Citrus Sinensis ID: 030466

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MPEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSESNQEAWSAVGKS
cccccccccccccccccEEEEEEEccccEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccEEEEccccccEEEEEccccccccccccccccEEccccccccccccEEEEEccccccccccccccHHHHHHHcccc
cccccccccccccccccEEEEEEEEcccEEEEEEEEccccEEccccccccEEEEEEEEEEEEEEEccccccccccccccEEEcccEEccccccEEEcccccccEEEEEEcccEEEEEEccccccccccccccccccccEEccccccEEEEEccccHccccccccccccHHHHHcccc
mpeqpyfrrqagrkypaiTYQHIFECekfsmgifclppsgviplhnhpgmtvFSKLLFGtmhiksydwvvdvpsdtsadaagvpgktsAVAVdaipgetsaaavdiipgkplaamvdvipgkplaaavdavpdknsadvvndngntsadavdvpskmstdanpsesnQEAWSAVGKS
mpeqpyfrrqagrkypAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNgntsadavdvpskmstdanpsesnqeawsavgks
MPEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSESNQEAWSAVGKS
***********GRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPS**************AVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAV*************************************************
************RKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWV********************VAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPS***************WSAV***
*********QAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPS**********************
****PYFR***GRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSE***EAWS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSESNQEAWSAVGKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q6PDY2256 2-aminoethanethiol dioxyg yes no 0.310 0.214 0.490 6e-10
Q556I2218 Probable 2-aminoethanethi yes no 0.310 0.252 0.448 3e-09
Q96SZ5270 2-aminoethanethiol dioxyg yes no 0.282 0.185 0.48 4e-08
>sp|Q6PDY2|AEDO_MOUSE 2-aminoethanethiol dioxygenase OS=Mus musculus GN=Ado PE=1 SV=2 Back     alignment and function desciption
 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (63%)

Query: 13  RKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYD 67
           R  P +TY HI+E E FS+G+F L     IPLH+HPGM    K+L+GT+ I   D
Sbjct: 68  RNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGTVRISCMD 122

Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 3EC: .EC: 1EC: 1EC: .EC: 1EC: 9
>sp|Q556I2|AEDO_DICDI Probable 2-aminoethanethiol dioxygenase OS=Dictyostelium discoideum GN=ado-1 PE=3 SV=2 Back     alignment and function description
>sp|Q96SZ5|AEDO_HUMAN 2-aminoethanethiol dioxygenase OS=Homo sapiens GN=ADO PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
356572405276 PREDICTED: 2-aminoethanethiol dioxygenas 0.525 0.336 0.688 1e-31
356550744 281 PREDICTED: 2-aminoethanethiol dioxygenas 0.525 0.330 0.663 2e-31
356572403 281 PREDICTED: 2-aminoethanethiol dioxygenas 0.525 0.330 0.663 5e-31
356531790 287 PREDICTED: 2-aminoethanethiol dioxygenas 0.406 0.250 0.777 9e-29
356568634 288 PREDICTED: 2-aminoethanethiol dioxygenas 0.406 0.25 0.777 1e-28
357501705272 2-aminoethanethiol dioxygenase [Medicago 0.508 0.330 0.691 1e-28
255648271 287 unknown [Glycine max] 0.406 0.250 0.777 1e-28
224077604237 predicted protein [Populus trichocarpa] 0.435 0.324 0.727 6e-28
224140947241 predicted protein [Populus trichocarpa] 0.435 0.319 0.753 8e-28
225452714 279 PREDICTED: 2-aminoethanethiol dioxygenas 0.446 0.283 0.721 1e-27
>gi|356572405|ref|XP_003554359.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform 2 [Glycine max] Back     alignment and taxonomy information
 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 72/93 (77%)

Query: 2   PEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTM 61
           P+ PYFR  A ++ P ITY HI+ECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTM
Sbjct: 85  PDMPYFRTSATQRVPRITYLHIYECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTM 144

Query: 62  HIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDA 94
           HIKSYDWVVD P ++         + + V VDA
Sbjct: 145 HIKSYDWVVDSPPESPTTLKPSESELAKVKVDA 177

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356550744|ref|XP_003543744.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Back     alignment and taxonomy information
>gi|356572403|ref|XP_003554358.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356531790|ref|XP_003534459.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Back     alignment and taxonomy information
>gi|356568634|ref|XP_003552515.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Back     alignment and taxonomy information
>gi|357501705|ref|XP_003621141.1| 2-aminoethanethiol dioxygenase [Medicago truncatula] gi|355496156|gb|AES77359.1| 2-aminoethanethiol dioxygenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255648271|gb|ACU24588.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224077604|ref|XP_002305324.1| predicted protein [Populus trichocarpa] gi|222848288|gb|EEE85835.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140947|ref|XP_002323838.1| predicted protein [Populus trichocarpa] gi|222866840|gb|EEF03971.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225452714|ref|XP_002282633.1| PREDICTED: 2-aminoethanethiol dioxygenase isoform 2 [Vitis vinifera] gi|296082863|emb|CBI22164.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
TAIR|locus:2150866293 AT5G15120 [Arabidopsis thalian 0.406 0.245 0.746 6.4e-28
TAIR|locus:2178032276 AT5G39890 [Arabidopsis thalian 0.683 0.438 0.504 4e-26
TAIR|locus:2041524242 AT2G42670 [Arabidopsis thalian 0.412 0.301 0.565 4.9e-21
TAIR|locus:2098984242 AT3G58670 [Arabidopsis thalian 0.401 0.293 0.549 3.1e-19
TAIR|locus:2014169282 AT1G18490 "AT1G18490" [Arabido 0.451 0.283 0.518 2e-17
ZFIN|ZDB-GENE-041212-62248 adoa "2-aminoethanethiol (cyst 0.344 0.245 0.475 9.5e-11
MGI|MGI:2685083256 Ado "2-aminoethanethiol (cyste 0.310 0.214 0.490 2.5e-10
DICTYBASE|DDB_G0274043218 DDB_G0274043 "2-aminoethanethi 0.293 0.238 0.461 4.1e-10
DICTYBASE|DDB_G0273031218 DDB_G0273031 "2-aminoethanethi 0.293 0.238 0.461 4.1e-10
ZFIN|ZDB-GENE-040426-2267254 adob "2-aminoethanethiol (cyst 0.361 0.251 0.441 7.1e-10
TAIR|locus:2150866 AT5G15120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 312 (114.9 bits), Expect = 6.4e-28, P = 6.4e-28
 Identities = 56/75 (74%), Positives = 62/75 (82%)

Query:     2 PEQPYFRRQAG---RKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLF 58
             P  PYFR  +G   R  P ITY H+ +C++FS+GIFCLPPSGVIPLHNHPGMTVFSKLLF
Sbjct:   102 PTMPYFRPNSGVEARSSPPITYLHLHQCDQFSIGIFCLPPSGVIPLHNHPGMTVFSKLLF 161

Query:    59 GTMHIKSYDWVVDVP 73
             GTMHIKSYDWVVD P
Sbjct:   162 GTMHIKSYDWVVDAP 176
GO:0005634 "nucleus" evidence=ISM
GO:0047800 "cysteamine dioxygenase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009061 "anaerobic respiration" evidence=IEP;IMP
GO:0001666 "response to hypoxia" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
TAIR|locus:2178032 AT5G39890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041524 AT2G42670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098984 AT3G58670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014169 AT1G18490 "AT1G18490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041212-62 adoa "2-aminoethanethiol (cysteamine) dioxygenase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2685083 Ado "2-aminoethanethiol (cysteamine) dioxygenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274043 DDB_G0274043 "2-aminoethanethiol dioxygenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273031 DDB_G0273031 "2-aminoethanethiol dioxygenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2267 adob "2-aminoethanethiol (cysteamine) dioxygenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.13.11LOW CONFIDENCE prediction!
3rd Layer1.13.11.19LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IV.4359.1
hypothetical protein (231 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.X.6258.1
hypothetical protein (497 aa)
     •  0.899
gw1.IV.3946.1
hypothetical protein (502 aa)
     •  0.899
grail3.0044016002
hypothetical protein (496 aa)
     •  0.899
grail3.0038018902
hypothetical protein (498 aa)
     •  0.899
fgenesh4_pg.C_LG_VIII001255
hypothetical protein (508 aa)
     •  0.899
eugene3.00120058
hypothetical protein (501 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
pfam07847194 pfam07847, DUF1637, Protein of unknown function (D 1e-38
>gnl|CDD|219605 pfam07847, DUF1637, Protein of unknown function (DUF1637) Back     alignment and domain information 
 Score =  130 bits (329), Expect = 1e-38
 Identities = 47/80 (58%), Positives = 61/80 (76%), Gaps = 2/80 (2%)

Query: 2  PEQPYFRR--QAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFG 59
          PE  YFR   ++G+  P +TY HI+EC+ FSMG+FCLPP  VIPLH+HPGMTV SK+L+G
Sbjct: 14 PELFYFRAAAKSGKSRPPVTYLHIYECDDFSMGVFCLPPGAVIPLHDHPGMTVLSKVLYG 73

Query: 60 TMHIKSYDWVVDVPSDTSAD 79
          ++H+KSYDWV   P DT+  
Sbjct: 74 SLHVKSYDWVDGEPLDTTRG 93

This family contains many eukaryotic hypothetical proteins. The region featured in this family is approximately 120 residues long. According to InterPro annotation, some members of this family may belong to the cupin superfamily. Length = 194

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 100.0
KOG4281236 consensus Uncharacterized conserved protein [Funct 100.0
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 98.6
COG1917131 Uncharacterized conserved protein, contains double 96.68
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 96.33
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 96.03
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 95.91
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 95.64
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 95.23
PRK13290125 ectC L-ectoine synthase; Reviewed 94.72
smart00835146 Cupin_1 Cupin. This family represents the conserve 94.63
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 93.46
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 86.25
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 84.95
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 83.44
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 82.07
PRK04190191 glucose-6-phosphate isomerase; Provisional 81.51
>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information 
Probab=100.00  E-value=1.1e-38  Score=263.34  Aligned_cols=130  Identities=36%  Similarity=0.696  Sum_probs=105.8

Q ss_pred             CCcccc---ccCCCCCCCeEEEEeeccCCeEEEEEecCCCccccCCCCCCCeeeeeeeecceeeEEeecccCCCCCCccc
Q 030466            3 EQPYFR---RQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSAD   79 (177)
Q Consensus         3 e~~~fr---~~~~~~~~pItY~~IyE~e~FSIgIF~LppG~~IPLHDHPgMtVlsKVLyGsl~VkSYDwvd~~~~~~~~~   79 (177)
                      ++.+++   .+..+..++|+|++||||++|||||||||+|++|||||||+||||||||||+++|+||||+++..+.....
T Consensus        15 ~~~~~~~~~~~~~~~~~~i~y~~iyE~~~fsi~iF~lp~g~~IPLHDHP~M~v~sKvL~Gs~~v~Syd~~~~~~~~~~~~   94 (200)
T PF07847_consen   15 SLQFFRAPSNRSSPSSPPITYMHIYEDEDFSIGIFCLPPGAVIPLHDHPGMTVLSKVLYGSLHVKSYDWVDEPSDSIEGQ   94 (200)
T ss_pred             ccccccccccccCCCCCCeEEEEEEECCCcEEEEEEeCCCCEeCCCCCCchHhhHhhEeeeEEEEEcccccccccccccc
Confidence            455664   45567899999999999999999999999999999999999999999999999999999999544333222


Q ss_pred             ccCCCCceeeeEecc-cCCCccceEeeccCCCcceeeecccCCcceeeeeecCCCCCC
Q 030466           80 AAGVPGKTSAVAVDA-IPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNS  136 (177)
Q Consensus        80 ~~~~~g~~~~v~vd~-~p~~ts~~~~~~~~g~~l~~~v~~~~g~~l~~~v~a~p~~~~  136 (177)
                         ...+++++.+|. ......+++|.|..|+-||++.++. |+..|+||++|||...
T Consensus        95 ---~~~~~a~~~~d~~~~a~~~~~vL~P~~ggNiH~f~a~~-~p~AflDIL~PPY~~~  148 (200)
T PF07847_consen   95 ---RQPRLARLVVDGEMTAPSDTCVLYPTSGGNIHEFTALT-GPCAFLDILAPPYDPD  148 (200)
T ss_pred             ---ccceeeEEEecceecCCCCCeEEccCCCCeeEEEEeCC-CCeEEEEEccCCCCCC
Confidence               223455554554 3333346788999999999999999 9999999999999843

Requires catalytic amounts of a cofactor-like compound, such as sulphur, sulphide, selenium or methylene blue for maximal activity. 3-Aminopropanethiol (homocysteamine) and 2-mercaptoethanol can also act as substrates, but glutathione, cysteine, and cysteine ethyl- and methyl esters are not good substrates [, ]. ; GO: 0047800 cysteamine dioxygenase activity, 0055114 oxidation-reduction process
>KOG4281 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 3e-04
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Length = 171 Back     alignment and structure
 Score = 38.6 bits (89), Expect = 3e-04
 Identities = 12/65 (18%), Positives = 24/65 (36%), Gaps = 3/65 (4%)

Query: 4   QPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHI 63
           QPY +      Y       I+   +  + +  +PP+    +H+H      + +L G +  
Sbjct: 47  QPYIKEPDQYAY---GRNAIYRNNELEIIVINIPPNKETTVHDHGQSIGCAMVLEGKLLN 103

Query: 64  KSYDW 68
             Y  
Sbjct: 104 SIYRS 108

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 98.69
3uss_A211 Putative uncharacterized protein; cupin, three his 98.5
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 98.46
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 98.42
3h8u_A125 Uncharacterized conserved protein with double-STR 97.86
1v70_A105 Probable antibiotics synthesis protein; structural 97.82
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 97.13
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 97.09
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 97.08
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 97.06
2q30_A110 Uncharacterized protein; double-stranded beta-heli 97.0
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 96.97
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 96.72
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 96.71
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 96.69
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 96.63
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 96.43
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 96.42
3rns_A227 Cupin 2 conserved barrel domain protein; structura 96.41
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 96.33
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 96.31
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 96.26
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 96.25
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 96.22
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 96.12
3rns_A227 Cupin 2 conserved barrel domain protein; structura 96.08
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 96.03
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 95.91
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 95.86
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 95.59
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 95.52
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 95.48
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 95.47
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 95.38
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 95.28
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 95.18
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 95.05
3cjx_A165 Protein of unknown function with A cupin-like FOL; 94.72
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 94.61
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 94.56
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 93.89
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 93.8
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 93.33
1vj2_A126 Novel manganese-containing cupin TM1459; structura 92.98
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 92.88
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 92.72
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 92.47
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 92.47
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 92.18
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 92.15
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 92.03
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 91.84
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 91.82
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 91.75
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 91.73
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 91.7
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 91.44
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 91.4
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 91.39
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 91.33
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 89.84
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 89.49
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 89.16
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 88.93
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 88.33
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 88.29
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 88.19
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 88.14
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 88.05
3d82_A102 Cupin 2, conserved barrel domain protein; structur 87.41
1sef_A274 Conserved hypothetical protein; structural genomic 87.09
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 86.75
4i4a_A128 Similar to unknown protein; structural genomics, P 86.29
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 85.88
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 85.34
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 85.15
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 84.55
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 84.43
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 84.29
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 84.19
1sfn_A246 Conserved hypothetical protein; structural genomic 83.97
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 83.42
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 83.34
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 83.25
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 83.24
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 82.92
1uij_A416 Beta subunit of beta conglycinin; double-stranded 82.14
3lwc_A119 Uncharacterized protein; structural genomics, unkn 81.33
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
Probab=98.69  E-value=1.1e-07  Score=76.80  Aligned_cols=100  Identities=17%  Similarity=0.229  Sum_probs=75.8

Q ss_pred             EEeec-cCCeEEEEEecCCCccccCCCCCCCeeeeeeeecceeeEEeecccCCCCCCcccccCCCCceeee-EecccCCC
Q 030466           21 QHIFE-CEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAV-AVDAIPGE   98 (177)
Q Consensus        21 ~~IyE-~e~FSIgIF~LppG~~IPLHDHPgMtVlsKVLyGsl~VkSYDwvd~~~~~~~~~~~~~~g~~~~v-~vd~~p~~   98 (177)
                      .-||+ +..|+|-+|+.+||..-|+|||.+..++.+||.|.++.+.|+|.+....           .+... ...-.+++
T Consensus        61 ~ll~~~~~~~~l~ll~W~PGq~SpiHDH~~s~g~i~VL~G~l~e~~y~~~~~~~~-----------~l~~~~~~~l~~G~  129 (200)
T 3eln_A           61 NLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSN-----------EMIKKSERTLRENQ  129 (200)
T ss_dssp             EEEECGGGTCEEEEEEECTTCBCCEECCTTCEEEEEEEESCEEEEEECCCCSSCC-----------CCCEEEEEEECTTC
T ss_pred             EeeecCCCceEEEEEEECCCCcCCCccCCCceEEEEEEeeeEEEEEeecCCCCcc-----------cccccceEEeCCCC
Confidence            34666 5789999999999999999999999999999999999999999643211           11111 11123343


Q ss_pred             ccceEeeccCCCcceeeeccc-CCcceeeeeecCCCCC
Q 030466           99 TSAAAVDIIPGKPLAAMVDVI-PGKPLAAAVDAVPDKN  135 (177)
Q Consensus        99 ts~~~~~~~~g~~l~~~v~~~-~g~~l~~~v~a~p~~~  135 (177)
                        |+.+.. +++ +|.|.|.+ +.+++-+-|-.+|...
T Consensus       130 --v~~~~~-~~g-iH~V~N~s~~~~avSlHvY~pp~~~  163 (200)
T 3eln_A          130 --CAYIND-SIG-LHRVENVSHTEPAVSLHLYSPPFDT  163 (200)
T ss_dssp             --EEEECT-TTC-EEEEECCCSSCCEEEEEEEESCCSE
T ss_pred             --EEEecC-CCc-EEEEECCCCCCCEEEEEeCCCCccc
Confidence              456644 333 99999999 7899999999999874
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d3elna1186 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {R 1e-08
d1v70a_105 b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm 6e-04
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Length = 186 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Cysteine dioxygenase type I
domain: Cysteine dioxygenase type I
species: Rattus norvegicus [TaxId: 10116]

 Score = 49.6 bits (118), Expect = 1e-08
 Identities = 17/103 (16%), Positives = 31/103 (30%), Gaps = 10/103 (9%)

Query: 22  HIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSA--- 78
                 KF++ I C        +H+H     F KLL G +    +DW     ++      
Sbjct: 59  VDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSE 118

Query: 79  ------DAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAM 115
                   A +        V+ +     A ++ +    P    
Sbjct: 119 RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLY-SPPFDTC 160
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 99.48
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 98.71
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 97.72
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 97.53
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 97.3
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 96.99
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 96.69
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 96.37
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 96.11
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 95.76
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 94.14
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 93.47
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 92.94
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 92.71
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 91.38
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 90.62
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 90.54
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 90.36
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 89.9
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 89.74
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 88.55
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 87.52
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 87.08
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 86.77
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 86.44
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 85.35
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 84.72
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 84.39
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Cysteine dioxygenase type I
domain: Cysteine dioxygenase type I
species: Rattus norvegicus [TaxId: 10116]

Probab=99.48  E-value=1.5e-13  Score=107.29  Aligned_cols=104  Identities=20%  Similarity=0.263  Sum_probs=78.2

Q ss_pred             eEEEEeec-cCCeEEEEEecCCCccccCCCCCCCeeeeeeeecceeeEEeecccCCCCCCcccccCCCCceeeeEecccC
Q 030466           18 ITYQHIFE-CEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIP   96 (177)
Q Consensus        18 ItY~~IyE-~e~FSIgIF~LppG~~IPLHDHPgMtVlsKVLyGsl~VkSYDwvd~~~~~~~~~~~~~~g~~~~v~vd~~p   96 (177)
                      -+..-||+ +++|+|.++|.+||...|+|||++|.+++|||.|.++.+.|+|.+.....       . ......  .-.+
T Consensus        54 Y~R~li~~~~~~fel~li~W~pGq~tpiHDH~~~~~~~~vl~G~l~e~~Y~~~~~~~~~-------l-~~~~~~--~~~~  123 (186)
T d3elna1          54 YTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNE-------M-IKKSER--TLRE  123 (186)
T ss_dssp             CEEEEEECGGGTCEEEEEEECTTCBCCEECCTTCEEEEEEEESCEEEEEECCCCSSCCC-------C-CEEEEE--EECT
T ss_pred             cEEEEEEcCCCCeEEEEEEccCCCcCCCccCCCCcEEEEEcccceEEEEeecCCCCccc-------c-cccceE--EecC
Confidence            34445665 67899999999999999999999999999999999999999998542211       0 011111  1123


Q ss_pred             CCccceEeeccCCCcceeeecccC-CcceeeeeecCCCCC
Q 030466           97 GETSAAAVDIIPGKPLAAMVDVIP-GKPLAAAVDAVPDKN  135 (177)
Q Consensus        97 ~~ts~~~~~~~~g~~l~~~v~~~~-g~~l~~~v~a~p~~~  135 (177)
                      +  .|+.+++..|  +|.|.|.++ ++++.+.|.+||+..
T Consensus       124 g--~v~~~~~~~~--iH~v~N~~~~~~avsLHvYspP~~~  159 (186)
T d3elna1         124 N--QCAYINDSIG--LHRVENVSHTEPAVSLHLYSPPFDT  159 (186)
T ss_dssp             T--CEEEECTTTC--EEEEECCCSSCCEEEEEEEESCCSE
T ss_pred             C--CEEEeCCCCC--cceeecCCCCCCeEEEEEeCCChhh
Confidence            3  3566665544  899999985 789999999999865
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure