]
Q9ZU95		182	Nudix hydrolase 17, mitoc	yes	no	0.921	0.901	0.742	5e-67
Q9LQU5		176	Nudix hydrolase 18, mitoc	no	no	0.876	0.886	0.729	3e-62
Q8VY81		198	Nudix hydrolase 21, chlor	no	no	0.853	0.767	0.566	2e-49
Q9LE73		207	Nudix hydrolase 4 OS=Arab	no	no	0.865	0.743	0.574	4e-48
Q93ZY7		203	Nudix hydrolase 12, mitoc	no	no	0.926	0.812	0.475	2e-32
Q52K88		202	Nudix hydrolase 13, mitoc	no	no	0.926	0.816	0.45	1e-30
Q9LHK1		180	Nudix hydrolase 16, mitoc	no	no	0.825	0.816	0.490	4e-27
Q09790		210	Diphosphoinositol polypho	yes	no	0.752	0.638	0.303	4e-11
Q58CW0		164	Diphosphoinositol polypho	yes	no	0.651	0.707	0.348	9e-08
P0C028		164	Diphosphoinositol polypho	yes	no	0.651	0.707	0.325	9e-08

>sp\|Q9ZU95\|NUD17_ARATH Nudix hydrolase 17, mitochondrial OS=Arabidopsis thaliana GN=NUDT17 PE=2 SV=1	Back alignment and function desciption

 Score =  253 bits (646), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (85%), Gaps = 3/167 (1%)

Query: 4   VCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFP 63
           VCL SRTGRQ QRY N GRRQVVGCVPYR+K  +  G + D++EVLVI+SQKG   +MFP
Sbjct: 7   VCLASRTGRQFQRY-NKGRRQVVGCVPYRFKLSND-GKISDEVEVLVISSQKG-HALMFP 63

Query: 64  KGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLE 123
           KGGWELDE+V+EAA RE  EEAGV+GNVEH+LGKW+FLSKSRGT+YEG MFP+LVTEQLE
Sbjct: 64  KGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKSRGTYYEGLMFPMLVTEQLE 123

Query: 124 LWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEE 170
           LWPE+ VRQRIWM+V EAREACR  WMKEALD+LVERLSS + Q +E
Sbjct: 124 LWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLSSPMNQPKE 170

Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: -

>sp\|Q9LQU5\|NUD18_ARATH Nudix hydrolase 18, mitochondrial OS=Arabidopsis thaliana GN=NUDT18 PE=2 SV=1	Back alignment and function description

>sp\|Q8VY81\|NUD21_ARATH Nudix hydrolase 21, chloroplastic OS=Arabidopsis thaliana GN=NUDT21 PE=2 SV=1	Back alignment and function description

>sp\|Q9LE73\|NUDT4_ARATH Nudix hydrolase 4 OS=Arabidopsis thaliana GN=NUDT4 PE=1 SV=1	Back alignment and function description

>sp\|Q93ZY7\|NUD12_ARATH Nudix hydrolase 12, mitochondrial OS=Arabidopsis thaliana GN=NUDT12 PE=2 SV=1	Back alignment and function description

>sp\|Q52K88\|NUD13_ARATH Nudix hydrolase 13, mitochondrial OS=Arabidopsis thaliana GN=NUDT13 PE=1 SV=1	Back alignment and function description

>sp\|Q9LHK1\|NUD16_ARATH Nudix hydrolase 16, mitochondrial OS=Arabidopsis thaliana GN=NUDT16 PE=2 SV=1	Back alignment and function description

>sp\|Q09790\|APS1_SCHPO Diphosphoinositol polyphosphate phosphohydrolase aps1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aps1 PE=1 SV=1	Back alignment and function description

>sp\|Q58CW0\|NUD11_BOVIN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Bos taurus GN=NUDT11 PE=2 SV=2	Back alignment and function description

>sp\|P0C028\|NUD11_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Mus musculus GN=Nudt11 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		178
255570057		175	diphosphoinositol polyphosphate phosphoh	0.943	0.96	0.775	9e-71
224108287		176	predicted protein [Populus trichocarpa]	0.943	0.954	0.758	6e-68
224101879		171	predicted protein [Populus trichocarpa]	0.932	0.970	0.75	7e-67
18379275		182	nudix hydrolase 17 [Arabidopsis thaliana	0.921	0.901	0.742	2e-65
21595695		177	unknown [Arabidopsis thaliana]	0.921	0.926	0.742	3e-65
297817774		182	hypothetical protein ARALYDRAFT_904375 [	0.921	0.901	0.736	2e-64
388492880		170	unknown [Lotus japonicus]	0.921	0.964	0.698	1e-62
351727819		171	uncharacterized protein LOC100527186 [Gl	0.921	0.959	0.686	2e-62
449466253		174	PREDICTED: nudix hydrolase 17, mitochond	0.887	0.908	0.710	5e-62
449523021		174	PREDICTED: nudix hydrolase 17, mitochond	0.887	0.908	0.710	5e-62

>gi\|255570057\|ref\|XP_002525991.1\| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] gi\|223534723\|gb\|EEF36415.1\| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 131/169 (77%), Positives = 146/169 (86%), Gaps = 1/169 (0%)

Query: 4   VCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFP 63
            CLVSR+GR+LQRYDN GRRQVVGC+PYRYK     G+  D++EVLVITSQKG QGMMFP
Sbjct: 2   ACLVSRSGRELQRYDNQGRRQVVGCIPYRYKNSSD-GSFSDELEVLVITSQKGGQGMMFP 60

Query: 64  KGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLE 123
           KGGWELDE+V+EAA RES EEAGV+G+VE ELGKWNFLSK  GTFYEGYMFPLLVTEQL+
Sbjct: 61  KGGWELDESVEEAASRESLEEAGVLGHVEDELGKWNFLSKRHGTFYEGYMFPLLVTEQLD 120

Query: 124 LWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEETV 172
            WPEKDVRQRIWM VAEAR+ACRH WMKEALDILV RL+S  ++ EE V
Sbjct: 121 FWPEKDVRQRIWMPVAEARDACRHWWMKEALDILVGRLTSLQRRTEENV 169

