Citrus Sinensis ID: 030486
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 176 | ||||||
| 297832482 | 176 | 4-phosphopantetheine adenylyltransferase | 0.937 | 0.937 | 0.855 | 1e-78 | |
| 15224138 | 176 | phosphopantetheine adenylyltransferase [ | 0.937 | 0.937 | 0.837 | 1e-77 | |
| 255561104 | 493 | syntaxin, putative [Ricinus communis] gi | 0.960 | 0.342 | 0.834 | 2e-77 | |
| 224133810 | 178 | predicted protein [Populus trichocarpa] | 0.977 | 0.966 | 0.815 | 2e-75 | |
| 296089428 | 372 | unnamed protein product [Vitis vinifera] | 0.943 | 0.446 | 0.801 | 1e-72 | |
| 225460271 | 174 | PREDICTED: phosphopantetheine adenylyltr | 0.965 | 0.977 | 0.788 | 2e-72 | |
| 449529337 | 178 | PREDICTED: phosphopantetheine adenylyltr | 0.954 | 0.943 | 0.786 | 2e-71 | |
| 359476888 | 493 | PREDICTED: syntaxin-112 [Vitis vinifera] | 0.914 | 0.326 | 0.788 | 4e-71 | |
| 449432834 | 178 | PREDICTED: phosphopantetheine adenylyltr | 0.954 | 0.943 | 0.781 | 8e-71 | |
| 297735135 | 174 | unnamed protein product [Vitis vinifera] | 0.914 | 0.925 | 0.788 | 4e-70 |
| >gi|297832482|ref|XP_002884123.1| 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297329963|gb|EFH60382.1| 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 297 bits (760), Expect = 1e-78, Method: Compositional matrix adjust.
Identities = 142/166 (85%), Positives = 160/166 (96%), Gaps = 1/166 (0%)
Query: 12 NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
+S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLTNKQFAE+I
Sbjct: 6 DSKMSPVNSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTNKQFAEMI 65
Query: 72 QPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKK 131
QP++ERMRNVE Y+KSIKPELVVQ EPI+DPYGPSIVDENLEAIVVSKETLPGGLSVN+K
Sbjct: 66 QPIEERMRNVEKYVKSIKPELVVQAEPISDPYGPSIVDENLEAIVVSKETLPGGLSVNRK 125
Query: 132 RADRGLSQLKIEVVDLVSEGSSGDKLSSSTLRKLEAEKA-KNEQPA 176
RA+RGLSQLKIEVV++VS+GSSG+K+SSSTLRKLEAEKA K +QPA
Sbjct: 126 RAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKLEAEKADKQKQPA 171
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15224138|ref|NP_179417.1| phosphopantetheine adenylyltransferase [Arabidopsis thaliana] gi|75267775|sp|Q9ZPV8.1|COAD_ARATH RecName: Full=Phosphopantetheine adenylyltransferase; AltName: Full=Dephospho-CoA pyrophosphorylase; Short=AtCoaD; AltName: Full=Pantetheine-phosphate adenylyltransferase gi|4309741|gb|AAD15511.1| hypothetical protein [Arabidopsis thaliana] gi|34365611|gb|AAQ65117.1| At2g18250 [Arabidopsis thaliana] gi|51971991|dbj|BAD44660.1| hypothetical protein [Arabidopsis thaliana] gi|330251652|gb|AEC06746.1| phosphopantetheine adenylyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255561104|ref|XP_002521564.1| syntaxin, putative [Ricinus communis] gi|223539242|gb|EEF40835.1| syntaxin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224133810|ref|XP_002327686.1| predicted protein [Populus trichocarpa] gi|222836771|gb|EEE75164.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296089428|emb|CBI39247.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225460271|ref|XP_002278835.1| PREDICTED: phosphopantetheine adenylyltransferase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449529337|ref|XP_004171656.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359476888|ref|XP_002265408.2| PREDICTED: syntaxin-112 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449432834|ref|XP_004134203.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297735135|emb|CBI17497.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 176 | ||||||
| TAIR|locus:2062165 | 176 | COAD "4-phosphopantetheine ade | 0.937 | 0.937 | 0.783 | 9.4e-66 | |
| WB|WBGene00022031 | 461 | Y65B4A.8 [Caenorhabditis elega | 0.727 | 0.277 | 0.507 | 9.1e-29 | |
| ZFIN|ZDB-GENE-040912-137 | 554 | coasy "Coenzyme A synthase" [D | 0.772 | 0.245 | 0.411 | 1.2e-26 | |
| SGD|S000003509 | 305 | CAB4 "Probable pantetheine-pho | 0.732 | 0.422 | 0.412 | 5.9e-25 | |
| FB|FBgn0035632 | 518 | Ppat-Dpck "Bifunctional Phosph | 0.818 | 0.277 | 0.423 | 3.9e-24 | |
| MGI|MGI:1918993 | 563 | Coasy "Coenzyme A synthase" [M | 0.789 | 0.246 | 0.395 | 8.6e-24 | |
| RGD|1549767 | 563 | Coasy "CoA synthase" [Rattus n | 0.789 | 0.246 | 0.395 | 8.6e-24 | |
| UNIPROTKB|Q8MIR4 | 562 | COASY "Bifunctional coenzyme A | 0.789 | 0.247 | 0.395 | 1.4e-23 | |
| UNIPROTKB|Q13057 | 564 | COASY "Bifunctional coenzyme A | 0.789 | 0.246 | 0.388 | 1.8e-23 | |
| UNIPROTKB|E2RIA4 | 564 | COASY "Uncharacterized protein | 0.789 | 0.246 | 0.388 | 3.9e-23 |
| TAIR|locus:2062165 COAD "4-phosphopantetheine adenylyltransferase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 669 (240.6 bits), Expect = 9.4e-66, P = 9.4e-66
Identities = 130/166 (78%), Positives = 147/166 (88%)
Query: 12 NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
+S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLT KQF+++I
Sbjct: 6 DSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQFSDMI 65
Query: 72 QPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKK 131
QP++ERMRNVE Y+KSIKPELVVQ EPITDPYGPSIVDENLEAIVVSKETLPGGLSVN+K
Sbjct: 66 QPIEERMRNVETYVKSIKPELVVQAEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNRK 125
Query: 132 RADRGLSQLKIEVVDLVXXXXXXXXXXXXTLRKLEAEKA-KNEQPA 176
RA+RGLSQLKIEVV++V TLRK+EAEKA K +QPA
Sbjct: 126 RAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKMEAEKASKQKQPA 171
|
|
| WB|WBGene00022031 Y65B4A.8 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040912-137 coasy "Coenzyme A synthase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| SGD|S000003509 CAB4 "Probable pantetheine-phosphate adenylyltransferase (PPAT)" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035632 Ppat-Dpck "Bifunctional Phosphopantetheine adenylyltransferase - Dephospho-CoA kinase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918993 Coasy "Coenzyme A synthase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1549767 Coasy "CoA synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8MIR4 COASY "Bifunctional coenzyme A synthase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13057 COASY "Bifunctional coenzyme A synthase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RIA4 COASY "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.3__3433__AT2G18250.1 | annotation not avaliable (176 aa) | ||||||||||
(Arabidopsis lyrata) | |||||||||||
| fgenesh2_kg.3__1991__AT3G18030.1 | • | • | 0.672 | ||||||||
| fgenesh2_kg.7__948__AT4G32180.1 | • | • | 0.637 | ||||||||
| fgenesh2_kg.2__418__AT1G60440.1 | • | • | 0.593 | ||||||||
| scaffold_403718.1 | • | • | 0.538 | ||||||||
| fgenesh2_kg.4__710__AT2G27490.2 | • | • | 0.462 | ||||||||
| scaffold_103330.1 | • | 0.416 | |||||||||
| fgenesh1_pm.C_scaffold_8000419 | • | • | 0.412 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 176 | |||
| PLN02388 | 177 | PLN02388, PLN02388, phosphopantetheine adenylyltra | 1e-108 | |
| cd02164 | 143 | cd02164, PPAT_CoAS, phosphopantetheine adenylyltra | 2e-66 | |
| COG1019 | 158 | COG1019, COG1019, Predicted nucleotidyltransferase | 3e-41 | |
| PRK00777 | 153 | PRK00777, PRK00777, phosphopantetheine adenylyltra | 2e-39 | |
| PRK01170 | 322 | PRK01170, PRK01170, phosphopantetheine adenylyltra | 2e-18 | |
| cd02039 | 143 | cd02039, cytidylyltransferase_like, Cytidylyltrans | 3e-13 | |
| pfam01467 | 148 | pfam01467, CTP_transf_2, Cytidylyltransferase | 6e-11 | |
| TIGR00125 | 66 | TIGR00125, cyt_tran_rel, cytidyltransferase-like d | 3e-08 | |
| COG0615 | 140 | COG0615, TagD, Cytidylyltransferase [Cell envelope | 4e-05 | |
| cd02170 | 136 | cd02170, cytidylyltransferase, cytidylyltransferas | 1e-04 |
| >gnl|CDD|215218 PLN02388, PLN02388, phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
Score = 304 bits (781), Expect = e-108
Identities = 140/172 (81%), Positives = 157/172 (91%)
Query: 3 MAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPML 62
M + +SV +S +SP NSYGAVVLGGTFDRLHDGHRLFLKA+AELARDRIV+GVCDGPML
Sbjct: 1 MVTVKDSVADSKLSPPNSYGAVVLGGTFDRLHDGHRLFLKAAAELARDRIVIGVCDGPML 60
Query: 63 TNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETL 122
+ KQFAELIQP++ERM NVE YIKSIKPELVVQ EPI DPYGPSIVDENLEAIVVSKETL
Sbjct: 61 SKKQFAELIQPIEERMHNVEEYIKSIKPELVVQAEPIIDPYGPSIVDENLEAIVVSKETL 120
Query: 123 PGGLSVNKKRADRGLSQLKIEVVDLVSEGSSGDKLSSSTLRKLEAEKAKNEQ 174
PGGLSVNKKRA+RGLSQLKIEVVD+V E S+G+KLSS+TLR+LEAEKA ++
Sbjct: 121 PGGLSVNKKRAERGLSQLKIEVVDIVPEESTGNKLSSTTLRRLEAEKAVKQK 172
|
Length = 177 |
| >gnl|CDD|173915 cd02164, PPAT_CoAS, phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|223950 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234834 PRK00777, PRK00777, phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234912 PRK01170, PRK01170, phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 176 | |||
| PLN02388 | 177 | phosphopantetheine adenylyltransferase | 100.0 | |
| cd02164 | 143 | PPAT_CoAS phosphopantetheine adenylyltransferase d | 100.0 | |
| PRK00777 | 153 | phosphopantetheine adenylyltransferase; Provisiona | 99.96 | |
| COG1019 | 158 | Predicted nucleotidyltransferase [General function | 99.96 | |
| cd02064 | 180 | FAD_synthetase_N FAD synthetase, N-terminal domain | 99.94 | |
| KOG3351 | 293 | consensus Predicted nucleotidyltransferase [Genera | 99.94 | |
| TIGR00083 | 288 | ribF riboflavin kinase/FMN adenylyltransferase. mu | 99.94 | |
| COG0196 | 304 | RibF FAD synthase [Coenzyme metabolism] | 99.94 | |
| PRK07143 | 279 | hypothetical protein; Provisional | 99.94 | |
| PRK01170 | 322 | phosphopantetheine adenylyltransferase/unknown dom | 99.93 | |
| PRK05627 | 305 | bifunctional riboflavin kinase/FMN adenylyltransfe | 99.93 | |
| PF06574 | 157 | FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof | 99.93 | |
| cd02170 | 136 | cytidylyltransferase cytidylyltransferase. The cyt | 99.87 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.86 | |
| TIGR02199 | 144 | rfaE_dom_II rfaE bifunctional protein, domain II. | 99.86 | |
| cd02171 | 129 | G3P_Cytidylyltransferase glycerol-3-phosphate cyti | 99.86 | |
| TIGR01518 | 125 | g3p_cytidyltrns glycerol-3-phosphate cytidylyltran | 99.84 | |
| cd02172 | 144 | RfaE_N N-terminal domain of RfaE. RfaE is a protei | 99.84 | |
| cd02039 | 143 | cytidylyltransferase_like Cytidylyltransferase-lik | 99.83 | |
| smart00764 | 182 | Citrate_ly_lig Citrate lyase ligase C-terminal dom | 99.82 | |
| COG1057 | 197 | NadD Nicotinic acid mononucleotide adenylyltransfe | 99.73 | |
| PRK08887 | 174 | nicotinic acid mononucleotide adenylyltransferase; | 99.72 | |
| PRK00168 | 159 | coaD phosphopantetheine adenylyltransferase; Provi | 99.72 | |
| PRK00071 | 203 | nadD nicotinic acid mononucleotide adenylyltransfe | 99.72 | |
| PRK13964 | 140 | coaD phosphopantetheine adenylyltransferase; Provi | 99.71 | |
| cd02163 | 153 | PPAT Phosphopantetheine adenylyltransferase. Phosp | 99.7 | |
| TIGR01527 | 165 | arch_NMN_Atrans nicotinamide-nucleotide adenylyltr | 99.69 | |
| TIGR00482 | 193 | nicotinate (nicotinamide) nucleotide adenylyltrans | 99.68 | |
| TIGR01510 | 155 | coaD_prev_kdtB pantetheine-phosphate adenylyltrans | 99.68 | |
| PTZ00308 | 353 | ethanolamine-phosphate cytidylyltransferase; Provi | 99.68 | |
| cd02168 | 181 | NMNAT_Nudix Nicotinamide/nicotinate mononucleotide | 99.67 | |
| cd02166 | 163 | NMNAT_Archaea Nicotinamide/nicotinate mononucleoti | 99.67 | |
| PRK06973 | 243 | nicotinic acid mononucleotide adenylyltransferase; | 99.67 | |
| cd02174 | 150 | CCT CTP:phosphocholine cytidylyltransferase. CTP:p | 99.65 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.63 | |
| cd02167 | 158 | NMNAT_NadR Nicotinamide/nicotinate mononucleotide | 99.62 | |
| cd02165 | 192 | NMNAT Nicotinamide/nicotinate mononucleotide adeny | 99.62 | |
| PRK07152 | 342 | nadD putative nicotinate-nucleotide adenylyltransf | 99.61 | |
| COG0669 | 159 | CoaD Phosphopantetheine adenylyltransferase [Coenz | 99.61 | |
| cd02173 | 152 | ECT CTP:phosphoethanolamine cytidylyltransferase ( | 99.61 | |
| PRK01153 | 174 | nicotinamide-nucleotide adenylyltransferase; Provi | 99.59 | |
| COG0615 | 140 | TagD Cytidylyltransferase [Cell envelope biogenesi | 99.58 | |
| PF01467 | 157 | CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 | 99.57 | |
| PRK13793 | 196 | nicotinamide-nucleotide adenylyltransferase; Provi | 99.55 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 99.52 | |
| TIGR00125 | 66 | cyt_tran_rel cytidyltransferase-related domain. Pr | 99.51 | |
| PLN02945 | 236 | nicotinamide-nucleotide adenylyltransferase/nicoti | 99.47 | |
| PRK11316 | 473 | bifunctional heptose 7-phosphate kinase/heptose 1- | 99.46 | |
| PTZ00308 | 353 | ethanolamine-phosphate cytidylyltransferase; Provi | 99.44 | |
| PLN02406 | 418 | ethanolamine-phosphate cytidylyltransferase | 99.43 | |
| cd09286 | 225 | NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti | 99.4 | |
| PLN02413 | 294 | choline-phosphate cytidylyltransferase | 99.37 | |
| cd02156 | 105 | nt_trans nucleotidyl transferase superfamily. nt_t | 99.36 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 99.36 | |
| PLN02406 | 418 | ethanolamine-phosphate cytidylyltransferase | 99.33 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 99.29 | |
| PRK00380 | 281 | panC pantoate--beta-alanine ligase; Reviewed | 99.26 | |
| cd00560 | 277 | PanC Pantoate-beta-alanine ligase. PanC Pantoate-b | 99.24 | |
| COG1056 | 172 | NadR Nicotinamide mononucleotide adenylyltransfera | 99.2 | |
| PF08218 | 182 | Citrate_ly_lig: Citrate lyase ligase C-terminal do | 99.03 | |
| COG2870 | 467 | RfaE ADP-heptose synthase, bifunctional sugar kina | 98.93 | |
| KOG2803 | 358 | consensus Choline phosphate cytidylyltransferase/P | 98.77 | |
| PRK13670 | 388 | hypothetical protein; Provisional | 98.76 | |
| KOG2803 | 358 | consensus Choline phosphate cytidylyltransferase/P | 98.62 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 98.4 | |
| TIGR00018 | 282 | panC pantoate--beta-alanine ligase. This family is | 98.4 | |
| TIGR00339 | 383 | sopT ATP sulphurylase. Members of this family also | 98.4 | |
| PLN02660 | 284 | pantoate--beta-alanine ligase | 98.32 | |
| PRK13671 | 298 | hypothetical protein; Provisional | 98.07 | |
| COG2046 | 397 | MET3 ATP sulfurylase (sulfate adenylyltransferase) | 97.91 | |
| PF01747 | 215 | ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002 | 97.65 | |
| cd00517 | 353 | ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also | 97.62 | |
| KOG2804 | 348 | consensus Phosphorylcholine transferase/cholinepho | 97.59 | |
| PRK04149 | 391 | sat sulfate adenylyltransferase; Reviewed | 97.55 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 97.16 | |
| PF05636 | 388 | HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr | 97.04 | |
| COG1323 | 358 | Predicted nucleotidyltransferase [General function | 96.08 | |
| COG0414 | 285 | PanC Panthothenate synthetase [Coenzyme metabolism | 95.92 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 94.9 | |
| KOG3199 | 234 | consensus Nicotinamide mononucleotide adenylyl tra | 94.64 | |
| PF02569 | 280 | Pantoate_ligase: Pantoate-beta-alanine ligase; Int | 89.87 |
| >PLN02388 phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-38 Score=241.17 Aligned_cols=173 Identities=82% Similarity=1.228 Sum_probs=154.6
Q ss_pred ccccccccccCCCCCCCCCCeEEEeCcCCcCCHHHHHHHHHHHHHhcCCeEEEEccCCCCCCcCcCCCCCCHHHHHHHHH
Q 030486 3 MAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVE 82 (176)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~vv~~G~FDgvH~GH~~ll~~a~~~~~~~~~v~vt~~~~~~~k~~~~~l~~~~eR~~~l~ 82 (176)
|.-..+|++-++.++.+.++.++++|+|||+|.||+.||++|.+.+++.++++++.++.+.+++.+..++|+++|.+.++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~Vv~gGtFDgLH~GHq~LL~~A~~~a~~~vvIgft~~p~l~~k~~~~~I~~~e~R~~~l~ 80 (177)
T PLN02388 1 MVTVKDSVADSKLSPPNSYGAVVLGGTFDRLHDGHRLFLKAAAELARDRIVIGVCDGPMLSKKQFAELIQPIEERMHNVE 80 (177)
T ss_pred CcccccccccccCCCCCcCCeEEEEecCCccCHHHHHHHHHHHHhhhcCEEEecCCChhhcccCCCcccCCHHHHHHHHH
Confidence 44567899999999999999999999999999999999999999997778888888887655555678999999999999
Q ss_pred HHHHhcCCCceEEEeeccCCCCCccccCCccEEEEcCCcccChhhhhhhHHhCCCCceeEEEEeeeecCCCCCeeehHHH
Q 030486 83 AYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKIEVVDLVSEGSSGDKLSSSTL 162 (176)
Q Consensus 83 ~~~~~~~~~~~v~~~~l~~~~~~~~~~~~~~~ivvG~d~~fG~~~~~~~~~~~~~~~l~v~~v~~~~~~~~~~~ISST~I 162 (176)
+++..+.|+..+++.+|.|+|||+.+..++++|||++|+..|+..+|+.|++.|++++++.+|+++..+.++.+||||+|
T Consensus 81 ~fl~~~~p~~~~~i~~i~D~~Gpt~~~~~~d~LVVS~ET~~g~~~IN~~R~e~Gl~pL~i~~v~~v~~~~~~~kiSST~i 160 (177)
T PLN02388 81 EYIKSIKPELVVQAEPIIDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRAERGLSQLKIEVVDIVPEESTGNKLSSTTL 160 (177)
T ss_pred HHHHHcCCCceEEEEEecCCCCCcccCCCCCEEEEcHhHhhhHHHHHHHHHHCCCCCeEEEEEEeEecCCCCCccCHHHH
Confidence 99999998888888899999999998889999999999999999999999999999999999999886445899999999
Q ss_pred HHHHHhhcc-ccCC
Q 030486 163 RKLEAEKAK-NEQP 175 (176)
Q Consensus 163 R~~i~~g~~-~~~~ 175 (176)
|+++.+..+ ++||
T Consensus 161 R~~~~~~~~~~~~~ 174 (177)
T PLN02388 161 RRLEAEKAVKQKQP 174 (177)
T ss_pred HHHHHHHHHhcccc
Confidence 999976443 4454
|
|
| >cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes | Back alignment and domain information |
|---|
| >PRK00777 phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1019 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme | Back alignment and domain information |
|---|
| >KOG3351 consensus Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase | Back alignment and domain information |
|---|
| >COG0196 RibF FAD synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 | Back alignment and domain information |
|---|
| >cd02170 cytidylyltransferase cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II | Back alignment and domain information |
|---|
| >cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02172 RfaE_N N-terminal domain of RfaE | Back alignment and domain information |
|---|
| >cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain | Back alignment and domain information |
|---|
| >smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain | Back alignment and domain information |
|---|
| >COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02163 PPAT Phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial | Back alignment and domain information |
|---|
| >PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain | Back alignment and domain information |
|---|
| >cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal | Back alignment and domain information |
|---|
| >PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02174 CCT CTP:phosphocholine cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins | Back alignment and domain information |
|---|
| >cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) | Back alignment and domain information |
|---|
| >PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00125 cyt_tran_rel cytidyltransferase-related domain | Back alignment and domain information |
|---|
| >PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02406 ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic | Back alignment and domain information |
|---|
| >PLN02413 choline-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02156 nt_trans nucleotidyl transferase superfamily | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >PLN02406 ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK00380 panC pantoate--beta-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >cd00560 PanC Pantoate-beta-alanine ligase | Back alignment and domain information |
|---|
| >COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 | Back alignment and domain information |
|---|
| >COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13670 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00018 panC pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >TIGR00339 sopT ATP sulphurylase | Back alignment and domain information |
|---|
| >PLN02660 pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >PRK13671 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01747 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002650 This entry consists of sulphate adenylyltransferase or ATP-sulfurylase (2 | Back alignment and domain information |
|---|
| >cd00517 ATPS ATP-sulfurylase | Back alignment and domain information |
|---|
| >KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04149 sat sulfate adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG1323 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3199 consensus Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 176 | ||||
| 3do8_A | 148 | The Crystal Structure Of The Protein With Unknown F | 6e-11 |
| >pdb|3DO8|A Chain A, The Crystal Structure Of The Protein With Unknown Function From Archaeoglobus Fulgidus Length = 148 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 176 | |||
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 5e-44 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 8e-06 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 5e-05 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 7e-05 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 8e-05 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 1e-04 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 2e-04 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 5e-04 | |
| 1ej2_A | 181 | Nicotinamide mononucleotide adenylyltransferase; d | 8e-04 |
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 | Back alignment and structure |
|---|
Score = 142 bits (358), Expect = 5e-44
Identities = 45/149 (30%), Positives = 75/149 (50%), Gaps = 5/149 (3%)
Query: 24 VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEA 83
V LGGTF+ LH+GH+ + + +L I +GV M + + P R NV+
Sbjct: 3 VALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSV--LPFAIRAENVKR 60
Query: 84 YIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKIE 143
Y+ K + IT+PYG ++ D + E +VVS ET L +N+KR + G ++ I
Sbjct: 61 YVMR-KYGFEPEIVKITNPYGKTL-DVDFEYLVVSPETYEMALKINQKREELGKRKITIV 118
Query: 144 VVDLVSEGSSGDKLSSSTLRKLEAEKAKN 172
VD + G +SS+ +++ E ++
Sbjct: 119 KVDWM-MAEDGKPISSTRIKRGEIDRYGG 146
|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 | Back alignment and structure |
|---|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Length = 281 | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Length = 168 | Back alignment and structure |
|---|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Length = 181 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 176 | |||
| 3op1_A | 308 | Macrolide-efflux protein; structural genomics, PSI | 99.94 | |
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 99.94 | |
| 2x0k_A | 338 | Riboflavin biosynthesis protein RIBF; riboflavin k | 99.93 | |
| 1mrz_A | 293 | Riboflavin kinase/FMN adenylyltransferase; rossman | 99.92 | |
| 3glv_A | 143 | Lipopolysaccharide core biosynthesis protein; stru | 99.91 | |
| 1o6b_A | 169 | Phosphopantetheine adenylyltransferase; structural | 99.85 | |
| 1qjc_A | 158 | Phosphopantetheine adenylyltransferase; coenzyme A | 99.84 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 99.84 | |
| 2qtr_A | 189 | Nicotinate (nicotinamide) nucleotide adenylyltran; | 99.82 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 99.81 | |
| 3k9w_A | 187 | Phosphopantetheine adenylyltransferase; niaid, ssg | 99.81 | |
| 1kam_A | 194 | Deamido-NAD(+), nicotinate-nucleotide adenylyltran | 99.79 | |
| 1od6_A | 160 | PPAT, phosphopantetheine adenylyltransferase; coen | 99.79 | |
| 4f3r_A | 162 | Phosphopantetheine adenylyltransferase; phosphopan | 99.75 | |
| 3f3m_A | 168 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.74 | |
| 1ej2_A | 181 | Nicotinamide mononucleotide adenylyltransferase; d | 99.74 | |
| 3nv7_A | 157 | Phosphopantetheine adenylyltransferase; helicobact | 99.73 | |
| 3h05_A | 177 | Uncharacterized protein VPA0413; nucleotidylyl, tr | 99.73 | |
| 2h29_A | 189 | Probable nicotinate-nucleotide adenylyltransferase | 99.72 | |
| 3nbk_A | 177 | Phosphopantetheine adenylyltransferase; PPAT, PHP; | 99.71 | |
| 1k4m_A | 213 | NAMN adenylyltransferase; nucleotidyltransferase; | 99.71 | |
| 3nd5_A | 171 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.7 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 99.7 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.68 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 99.67 | |
| 1yum_A | 242 | 'probable nicotinate-nucleotide adenylyltransferas | 99.67 | |
| 1vlh_A | 173 | Phosphopantetheine adenylyltransferase; TM0741, st | 99.65 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 99.63 | |
| 2ejc_A | 280 | Pantoate--beta-alanine ligase; X-RAY diffraction, | 99.6 | |
| 1nup_A | 252 | FKSG76; NAD biosynthesis, mitochondria, pyridine a | 99.59 | |
| 1kqn_A | 279 | Nmnat, nicotinamide mononucleotide adenylyl transf | 99.57 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 99.48 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.48 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 99.43 | |
| 1v8f_A | 276 | Pantoate-beta-alanine ligase; rossmann fold, dimer | 99.4 | |
| 3gmi_A | 357 | UPF0348 protein MJ0951; protein with unknown funct | 99.4 | |
| 3ag6_A | 283 | Pantothenate synthetase; ATP-dependent enzyme, ATP | 99.31 | |
| 1jhd_A | 396 | Sulfate adenylyltransferase; sulfurylase, APS, che | 99.1 | |
| 3cov_A | 301 | Pantothenate synthetase; pantothenate biosynthesis | 99.1 | |
| 1v47_A | 349 | ATP sulfurylase; product binding complex, zinc, ri | 99.03 | |
| 1r6x_A | 395 | ATP:sulfate adenylyltransferase; APS kinase-like d | 97.88 | |
| 3uk2_A | 283 | Pantothenate synthetase; AMP, structural genomics, | 97.64 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 97.51 | |
| 3inn_A | 314 | Pantothenate synthetase; ssgcid, SBRI, UW, decode, | 97.41 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 97.25 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 96.96 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.47 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.34 | |
| 3q12_A | 287 | Pantoate--beta-alanine ligase; structural genomics | 95.44 | |
| 3mxt_A | 285 | Pantothenate synthetase; alpha-beta-alpha, structu | 87.59 | |
| 3n8h_A | 264 | Pantothenate synthetase; alpha-beta sandwich, liga | 87.18 |
| >3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
Probab=99.94 E-value=3e-28 Score=200.08 Aligned_cols=138 Identities=22% Similarity=0.232 Sum_probs=105.7
Q ss_pred CCeEEEeCcCCcCCHHHHHHHHHHHHHhcCC--eEEEEccCCC----CCC--cCcCCCCCCHHHHHHHHHHH--------
Q 030486 21 YGAVVLGGTFDRLHDGHRLFLKASAELARDR--IVVGVCDGPM----LTN--KQFAELIQPVDERMRNVEAY-------- 84 (176)
Q Consensus 21 ~~~vv~~G~FDgvH~GH~~ll~~a~~~~~~~--~~v~vt~~~~----~~~--k~~~~~l~~~~eR~~~l~~~-------- 84 (176)
.++++++|+|||+|+|||+||++|++.|++. .++++||++. +.+ .+.+.+|+|.++|.++++++
T Consensus 20 ~~~vvtiG~FDGvH~GHq~li~~a~~~a~~~~~~~vV~TFdphP~~v~~~~~~~~~~~Lt~~~eK~~ll~~lGVD~v~~~ 99 (308)
T 3op1_A 20 SDSVVVLGYFDGIHKGHQELFRVANKAARKDLLPIVVMTFNESPKIALEPYHPDLFLHILNPAERERKLKREGVEELYLL 99 (308)
T ss_dssp SCEEEEESCCSSCCHHHHHHHHHHHHHSSTTCCCEEEEEESSCTHHHHSCCCGGGGCBSSCHHHHHHHHHHHTCCEEEEE
T ss_pred CCeEEEEecCCcccHHHHHHHHHHHHHHHhcCCceEEEEecCCHHHHhCccccCCcccCCCHHHHHHHHHHcCCCEEEEe
Confidence 4689999999999999999999999998754 4678899862 222 12346799999999999987
Q ss_pred -----HHhcCCCceEEEeeccCCCCCccccCCccEEEEcCCcccChhhhhh---hHHhCCCCceeEEEEeeeecCCCCCe
Q 030486 85 -----IKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNK---KRADRGLSQLKIEVVDLVSEGSSGDK 156 (176)
Q Consensus 85 -----~~~~~~~~~v~~~~l~~~~~~~~~~~~~~~ivvG~d~~fG~~~~~~---~~~~~~~~~l~v~~v~~~~~~~~~~~ 156 (176)
++.++|++|++.+ + ..++++.+|||+||+||. +.++ ++..+. . ++.+++.+. .++.+
T Consensus 100 ~F~~~~a~ls~e~Fv~~l-l--------~~l~~~~ivvG~DfrFG~-r~G~~~~L~~~~~--~-~V~~v~~~~--~~~~~ 164 (308)
T 3op1_A 100 DFSSQFASLTAQEFFATY-I--------KAMNAKIIVAGFDYTFGS-DKKTAEDLKNYFD--G-EVIIVPPVE--DEKGK 164 (308)
T ss_dssp CCCHHHHTCCHHHHHHHH-H--------HHHTEEEEEEETTCCBTT-TTBCSTTHHHHCS--S-EEEEECCCB--CSSCB
T ss_pred cCCHHHHcCCHHHHHHHH-H--------HHcCCCEEEECcCCCCCC-cCCCHHHHHHhCC--C-CEEEeCCEe--cCCce
Confidence 4567777777521 1 145899999999999996 4422 333332 2 677788766 36889
Q ss_pred eehHHHHHHHHhhcccc
Q 030486 157 LSSSTLRKLEAEKAKNE 173 (176)
Q Consensus 157 ISST~IR~~i~~g~~~~ 173 (176)
||||+||++|.+|++.+
T Consensus 165 ISST~IR~~L~~G~v~~ 181 (308)
T 3op1_A 165 ISSTRIRQAILDGNVKE 181 (308)
T ss_dssp CCHHHHHHHHHHTCHHH
T ss_pred EeHHHHHHHHHcCCHHH
Confidence 99999999999999865
|
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} | Back alignment and structure |
|---|
| >1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A | Back alignment and structure |
|---|
| >3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* | Back alignment and structure |
|---|
| >3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* | Back alignment and structure |
|---|
| >1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* | Back alignment and structure |
|---|
| >1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* | Back alignment and structure |
|---|
| >3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* | Back alignment and structure |
|---|
| >3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* | Back alignment and structure |
|---|
| >3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* | Back alignment and structure |
|---|
| >1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* | Back alignment and structure |
|---|
| >3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* | Back alignment and structure |
|---|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* | Back alignment and structure |
|---|
| >1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* | Back alignment and structure |
|---|
| >1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A | Back alignment and structure |
|---|
| >3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* | Back alignment and structure |
|---|
| >1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... | Back alignment and structure |
|---|
| >1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* | Back alignment and structure |
|---|
| >3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* | Back alignment and structure |
|---|
| >3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 176 | ||||
| d1lw7a1 | 163 | c.26.1.3 (A:57-219) Transcriptional regulator NadR | 3e-08 | |
| d1mrza2 | 157 | c.26.1.3 (A:2-158) FMN adenylyltransferase domain | 3e-06 | |
| d1k4ma_ | 213 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 4e-05 | |
| d1kama_ | 189 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 1e-04 | |
| d1ej2a_ | 167 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 4e-04 | |
| d1f9aa_ | 164 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 7e-04 | |
| d1qjca_ | 157 | c.26.1.3 (A:) Phosphopantetheine adenylyltransfera | 0.004 |
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Adenylyltransferase domain: Transcriptional regulator NadR, NMN-adenylyltransferase domain species: Haemophilus influenzae [TaxId: 727]
Score = 48.3 bits (114), Expect = 3e-08
Identities = 24/153 (15%), Positives = 49/153 (32%), Gaps = 17/153 (11%)
Query: 24 VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFA----ELIQPVDERMR 79
V+ G F +H GH + + D + V VC + K F + + V +R+R
Sbjct: 5 GVIFGKFYPVHTGHINMIYEAFSKV-DELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRLR 63
Query: 80 NVEAYIKSIKPELVVQTE--------PITDPYGPSIVDENLEAIVVSKETLPGGLSVNKK 131
++ K K ++ + P V + +
Sbjct: 64 WMQQIFKYQKNQIFIHHLVEDGIPSYPNGWQSWSEAVKTLFHEKHFEPSIVFSS---EPQ 120
Query: 132 RADRGLSQLKIEVVDLVSEGSSGDKLSSSTLRK 164
L +EV + + + +S++ +R
Sbjct: 121 DKAPYEKYLGLEVSLVDPD-RTFFNVSATKIRT 152
|
| >d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Length = 157 | Back information, alignment and structure |
|---|
| >d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 189 | Back information, alignment and structure |
|---|
| >d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 167 | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 164 | Back information, alignment and structure |
|---|
| >d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 157 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 176 | |||
| d1mrza2 | 157 | FMN adenylyltransferase domain of bifunctional FAD | 99.96 | |
| d1coza_ | 126 | CTP:glycerol-3-phosphate cytidylyltransferase {Bac | 99.78 | |
| d1f9aa_ | 164 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.76 | |
| d1ej2a_ | 167 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.72 | |
| d1o6ba_ | 163 | Phosphopantetheine adenylyltransferase {Bacillus s | 99.59 | |
| d1lw7a1 | 163 | Transcriptional regulator NadR, NMN-adenylyltransf | 99.59 | |
| d1qjca_ | 157 | Phosphopantetheine adenylyltransferase {Escherichi | 99.59 | |
| d1od6a_ | 160 | Phosphopantetheine adenylyltransferase {Thermus th | 99.56 | |
| d1tfua_ | 157 | Phosphopantetheine adenylyltransferase {Mycobacter | 99.56 | |
| d1vlha_ | 157 | Phosphopantetheine adenylyltransferase {Thermotoga | 99.52 | |
| d1nuua_ | 233 | Cytosolic NMN/NAMN adenylyltransferase {Human (Hom | 99.48 | |
| d1kr2a_ | 271 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.46 | |
| d1jhda2 | 223 | ATP sulfurylase catalytic domain {Sulfur-oxidizing | 99.44 | |
| d1kama_ | 189 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.43 | |
| d1k4ma_ | 213 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.41 | |
| d1v47a2 | 214 | ATP sulfurylase catalytic domain {Thermus thermoph | 97.65 | |
| d1g8fa2 | 221 | ATP sulfurylase catalytic domain {Baker's yeast (S | 97.52 | |
| d1x6va2 | 235 | ATP sulfurylase catalytic domain {Human (Homo sapi | 96.99 | |
| d1v8fa_ | 276 | Pantothenate synthetase (Pantoate-beta-alanine lig | 91.02 | |
| d1ihoa_ | 282 | Pantothenate synthetase (Pantoate-beta-alanine lig | 88.25 | |
| d2a84a1 | 286 | Pantothenate synthetase (Pantoate-beta-alanine lig | 86.94 |
| >d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Adenylyltransferase domain: FMN adenylyltransferase domain of bifunctional FAD synthetase species: Thermotoga maritima [TaxId: 2336]
Probab=99.96 E-value=5.9e-30 Score=190.40 Aligned_cols=137 Identities=26% Similarity=0.299 Sum_probs=98.3
Q ss_pred EEEeCcCCcCCHHHHHHHHHHHHHhcC--CeEEEEccC--CCCCCcCcCCCCCCHHHHHHHHHHH----------HHhcC
Q 030486 24 VVLGGTFDRLHDGHRLFLKASAELARD--RIVVGVCDG--PMLTNKQFAELIQPVDERMRNVEAY----------IKSIK 89 (176)
Q Consensus 24 vv~~G~FDgvH~GH~~ll~~a~~~~~~--~~~v~vt~~--~~~~~k~~~~~l~~~~eR~~~l~~~----------~~~~~ 89 (176)
|+++|+|||+|+|||+||++|.+.+.+ ...+++||+ +.+..++.+..+++.++|.++++++ ++.++
T Consensus 1 VvtiG~FDGvH~GHq~li~~~~~~a~~~~~~~~v~tf~~~p~~~~~~~~~~l~~~~~k~~~l~~~g~~~~l~f~~~~~ls 80 (157)
T d1mrza2 1 VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLT 80 (157)
T ss_dssp CEEEECCTTCCHHHHHHHHHHHHHHHHHTCCCEEEEESSCGGGGSTTCCCBSSCHHHHHHHHTTTSCEEEECHHHHTTCC
T ss_pred CEEEEcccchhHHHHHHHHHHHHHHHHcCCCceEeecCCCchheEeccccccccHHHhhhhhhcccceeeehhhhHhhhh
Confidence 589999999999999999999988743 233445554 2111223456789999999998765 44556
Q ss_pred CCceEEEeeccCCCCCccccCCccEEEEcCCcccChhhhhhhHHhCCCCceeEEEEeeeecCCCCCeeehHHHHHHHHhh
Q 030486 90 PELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKIEVVDLVSEGSSGDKLSSSTLRKLEAEK 169 (176)
Q Consensus 90 ~~~~v~~~~l~~~~~~~~~~~~~~~ivvG~d~~fG~~~~~~~~~~~~~~~l~v~~v~~~~~~~~~~~ISST~IR~~i~~g 169 (176)
|++|++.+ ..++++||||+||+||.++.++...... ...++.+++.+.. ++.+||||+||++|.+|
T Consensus 81 ~~~Fi~~~-----------l~~~~~ivvG~Df~FG~~r~G~~~~Lk~-~g~~v~~i~~~~~--~~~~ISST~IR~~l~~G 146 (157)
T d1mrza2 81 PEGFVERY-----------LSGVSAVVVGRDFRFGKNASGNASFLRK-KGVEVYEIEDVVV--QGKRVSSSLIRNLVQEG 146 (157)
T ss_dssp HHHHHHHH-----------CTTCCEEEEETTCCBSGGGCBCHHHHHH-TTCEEEEECCCEE--TTEECCHHHHHHHHHTT
T ss_pred hhHHHHHH-----------hhcCcEEEEecCcccccccccchhhhcc-ceeEEEeeccEee--CCcEEcHHHHHHHHHcC
Confidence 66666421 1368999999999999766544333221 1246677776653 78999999999999999
Q ss_pred ccccC
Q 030486 170 AKNEQ 174 (176)
Q Consensus 170 ~~~~~ 174 (176)
++.+.
T Consensus 147 ~i~~A 151 (157)
T d1mrza2 147 RVEEI 151 (157)
T ss_dssp CTTTT
T ss_pred CHHHH
Confidence 99874
|
| >d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} | Back information, alignment and structure |
|---|
| >d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8fa2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|