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224108287\|ref\|XP_002314788.1\| predicted protein [Populus trichocarpa] gi\|222863828\|gb\|EEF00959.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224101879\|ref\|XP_002312457.1\| predicted protein [Populus trichocarpa] gi\|222852277\|gb\|EEE89824.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi|18379275|ref|NP_565273.1| nudix hydrolase 17 [Arabidopsis thaliana] gi|68565953|sp|Q9ZU95.1|NUD17_ARATH RecName: Full=Nudix hydrolase 17, mitochondrial; Short=AtNUDT17; Flags: Precursor gi|13272383|gb|AAK17130.1|AF325062_1 unknown protein [Arabidopsis thaliana] gi|13430438|gb|AAK25841.1|AF360131_1 unknown protein [Arabidopsis thaliana] gi|15724326|gb|AAL06556.1|AF412103_1 At2g01670/T8O11.16 [Arabidopsis thaliana] gi|4220481|gb|AAD12704.1| expressed protein [Arabidopsis thaliana] gi|15293193|gb|AAK93707.1| unknown protein [Arabidopsis thaliana] gi|330250389|gb|AEC05483.1| nudix hydrolase 17 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|21595695\|gb\|AAM66124.1\| unknown [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297817774\|ref\|XP_002876770.1\| hypothetical protein ARALYDRAFT_904375 [Arabidopsis lyrata subsp. lyrata] gi\|297322608\|gb\|EFH53029.1\| hypothetical protein ARALYDRAFT_904375 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|388492880\|gb\|AFK34506.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|351727819\|ref\|NP_001236150.1\| uncharacterized protein LOC100527186 [Glycine max] gi\|255631740\|gb\|ACU16237.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|449466253\|ref\|XP_004150841.1\| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449523021\|ref\|XP_004168523.1\| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		178
TAIR\|locus:2065440		182	NUDT17 "nudix hydrolase homolo	0.921	0.901	0.75	4.7e-64
TAIR\|locus:2006817		176	NUDT18 "nudix hydrolase homolo	0.876	0.886	0.729	1.3e-59
TAIR\|locus:2206835		198	NUDT21 "nudix hydrolase homolo	0.853	0.767	0.573	1.4e-46
TAIR\|locus:2014164		207	NUDT4 "nudix hydrolase homolog	0.865	0.743	0.574	1.8e-46
TAIR\|locus:2091275		180	NUDT16 "nudix hydrolase homolo	0.837	0.827	0.5	1.5e-33
TAIR\|locus:2010331		203	NUDT12 "nudix hydrolase homolo	0.926	0.812	0.480	4.1e-33
TAIR\|locus:2090842		202	NUDX13 "nudix hydrolase homolo	0.926	0.816	0.455	2.6e-31
UNIPROTKB\|G4MKT5		168	MGG_06680 "Nudix/MutT family p	0.769	0.815	0.354	1.6e-17
POMBASE\|SPAC13G6.14		210	aps1 "diadenosine 5',5'''-p1,p	0.466	0.395	0.361	4.5e-15
ASPGD\|ASPL0000000420		159	ndxD [Emericella nidulans (tax	0.696	0.779	0.337	2.7e-13

TAIR\|locus:2065440 NUDT17 "nudix hydrolase homolog 17" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 653 (234.9 bits), Expect = 4.7e-64, P = 4.7e-64
 Identities = 126/168 (75%), Positives = 144/168 (85%)

Query:     4 VCLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFP 63
             VCL SRTGRQ QRY N GRRQVVGCVPYR+K  +  G + D++EVLVI+SQKG   +MFP
Sbjct:     7 VCLASRTGRQFQRY-NKGRRQVVGCVPYRFKLSND-GKISDEVEVLVISSQKG-HALMFP 63

Query:    64 KGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLE 123
             KGGWELDE+V+EAA RE  EEAGV+GNVEH+LGKW+FLSKSRGT+YEG MFP+LVTEQLE
Sbjct:    64 KGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKSRGTYYEGLMFPMLVTEQLE 123

Query:   124 LWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQ-KEE 170
             LWPE+ VRQRIWM+V EAREACR  WMKEALD+LVERLSS + Q KEE
Sbjct:   124 LWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLSSPMNQPKEE 171

GO:0005739 "mitochondrion" evidence=ISM

GO:0016787 "hydrolase activity" evidence=IEA;ISS

TAIR\|locus:2006817 NUDT18 "nudix hydrolase homolog 18" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2206835 NUDT21 "nudix hydrolase homolog 21" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2014164 NUDT4 "nudix hydrolase homolog 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2091275 NUDT16 "nudix hydrolase homolog 16" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2010331 NUDT12 "nudix hydrolase homolog 12" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2090842 NUDX13 "nudix hydrolase homolog 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|G4MKT5 MGG_06680 "Nudix/MutT family protein" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

POMBASE\|SPAC13G6.14 aps1 "diadenosine 5',5'''-p1,p6-hexaphosphate hydrolase Aps1" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000000420 ndxD [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LQU5	NUD18_ARATH	3, ., 6, ., 1, ., -	0.7295	0.8764	0.8863	no	no
Q9ZU95	NUD17_ARATH	3, ., 6, ., 1, ., -	0.7425	0.9213	0.9010	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.1	0.921
3rd Layer	3.6.1.13	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		178
cd04666		122	cd04666, Nudix_Hydrolase_9, Members of the Nudix h	3e-38
pfam00293		133	pfam00293, NUDIX, NUDIX domain	5e-14
cd02883		123	cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup	5e-10
cd03428		130	cd03428, Ap4A_hydrolase_human_like, Diadenosine te	4e-07
cd03673		131	cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate	2e-05
COG0494		161	COG0494, MutT, NTP pyrophosphohydrolases including	2e-04
cd04511		130	cd04511, Nudix_Hydrolase_4, Members of the Nudix h	4e-04
cd03424		137	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase	7e-04
cd03675		134	cd03675, Nudix_Hydrolase_2, Contains a crystal str	7e-04
cd03671		147	cd03671, Ap4A_hydrolase_plant_like, Diadenosine te	0.001
cd04670		127	cd04670, Nudix_Hydrolase_12, Members of the Nudix	0.001
COG1051		145	COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl	0.002
cd04687		128	cd04687, Nudix_Hydrolase_28, Members of the Nudix	0.004

>gnl\|CDD\|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

 Score =  126 bits (320), Expect = 3e-38
 Identities = 49/131 (37%), Positives = 72/131 (54%), Gaps = 12/131 (9%)

Query: 24  QVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFE 83
              G +PYR   G+        +EVL++TS++ +   + PKGG E DE+  EAA RE++E
Sbjct: 1   LQAGAIPYRETGGE--------VEVLLVTSRR-TGRWIVPKGGPEKDESPAEAAAREAWE 51

Query: 84  EAGVMGNVEH-ELGKWNFLSKSRGTF--YEGYMFPLLVTEQLELWPEKDVRQRIWMSVAE 140
           EAGV G +    LG++ +  +S+      E  +FPL VTE+L+ WPE   R+R W S  E
Sbjct: 52  EAGVRGKIGKRPLGRFEYRKRSKNRPPRCEVAVFPLEVTEELDEWPEMHQRKRKWFSPEE 111

Query: 141 AREACRHGWMK 151
           A        +K
Sbjct: 112 AALLVEEPELK 122

Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. Length = 122

>gnl\|CDD\|215841 pfam00293, NUDIX, NUDIX domain	Back alignment and domain information

>gnl\|CDD\|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|239948 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate	Back alignment and domain information

>gnl\|CDD\|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function	Back alignment and domain information

>gnl\|CDD\|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>gnl\|CDD\|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>gnl\|CDD\|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240043 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		178
KOG2839		145	consensus Diadenosine and diphosphoinositol polyph	99.92
cd03673		131	Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy	99.92
cd04666		122	Nudix_Hydrolase_9 Members of the Nudix hydrolase s	99.92
cd03428		130	Ap4A_hydrolase_human_like Diadenosine tetraphospha	99.9
PRK09438		148	nudB dihydroneopterin triphosphate pyrophosphatase	99.89
cd04695		131	Nudix_Hydrolase_36 Members of the Nudix hydrolase	99.88
cd04684		128	Nudix_Hydrolase_25 Contains a crystal structure of	99.88
cd03675		134	Nudix_Hydrolase_2 Contains a crystal structure of	99.88
cd04679		125	Nudix_Hydrolase_20 Members of the Nudix hydrolase	99.88
cd03674		138	Nudix_Hydrolase_1 Members of the Nudix hydrolase s	99.86
cd03427		137	MTH1 MutT homolog-1 (MTH1) is a member of the Nudi	99.86
PF00293		134	NUDIX: NUDIX domain; InterPro: IPR000086 The gener	99.86
COG1051		145	ADP-ribose pyrophosphatase [Nucleotide transport a	99.86
cd03430		144	GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann	99.85
PRK15434		159	GDP-mannose mannosyl hydrolase NudD; Provisional	99.85
cd04664		129	Nudix_Hydrolase_7 Members of the Nudix hydrolase s	99.85
cd04673		122	Nudix_Hydrolase_15 Members of the Nudix hydrolase	99.85
cd04700		142	DR1025_like DR1025 from Deinococcus radiodurans, a	99.85
cd04687		128	Nudix_Hydrolase_28 Members of the Nudix hydrolase	99.85
cd03672		145	Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt	99.85
cd04681		130	Nudix_Hydrolase_22 Members of the Nudix hydrolase	99.84
PLN02325		144	nudix hydrolase	99.84
cd04696		125	Nudix_Hydrolase_37 Members of the Nudix hydrolase	99.84
cd04680		120	Nudix_Hydrolase_21 Members of the Nudix hydrolase	99.84
cd04672		123	Nudix_Hydrolase_14 Members of the Nudix hydrolase	99.84
cd04689		125	Nudix_Hydrolase_30 Members of the Nudix hydrolase	99.84
cd04688		126	Nudix_Hydrolase_29 Members of the Nudix hydrolase	99.84
cd04670		127	Nudix_Hydrolase_12 Members of the Nudix hydrolase	99.83
cd03671		147	Ap4A_hydrolase_plant_like Diadenosine tetraphospha	99.83
cd04678		129	Nudix_Hydrolase_19 Members of the Nudix hydrolase	99.83
cd04676		129	Nudix_Hydrolase_17 Members of the Nudix hydrolase	99.83
cd04667		112	Nudix_Hydrolase_10 Members of the Nudix hydrolase	99.82
cd04677		132	Nudix_Hydrolase_18 Members of the Nudix hydrolase	99.82
PRK15472		141	nucleoside triphosphatase NudI; Provisional	99.82
cd04511		130	Nudix_Hydrolase_4 Members of the Nudix hydrolase s	99.82
cd04669		121	Nudix_Hydrolase_11 Members of the Nudix hydrolase	99.82
cd04690		118	Nudix_Hydrolase_31 Members of the Nudix hydrolase	99.81
cd04683		120	Nudix_Hydrolase_24 Members of the Nudix hydrolase	99.81
cd04691		117	Nudix_Hydrolase_32 Members of the Nudix hydrolase	99.81
cd03424		137	ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase)	99.81
PRK10546		135	pyrimidine (deoxy)nucleoside triphosphate pyrophos	99.81
cd04682		122	Nudix_Hydrolase_23 Members of the Nudix hydrolase	99.8
cd03429		131	NADH_pyrophosphatase NADH pyrophosphatase, a membe	99.8
cd04686		131	Nudix_Hydrolase_27 Members of the Nudix hydrolase	99.8
PRK00241		256	nudC NADH pyrophosphatase; Reviewed	99.79
cd03426		157	CoAse Coenzyme A pyrophosphatase (CoAse), a member	99.79
cd04671		123	Nudix_Hydrolase_13 Members of the Nudix hydrolase	99.79
PRK00714		156	RNA pyrophosphohydrolase; Reviewed	99.78
cd04661		132	MRP_L46 Mitochondrial ribosomal protein L46 (MRP L	99.78
cd04693		127	Nudix_Hydrolase_34 Members of the Nudix hydrolase	99.77
PRK05379		340	bifunctional nicotinamide mononucleotide adenylylt	99.77
cd04692		144	Nudix_Hydrolase_33 Members of the Nudix hydrolase	99.76
cd04697		126	Nudix_Hydrolase_38 Members of the Nudix hydrolase	99.76
cd02885		165	IPP_Isomerase Isopentenyl diphosphate (IPP) isomer	99.75
cd04699		129	Nudix_Hydrolase_39 Members of the Nudix hydrolase	99.75
cd04662		126	Nudix_Hydrolase_5 Members of the Nudix hydrolase s	99.74
PRK15393		180	NUDIX hydrolase YfcD; Provisional	99.73
PRK10776		129	nucleoside triphosphate pyrophosphohydrolase; Prov	99.73
cd02883		123	Nudix_Hydrolase Nudix hydrolase is a superfamily o	99.73
cd03425		124	MutT_pyrophosphohydrolase The MutT pyrophosphohydr	99.72
PRK11762		185	nudE adenosine nucleotide hydrolase NudE; Provisio	99.71
PRK03759		184	isopentenyl-diphosphate delta-isomerase; Provision	99.71
TIGR00586		128	mutt mutator mutT protein. All proteins in this fa	99.71
cd04665		118	Nudix_Hydrolase_8 Members of the Nudix hydrolase s	99.71
cd04694		143	Nudix_Hydrolase_35 Members of the Nudix hydrolase	99.7
TIGR00052		185	nudix-type nucleoside diphosphatase, YffH/AdpP fam	99.69
TIGR02705		156	nudix_YtkD nucleoside triphosphatase YtkD. The fun	99.68
PRK10729		202	nudF ADP-ribose pyrophosphatase NudF; Provisional	99.68
TIGR02150		158	IPP_isom_1 isopentenyl-diphosphate delta-isomerase	99.68
PRK10707		190	putative NUDIX hydrolase; Provisional	99.67
cd04685		133	Nudix_Hydrolase_26 Members of the Nudix hydrolase	99.67
cd03676		180	Nudix_hydrolase_3 Members of the Nudix hydrolase s	99.64
cd03670		186	ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase)	99.62
PRK15009		191	GDP-mannose pyrophosphatase NudK; Provisional	99.62
cd04674		118	Nudix_Hydrolase_16 Members of the Nudix hydrolase	99.62
cd04663		126	Nudix_Hydrolase_6 Members of the Nudix hydrolase s	99.61
PRK08999		312	hypothetical protein; Provisional	99.59
COG2816		279	NPY1 NTP pyrophosphohydrolases containing a Zn-fin	99.55
PLN03143		291	nudix hydrolase; Provisional	99.55
PLN02709		222	nudix hydrolase	99.52
KOG3084		345	consensus NADH pyrophosphatase I of the Nudix fami	99.44
PLN02552		247	isopentenyl-diphosphate delta-isomerase	99.43
COG0494		161	MutT NTP pyrophosphohydrolases including oxidative	99.43
COG4119		161	Predicted NTP pyrophosphohydrolase [DNA replicatio	99.32
PLN02791		770	Nudix hydrolase homolog	99.27
KOG3041		225	consensus Nucleoside diphosphate-sugar hydrolase o	99.18
KOG3069		246	consensus Peroxisomal NUDIX hydrolase [Replication	99.02
cd03431		118	DNA_Glycosylase_C DNA glycosylase (MutY in bacteri	99.01
KOG0648		295	consensus Predicted NUDIX hydrolase FGF-2 and rela	98.87
PLN02839		372	nudix hydrolase	98.73
COG1443		185	Idi Isopentenyldiphosphate isomerase [Lipid metabo	98.5
PF14815		114	NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3	98.1
KOG4195		275	consensus Transient receptor potential-related cha	97.96
KOG2937		348	consensus Decapping enzyme complex, predicted pyro	97.7
PF13869		188	NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B	97.61
COG4112		203	Predicted phosphoesterase (MutT family) [General f	97.26
KOG1689		221	consensus mRNA cleavage factor I subunit [RNA proc	96.88
KOG4432		405	consensus Uncharacterized NUDIX family hydrolase [	96.83
KOG0142		225	consensus Isopentenyl pyrophosphate:dimethylallyl	96.4
KOG4548		263	consensus Mitochondrial ribosomal protein L17 [Tra	96.39
KOG4432		405	consensus Uncharacterized NUDIX family hydrolase [	96.25
KOG4313		306	consensus Thiamine pyrophosphokinase [Nucleotide t	95.91
PRK10880		350	adenine DNA glycosylase; Provisional	94.97
PRK13910		289	DNA glycosylase MutY; Provisional	84.38

>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms]	Back alignment and domain information

Probab=99.92  E-value=1.3e-24  Score=155.52  Aligned_cols=140  Identities=49%  Similarity=0.822  Sum_probs=117.9

Q ss_pred             eeecCCCceEEEEEEEEEeecCCCCCCcCCCeEEEEEEeeCCCCCEEeccccCCCCCCHHHHHHHHHhhhhceeeccce-
Q 030372           15 QRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEH-   93 (178)
Q Consensus        15 ~~~~~~~~r~~~g~i~~~~~~~~~~~~~~~~~~vLLv~~~~~~~~W~lPgG~ve~gEs~~eaa~REv~EEtGl~~~~~~-   93 (178)
                      ++|++..+|.++|||+|+.+        +...+||||+..+.+..|.+|+|+++++||..+||+||+.||.|+...... 
T Consensus         1 qry~~~G~r~vagCi~~r~~--------~~~ieVLlvsSs~~~~~wi~PKGGwE~dE~~~eAA~REt~EEAGv~G~l~~~   72 (145)
T KOG2839|consen    1 QRYDPAGFRLVAGCICYRSD--------KEKIEVLLVSSSKKPHRWIVPKGGWEPDESVEEAALRETWEEAGVKGKLGRL   72 (145)
T ss_pred             CccCCCCcEEEEEeeeeeec--------CcceEEEEEecCCCCCCccCCCCCCCCCCCHHHHHHHHHHHHhCceeeeecc
Confidence            46776689999999999988        345799999988865889999999999999999999999999999998886 


Q ss_pred             eeeEEEeeecCCCcEEEEEEEEEEeccccccCCccc--eeeeEEEeHHHHHHHhccchHHHHHHHHHHHHh
Q 030372           94 ELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKD--VRQRIWMSVAEAREACRHGWMKEALDILVERLS  162 (178)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e--~~~~~W~~~~el~~~~~~~~~~~~l~~~~~~l~  162 (178)
                      +.+...+.+....+.+..+.|.+.+......+|+.+  ..+..|+.++|+...+.+..|+.++..+++.+.
T Consensus        73 ~~g~~~~~~~~~~~~~k~~~~~l~v~e~le~wp~~~~~~r~r~W~~ledA~~~~~~~~m~~al~e~~~~l~  143 (145)
T KOG2839|consen   73 LGGFEDFLSKKHRTKPKGVMYVLAVTEELEDWPESEHEFREREWLKLEDAIELCQHKWMKAALEEFLQFLC  143 (145)
T ss_pred             ccchhhccChhhcccccceeehhhhhhhcccChhhhcccceeEEeeHHHHHHHHhhHHHHHHHHHHHHHhc
Confidence            444444665555556677888888877666677665  788899999999999999999999999988764

>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional	Back alignment and domain information

>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function	Back alignment and domain information

>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function	Back alignment and domain information

>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family []	Back alignment and domain information

>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional	Back alignment and domain information

>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities	Back alignment and domain information

>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex	Back alignment and domain information

>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PLN02325 nudix hydrolase	Back alignment and domain information

>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK15472 nucleoside triphosphatase NudI; Provisional	Back alignment and domain information

>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate	Back alignment and domain information

>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional	Back alignment and domain information

>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP	Back alignment and domain information

>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK00241 nudC NADH pyrophosphatase; Reviewed	Back alignment and domain information

>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes	Back alignment and domain information

>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK00714 RNA pyrophosphohydrolase; Reviewed	Back alignment and domain information

>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional	Back alignment and domain information

>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway	Back alignment and domain information

>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK15393 NUDIX hydrolase YfcD; Provisional	Back alignment and domain information

>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional	Back alignment and domain information

>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi)	Back alignment and domain information

>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional	Back alignment and domain information

>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional	Back alignment and domain information

>TIGR00586 mutt mutator mutT protein	Back alignment and domain information

>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family	Back alignment and domain information

>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD	Back alignment and domain information

>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional	Back alignment and domain information

>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1	Back alignment and domain information

>PRK10707 putative NUDIX hydrolase; Provisional	Back alignment and domain information

>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P	Back alignment and domain information

>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional	Back alignment and domain information

>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03143 nudix hydrolase; Provisional	Back alignment and domain information

>PLN02709 nudix hydrolase	Back alignment and domain information

>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair]	Back alignment and domain information

>PLN02552 isopentenyl-diphosphate delta-isomerase	Back alignment and domain information

>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only]	Back alignment and domain information

>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only]	Back alignment and domain information

>PLN02791 Nudix hydrolase homolog	Back alignment and domain information

>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair]	Back alignment and domain information

>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair]	Back alignment and domain information

>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread AoxoG residues to CG by removing the inappropriately paired adenine base from the DNA backbone	Back alignment and domain information

>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PLN02839 nudix hydrolase	Back alignment and domain information

>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism]	Back alignment and domain information

>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A	Back alignment and domain information

>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification]	Back alignment and domain information

>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A	Back alignment and domain information

>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only]	Back alignment and domain information

>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification]	Back alignment and domain information

>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only]	Back alignment and domain information

>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only]	Back alignment and domain information

>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK10880 adenine DNA glycosylase; Provisional	Back alignment and domain information

>PRK13910 DNA glycosylase MutY; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		178
2duk_A		138	Crystal Structure Of Ms0616 Length = 138		7e-08
2fvv_A		194	Human Diphosphoinositol Polyphosphate Phosphohydrol		2e-07
3mcf_A		136	Crystal Structure Of Human Diphosphoinositol Polyph		2e-06
3i7u_A		134	Crystal Structure Of Ap4a Hydrolase (Aq_158) From A		7e-04

>pdb|2DUK|A Chain A, Crystal Structure Of Ms0616 Length = 138

Back alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 43/128 (33%), Positives = 63/128 (49%), Gaps = 17/128 (13%) Query: 17 YDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEA 76 YD G ++ C+ +R + D EVL+++S + + P GG E +E A Sbjct: 4 YDREGFKKRAACLCFRSEQED---------EVLLVSSSRYPDQWIVPGGGMEPEEEPGGA 54 Query: 77 ALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLELWPEKDV---RQR 133 A+RE +EEAGV G + LG + + T Y++ L VTE LE W E V R+R Sbjct: 55 AVREVYEEAGVKGKLGRLLGIFENQDRKHRT----YVYVLTVTEILEDW-EDSVNIGRKR 109 Query: 134 IWMSVAEA 141 W V +A Sbjct: 110 EWFKVEDA 117

PyMOL of 2duk

>pdb|2FVV|A Chain A, Human Diphosphoinositol Polyphosphate Phosphohydrolase 1 Length = 194

Back alignment and structure

>pdb|3MCF|A Chain A, Crystal Structure Of Human Diphosphoinositol Polyphosphate Phosphohydrolase 3-Alpha Length = 136

Back alignment and structure

>pdb|3I7U|A Chain A, Crystal Structure Of Ap4a Hydrolase (Aq_158) From Aquifex Aeolicus Vf5 Length = 134

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		178
2fvv_A		194	Diphosphoinositol polyphosphate phosphohydrolase 1	7e-37
1xsa_A		153	BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme,	5e-18
2pbt_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	7e-15
1vcd_A		126	NDX1; nudix protein, diadenosine polyphosphate, AP	6e-12
2a6t_A		271	SPAC19A8.12; alpha/beta/alpha, RNA binding protein	9e-11
3shd_A		153	Phosphatase NUDJ; nudix fold, nudix motif, hydrola	7e-10
1ktg_A		138	Diadenosine tetraphosphate hydrolase; nudix, AMP,	3e-09
2b0v_A		153	Nudix hydrolase; structural genomics, PSI, protein	4e-09
2azw_A		148	MUTT/nudix family protein; MUTT/nudix ,enterococcu	7e-09
3son_A		149	Hypothetical nudix hydrolase; structural genomics,	1e-08
2jvb_A		146	Protein PSU1, mRNA-decapping enzyme subunit 2; DCP	2e-08
3fk9_A		188	Mutator MUTT protein; structural genomics, hydrola	2e-07
3fjy_A		364	Probable MUTT1 protein; dimer, protein structure i	2e-07
3gg6_A		156	Nudix motif 18, nucleoside diphosphate-linked moie	6e-07
3h95_A		199	Nucleoside diphosphate-linked moiety X motif 6; NU	2e-05
1k2e_A		156	Nudix homolog; nudix/MUTT-like fold, mixed alpha/b	4e-05
3o8s_A		206	Nudix hydrolase, ADP-ribose pyrophosphatase; struc	5e-05
3i9x_A		187	MUTT/nudix family protein; structural genomics, hy	8e-05
3fcm_A		197	Hydrolase, nudix family; protein structure initiat	1e-04
2fkb_A		180	Putative nudix hydrolase YFCD; putative protein, M	1e-04
3q1p_A		205	Phosphohydrolase (MUTT/nudix family protein); asym	1e-04
3eds_A		153	MUTT/nudix family protein; MUT/nudix protein, prot	2e-04
2pqv_A		154	MUTT/nudix family protein; structu genomics, PSI-2	2e-04
3exq_A		161	Nudix family hydrolase; protein structure initiati	3e-04
3cng_A		189	Nudix hydrolase; structural genomics, APC7497, PSI	4e-04
1vhz_A		198	ADP compounds hydrolase NUDE; structural genomics;	4e-04
3id9_A		171	MUTT/nudix family protein; hydrolase, protein stru	4e-04
3f13_A		163	Putative nudix hydrolase family member; structural	4e-04
1rya_A		160	GDP-mannose mannosyl hydrolase; GDP-glucose, nudix	4e-04
1sjy_A		159	MUTT/nudix family protein; nudix fold, alpha-beta-	5e-04
2qjt_B		352	Nicotinamide-nucleotide adenylyltransferase; two i	5e-04
2w4e_A		145	MUTT/nudix family protein; ADP-ribose pyrophosphat	6e-04
1nqz_A		194	COA pyrophosphatase (MUTT/nudix family protein); D	6e-04
3q93_A		176	7,8-dihydro-8-oxoguanine triphosphatase; structura	6e-04
3dup_A		300	MUTT/nudix family protein; nudix superfamily hydro	7e-04
2yyh_A		139	MUTT domain, 8-OXO-DGTPase domain; nudix family pr	8e-04
2yvp_A		182	NDX2, MUTT/nudix family protein; nudix protein, AD	9e-04

>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194	Back alignment and structure

 Score =  125 bits (314), Expect = 7e-37
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 17/170 (10%)

Query: 5   CLVSRTGRQLQRYDNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPK 64
            ++     Q + YD  G ++   C+ +R ++        ++  +LV +S+      + P 
Sbjct: 22  SMMKLKSNQTRTYDGDGYKKRAACLCFRSES--------EEEVLLVSSSRHP-DRWIVPG 72

Query: 65  GGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLVTEQLEL 124
           GG E +E    AA+RE  EEAGV G +   +G +    +   T    Y++ L+VTE LE 
Sbjct: 73  GGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRT----YVYVLIVTEVLED 128

Query: 125 WPE--KDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEETV 172
           W +     R+R W  + +A +  ++    +A     E L         T 
Sbjct: 129 WEDSVNIGRKREWFKIEDAIKVLQYHKPVQAS--YFETLRQGYSANNGTP 176

PyMOL of 2fvv

>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153	Back alignment and structure

>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126	Back alignment and structure

>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271	Back alignment and structure

>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153	Back alignment and structure

>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138	Back alignment and structure

>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153	Back alignment and structure

>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148	Back alignment and structure

>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149	Back alignment and structure

>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146	Back alignment and structure

>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188	Back alignment and structure

>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364	Back alignment and structure

>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156	Back alignment and structure

>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199	Back alignment and structure

>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156	Back alignment and structure

>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206	Back alignment and structure

>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187	Back alignment and structure

>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197	Back alignment and structure

>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180	Back alignment and structure

>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205	Back alignment and structure

>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154	Back alignment and structure

>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161	Back alignment and structure

>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189	Back alignment and structure

>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198	Back alignment and structure

>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171	Back alignment and structure

>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163	Back alignment and structure

>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160	Back alignment and structure

>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159	Back alignment and structure

>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352	Back alignment and structure

>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145	Back alignment and structure

>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194	Back alignment and structure

>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176	Back alignment and structure

>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300	Back alignment and structure

>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139	Back alignment and structure

>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		178
3i7u_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	99.94
3u53_A		155	BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical];	99.93
1ktg_A		138	Diadenosine tetraphosphate hydrolase; nudix, AMP,	99.92
2pbt_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	99.9
3son_A		149	Hypothetical nudix hydrolase; structural genomics,	99.9
1vcd_A		126	NDX1; nudix protein, diadenosine polyphosphate, AP	99.89
3i9x_A		187	MUTT/nudix family protein; structural genomics, hy	99.88
3fcm_A		197	Hydrolase, nudix family; protein structure initiat	99.88
2b0v_A		153	Nudix hydrolase; structural genomics, PSI, protein	99.87
2yyh_A		139	MUTT domain, 8-OXO-DGTPase domain; nudix family pr	99.87
4dyw_A		157	MUTT/nudix family protein; structural genomics, ni	99.87
2o1c_A		150	DATP pyrophosphohydrolase; nudix NTP hydrolase NTP	99.87
3gz5_A		240	MUTT/nudix family protein; DNA binding protein, nu	99.87
3gwy_A		140	Putative CTP pyrophosphohydrolase; structural geno	99.86
3grn_A		153	MUTT related protein; structural genomics, hydrola	99.86
1sjy_A		159	MUTT/nudix family protein; nudix fold, alpha-beta-	99.86
3q1p_A		205	Phosphohydrolase (MUTT/nudix family protein); asym	99.86
3id9_A		171	MUTT/nudix family protein; hydrolase, protein stru	99.85
2azw_A		148	MUTT/nudix family protein; MUTT/nudix ,enterococcu	99.85
2fb1_A		226	Conserved hypothetical protein; structural genomic	99.85
3gg6_A		156	Nudix motif 18, nucleoside diphosphate-linked moie	99.85
3fjy_A		364	Probable MUTT1 protein; dimer, protein structure i	99.85
3shd_A		153	Phosphatase NUDJ; nudix fold, nudix motif, hydrola	99.85
3f6a_A		159	Hydrolase, nudix family; protein structure initiat	99.85
3q93_A		176	7,8-dihydro-8-oxoguanine triphosphatase; structura	99.85
3exq_A		161	Nudix family hydrolase; protein structure initiati	99.85
1k2e_A		156	Nudix homolog; nudix/MUTT-like fold, mixed alpha/b	99.85
3o8s_A		206	Nudix hydrolase, ADP-ribose pyrophosphatase; struc	99.85
2fvv_A		194	Diphosphoinositol polyphosphate phosphohydrolase 1	99.84
3cng_A		189	Nudix hydrolase; structural genomics, APC7497, PSI	99.84
1rya_A		160	GDP-mannose mannosyl hydrolase; GDP-glucose, nudix	99.84
3fk9_A		188	Mutator MUTT protein; structural genomics, hydrola	99.84
2rrk_A		140	ORF135, CTP pyrophosphohydrolase; NMR {Escherichia	99.83
2fkb_A		180	Putative nudix hydrolase YFCD; putative protein, M	99.83
2w4e_A		145	MUTT/nudix family protein; ADP-ribose pyrophosphat	99.83
3ees_A		153	Probable pyrophosphohydrolase; nudix, RNA pyrophos	99.83
3h95_A		199	Nucleoside diphosphate-linked moiety X motif 6; NU	99.82
3r03_A		144	Nudix hydrolase; structural genomics, PSI2, protei	99.82
2jvb_A		146	Protein PSU1, mRNA-decapping enzyme subunit 2; DCP	99.82
3oga_A		165	Nucleoside triphosphatase NUDI; salmonella enteric	99.82
2b06_A		155	MUTT/nudix family protein; structural genomics, P	99.82
1f3y_A		165	Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase	99.82
3hhj_A		158	Mutator MUTT protein; niaid, ssgcid, decode, UW, S	99.82
2pqv_A		154	MUTT/nudix family protein; structu genomics, PSI-2	99.81
3eds_A		153	MUTT/nudix family protein; MUT/nudix protein, prot	99.81
1hzt_A		190	Isopentenyl diphosphate delta-isomerase; dimethyla	99.81
2kdv_A		164	RNA pyrophosphohydrolase; nudix family, magnesium,	99.8
1vk6_A		269	NADH pyrophosphatase; 1790429, structural genomics	99.8
2qjt_B		352	Nicotinamide-nucleotide adenylyltransferase; two i	99.8
1v8y_A		170	ADP-ribose pyrophosphatase; nudix motif, loop-heli	99.8
2fml_A		273	MUTT/nudix family protein; structural genomics, PS	99.8
2yvp_A		182	NDX2, MUTT/nudix family protein; nudix protein, AD	99.8
3f13_A		163	Putative nudix hydrolase family member; structural	99.8
2qjo_A		341	Bifunctional NMN adenylyltransferase/nudix hydrol;	99.8
3e57_A		211	Uncharacterized protein TM1382; structural genomic	99.79
2a6t_A		271	SPAC19A8.12; alpha/beta/alpha, RNA binding protein	99.78
1mk1_A		207	ADPR pyrophosphatase; nudix hydrolase, adprase, ad	99.78
1nqz_A		194	COA pyrophosphatase (MUTT/nudix family protein); D	99.78
1q27_A		171	Putative nudix hydrolase DR0079; radiation resista	99.77
1vhz_A		198	ADP compounds hydrolase NUDE; structural genomics;	99.77
3o6z_A		191	GDP-mannose pyrophosphatase NUDK; nudix, hydrolase	99.77
1mut_A		129	MUTT, nucleoside triphosphate pyrophosphohydrolase	99.76
3q91_A		218	Uridine diphosphate glucose pyrophosphatase; struc	99.75
1g0s_A		209	Hypothetical 23.7 kDa protein in ICC-TOLC intergen	99.74
1x51_A		155	A/G-specific adenine DNA glycosylase; nudix domain	99.74
2dsc_A		212	ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP	99.74
1q33_A		292	Pyrophosphatase, ADP-ribose pyrophosphatase; nudix	99.7
1u20_A		212	U8 snoRNA-binding protein X29; modified nudix hydr	99.64
3fsp_A		369	A/G-specific adenine glycosylase; protein-DNA comp	99.63
2dho_A		235	Isopentenyl-diphosphate delta-isomerase 1; alpha/b	99.61
3qsj_A		232	Nudix hydrolase; structural genomics, PSI-biology,	99.6
2pny_A		246	Isopentenyl-diphosphate delta-isomerase 2; caroten	99.6
3dup_A		300	MUTT/nudix family protein; nudix superfamily hydro	99.55
2xsq_A		217	U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp	99.52
3rh7_A		321	Hypothetical oxidoreductase; FMN-binding split bar	99.52
3kvh_A		214	Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R	99.29
3bho_A		208	Cleavage and polyadenylation specificity factor su	99.27

>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A*	Back alignment and structure

Probab=99.94  E-value=3.1e-26  Score=165.00  Aligned_cols=128  Identities=24%  Similarity=0.342  Sum_probs=100.7

Q ss_pred             ceEEEEEEEEEeecCCCCCCcCCCeEEEEEEeeCCCCCEEeccccCCCCCCHHHHHHHHHhhhhceeeccceeeeEEEee
Q 030372           22 RRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFL  101 (178)
Q Consensus        22 ~r~~~g~i~~~~~~~~~~~~~~~~~~vLLv~~~~~~~~W~lPgG~ve~gEs~~eaa~REv~EEtGl~~~~~~~~~~~~~~  101 (178)
                      .+.+||+|+++.+            +|||+++++  +.|.||||++++|||+.+||+||++||||+.+....+++.+.+.
T Consensus         3 ~~~aag~vv~~~~------------~vLL~~r~~--g~W~~PgG~ve~gEt~~~aa~RE~~EEtGl~~~~~~~l~~~~~~   68 (134)
T 3i7u_A            3 KEFSAGGVLFKDG------------EVLLIKTPS--NVWSFPKGNIEPGEKPEETAVREVWEETGVKGEILDYIGEIHYW   68 (134)
T ss_dssp             EEEEEEEEEEETT------------EEEEEECTT--SCEECCEEECCTTCCHHHHHHHHHHHHHSEEEEEEEEEEEEEEE
T ss_pred             cEEEEEEEEEECC------------EEEEEEeCC--CcEECCeeEecCCCCHHHHHHHHHHHhcCceEEEeeeeeeeeEE
Confidence            3568999998766            899998654  78999999999999999999999999999999888877776554


Q ss_pred             ecCCCc--EEEEEEEEEEeccccccCCccceeeeEEEeHHHHHHHhccchHHHHHHHHHHHHhcc
Q 030372          102 SKSRGT--FYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSR  164 (178)
Q Consensus       102 ~~~~~~--~~~~~~~~~~~~~~~~~~~~~e~~~~~W~~~~el~~~~~~~~~~~~l~~~~~~l~~~  164 (178)
                      +...+.  ....++|.+...... ..+++|+.++.|++++++.+++.++..++++.++++.+.+.
T Consensus        69 ~~~~~~~~~~~~~~f~~~~~~~~-~~~~~E~~~~~W~~~~e~~~~l~~~~~r~il~~a~~l~~k~  132 (134)
T 3i7u_A           69 YTLKGERIFKTVKYYLMKYKEGE-PRPSWEVKDAKFFPIKEAKKLLKYKGDKEIFEKALKLKEKF  132 (134)
T ss_dssp             EEETTEEEEEEEEEEEEEEEEEC-CCCCTTSSEEEEEEHHHHHHHBCSHHHHHHHHHHHHHHHHH
T ss_pred             ecCCCceEEEEEEEEEEEEcCCc-CcCChhheEEEEEEHHHHhhhcCChHHHHHHHHHHHHHHcc
Confidence            433332  233455666554433 34556888999999999999999999999999888766543

PyMOL of 3i7u

>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A*	Back alignment and structure

>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A*	Back alignment and structure

>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes}	Back alignment and structure

>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A*	Back alignment and structure

>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua}	Back alignment and structure

>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124}	Back alignment and structure

>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1	Back alignment and structure

>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus}	Back alignment and structure

>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei}	Back alignment and structure

>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A	Back alignment and structure

>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A*	Back alignment and structure

>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0	Back alignment and structure

>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei}	Back alignment and structure

>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A*	Back alignment and structure

>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A	Back alignment and structure

>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str}	Back alignment and structure

>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1	Back alignment and structure

>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6	Back alignment and structure

>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens}	Back alignment and structure

>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID}	Back alignment and structure

>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A	Back alignment and structure

>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A	Back alignment and structure

>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367}	Back alignment and structure

>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A	Back alignment and structure

>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis}	Back alignment and structure

>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A*	Back alignment and structure

>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718}	Back alignment and structure

>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A*	Back alignment and structure

>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans}	Back alignment and structure

>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli}	Back alignment and structure

>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2	Back alignment and structure

>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans}	Back alignment and structure

>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A*	Back alignment and structure

>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens}	Back alignment and structure

>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0	Back alignment and structure

>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A	Back alignment and structure

>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1	Back alignment and structure

>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A*	Back alignment and structure

>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae}	Back alignment and structure

>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae}	Back alignment and structure

>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A*	Back alignment and structure

>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A	Back alignment and structure

>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A	Back alignment and structure

>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B	Back alignment and structure

>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A	Back alignment and structure

>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6	Back alignment and structure

>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A*	Back alignment and structure

>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum}	Back alignment and structure

>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP}	Back alignment and structure

>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima}	Back alignment and structure

>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B*	Back alignment and structure

>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A*	Back alignment and structure

>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A	Back alignment and structure

>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A	Back alignment and structure

>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A*	Back alignment and structure

>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A	Back alignment and structure

>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A*	Back alignment and structure

>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens}	Back alignment and structure

>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A	Back alignment and structure

>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3	Back alignment and structure

>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A*	Back alignment and structure

>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A*	Back alignment and structure

>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A*	Back alignment and structure

>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A*	Back alignment and structure

>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A*	Back alignment and structure

>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens}	Back alignment and structure

>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170}	Back alignment and structure

>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A	Back alignment and structure

>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens}	Back alignment and structure

>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		178
d1xsba_		153	d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas	6e-19
d2fvva1		135	d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat	5e-18
d1vcda1		126	d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t	8e-13
d2azwa1		147	d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E	2e-12
d1ktga_		137	d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas	2e-09
d1sjya_		158	d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc	3e-07
d1k2ea_		152	d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa	8e-07
d2b0va1		146	d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N	1e-06
d2a6ta2		151	d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c	2e-06
d1irya_		156	d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha	2e-05
d1u20a1		196	d.113.1.1 (A:14-209) U8 snorna-binding protein x29	1e-04
d1vhza_		186	d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche	0.001
d1vk6a2		131	d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher	0.001
d2fmla2		202	d.113.1.6 (A:3-204) Hypothetical protein EF2700, N	0.002
d1jkna_		165	d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas	0.004

>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.8 bits (188), Expect = 6e-19
 Identities = 33/150 (22%), Positives = 54/150 (36%), Gaps = 6/150 (4%)

Query: 18  DNMGRRQVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAA 77
            +M  R   G + +R        N  + IE L++ +  G      PKG  E  E   E A
Sbjct: 4   GSMALRAC-GLIIFRRCLIPKVDN--NAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETA 60

Query: 78  LRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEG---YMFPLLVTEQLELWPEKDVRQRI 134
           LR + EEAG+       +  +                Y    +    +E+    + +   
Sbjct: 61  LRATQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYR 120

Query: 135 WMSVAEAREACRHGWMKEALDILVERLSSR 164
           W+ + EA +  +   MK AL    + L S 
Sbjct: 121 WLGLEEACQLAQFKEMKAALQEGHQFLCSI 150

PyMOL of d1xsba_

>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure

>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126	Back information, alignment and structure

>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147	Back information, alignment and structure

>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137	Back information, alignment and structure

>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158	Back information, alignment and structure

>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152	Back information, alignment and structure

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146	Back information, alignment and structure

>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151	Back information, alignment and structure

>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196	Back information, alignment and structure

>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186	Back information, alignment and structure

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131	Back information, alignment and structure

>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202	Back information, alignment and structure

>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		178
d1ktga_		137	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	99.94
d1vcda1		126	AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId:	99.92
d2b0va1		146	Hypothetical protein NE0184 {Nitrosomonas europaea	99.92
d2fvva1		135	Diphosphoinositol polyphosphate phosphohydrolase {	99.91
d2fb1a2		147	Hypothetical protein BT0354, N-terminal domain {Ba	99.91
d1xsba_		153	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	99.91
d2azwa1		147	Hypothetical protein EF1141 {Enterococcus faecalis	99.89
d1vk6a2		131	NADH pyrophosphatase {Escherichia coli [TaxId: 562	99.89
d2a6ta2		151	mRNA decapping enzyme Dcp2p catalytic domain {Schi	99.88
d1irya_		156	7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum	99.88
d1sjya_		158	Hypothetical protein DR1025 {Deinococcus radiodura	99.88
d1k2ea_		152	Hypothetical protein PAE3301 {Archaeon Pyrobaculum	99.87
d1jkna_		165	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	99.86
d2fmla2		202	Hypothetical protein EF2700, N-terminal domain {En	99.84
d2b06a1		155	Hypothetical protein SP1235 (spr1115) {Streptococc	99.84
d1ryaa_		160	GDP-mannose mannosyl hydrolase NudD {Escherichia c	99.84
d1puna_		129	Nucleoside triphosphate pyrophosphorylase (MutT) {	99.83
d1v8ya_		158	ADP-ribose pyrophosphatase {Thermus thermophilus [	99.82
d2fkba1		161	Hypothetical protein YfcD {Escherichia coli [TaxId	99.81
d1nqza_		187	Coenzyme A pyrophosphatase {Deinococcus radioduran	99.79
d1vhza_		186	ADP compounds hydrolase NudE {Escherichia coli [Ta	99.79
d1mqea_		202	ADP-ribose pyrophosphatase {Mycobacterium tubercul	99.78
d1hzta_		153	Isopentenyl diphosphate isomerase {Escherichia col	99.78
d2o5fa1		162	Hypothetical protein DR0079 {Deinococcus radiodura	99.77
d1g0sa_		209	ADP-ribose pyrophosphatase {Escherichia coli [TaxI	99.69
d1q33a_		292	NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {	99.62
d1rrqa2		127	Adenine glycosylase MutY, C-terminal domain {Bacil	99.62
d1viua_		189	ADP-ribose pyrophosphatase homologue YffH {Escheri	99.57
d1u20a1		196	U8 snorna-binding protein x29 {African clawed frog	99.53
d1x51a1		142	A/G-specific adenine DNA glycosylase {Human (Homo	99.33

>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.94  E-value=1.6e-25  Score=159.22  Aligned_cols=131  Identities=18%  Similarity=0.192  Sum_probs=102.8

Q ss_pred             EEEEEEEEEeecCCCCCCcCCCeEEEEEEeeCCCCCEEeccccCCCCCCHHHHHHHHHhhhhceeeccceeeeEEE--ee
Q 030372           24 QVVGCVPYRYKTGDGAGNVVDDIEVLVITSQKGSQGMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWN--FL  101 (178)
Q Consensus        24 ~~~g~i~~~~~~~~~~~~~~~~~~vLLv~~~~~~~~W~lPgG~ve~gEs~~eaa~REv~EEtGl~~~~~~~~~~~~--~~  101 (178)
                      .++|+|+|+..        ++..++||++++..++.|.+|||+++.|||+.+||+||++||||+.+.....+..+.  +.
T Consensus         3 raag~vv~~~~--------~~~~~~Ll~~r~~~~g~W~~PgG~ie~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~   74 (137)
T d1ktga_           3 KAAGLVIYRKL--------AGKIEFLLLQASYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANITKEQLTIHEDCHETLF   74 (137)
T ss_dssp             EEEEEEEEEEE--------TTEEEEEEEEESSTTCCEESSEEECCTTCCHHHHHHHHHHHHHCCCGGGEEEEEEEEEEEE
T ss_pred             EEEEEEEEEEc--------CCCEEEEEEEEcCCCCcEeCcccccccCCCHHHHHHHHHHHHhCCcceeeeeeeeeeeeee
Confidence            57899999987        667789999987666899999999999999999999999999999977654443322  12


Q ss_pred             ecCCCcEEEEEEEEEEeccccccCCccceeeeEEEeHHHHHHHhccchHHHHHHHHHHHHh
Q 030372          102 SKSRGTFYEGYMFPLLVTEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLS  162 (178)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~W~~~~el~~~~~~~~~~~~l~~~~~~l~  162 (178)
                      ...........+|.+.........++.|+.++.|++++++.+...++.++++|+++.+.|+
T Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~e~~~~~~~~~~~~~l~~~~~~L~  135 (137)
T d1ktga_          75 YEAKGKPKSVKYWLAKLNNPDDVQLSHEHQNWKWCELEDAIKIADYAEMGSLLRKFSAFLA  135 (137)
T ss_dssp             EEETTEEEEEEEEEEEECSCCCCCCCTTEEEEEEECHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_pred             cCCCcceEEEEEEEEEecCCCCcCCCcceEEEEEEEHHHHHHhcCCHHHHHHHHHHHHHhc
Confidence            1222233444556666655555556678889999999999999989999999999999886

PyMOL of d1ktga_

>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}	Back information, alignment and structure

>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]}	Back information, alignment and structure

>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure