Citrus Sinensis ID: 030606

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MGTSIPQPTLRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRSFHNPLSLLFPLPPPHSFLSPLLRPPPRFLCNMTDTQSPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQTV
cccccccccEEcccccccccEEEccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEEEEEEEEcccccHHHHHHHHHHcccEEEEEEcccccEEEEEEEcHHHHHHHHHHHHccccccEEcEEEEEEcccccccccEEcccc
cccccccccEEEEEcccccccHHHHHHHccccccccEccccccccccccEEEccccccccccccccccccHHHHccccccccccEEEEEEEEEEEEcccEHHHHHHHHHHcccEEEEEEccccEEEEEEEccHHHHHHHHHHHHccccccEEEEEEEEccccccccccEEEccc
mgtsipqptlrflTSGISKRIIWNTKdairthrlplrtrspfrsfhnplsllfplppphsflspllrppprflcnmtdtqsppaktVRVVVKGRVQGVFYRNWTIENATQLGLKGwvrnrrdgsvealfsgnpdsvkemeqrcchgpsdavvtglqvfpsnddpgtgfvrkqtv
mgtsipqptlrfltsgiskriiwntkdairthrlplrtrspFRSFHNPLSLLFPLPPPHSFLSPLLRPPPRFLCNMTdtqsppaktvrvVVKGRVQGvfyrnwtienatqlglkgwvrNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLqvfpsnddpgtgfvrkqtv
MGTSIPQPTLRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRsfhnplsllfplppphsflspllrppprflCNMTDTQSPPAKTvrvvvkgrvqgvFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQTV
*********LRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRSFHNPLSLLFPLPPPHSFLSPLLRPPPRFLCNMT******AKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEAL**************CCH***DAVVTGLQV*****************
******Q**LRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRSFHNPLSLLFPLPPPHSFLSP***********************RVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQTV
MGTSIPQPTLRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRSFHNPLSLLFPLPPPHSFLSPLLRPPPRFLCNMTDTQSPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPD**********HGPSDAVVTGLQVFPSNDDPGTGFVRKQTV
****IPQPTLRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRSFHNPLSLLFPLPPPHSFLSPLLRPPPRFLCN*TDT*SPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQ**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTSIPQPTLRFLTSGISKRIIWNTKDAIRTHRLPLRTRSPFRSFHNPLSLLFPLPPPHSFLSPLLRPPPRFLCNMTDTQSPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
Q1QLD899 Acylphosphatase OS=Nitrob yes no 0.413 0.727 0.541 2e-16
A5VFP299 Acylphosphatase OS=Sphing yes no 0.551 0.969 0.470 2e-16
Q2RQZ491 Acylphosphatase OS=Rhodos yes no 0.465 0.890 0.530 8e-16
Q21YG792 Acylphosphatase OS=Rhodof yes no 0.448 0.847 0.525 1e-15
Q89JL899 Acylphosphatase OS=Bradyr yes no 0.350 0.616 0.606 1e-15
Q211P499 Acylphosphatase OS=Rhodop yes no 0.442 0.777 0.545 2e-15
Q3SRU599 Acylphosphatase OS=Nitrob yes no 0.396 0.696 0.536 2e-15
Q135C299 Acylphosphatase OS=Rhodop yes no 0.454 0.797 0.537 3e-15
Q6N51099 Acylphosphatase OS=Rhodop yes no 0.390 0.686 0.544 2e-14
Q07L1596 Acylphosphatase OS=Rhodop yes no 0.385 0.697 0.582 1e-13
>sp|Q1QLD8|ACYP_NITHX Acylphosphatase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=acyP PE=3 SV=1 Back     alignment and function desciption
 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (73%)

Query: 88  RVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGP 147
           ++V++GRVQGV +R WT+  A +LG+ GWVRNRRDGSVEALF+G  D+V +M  RC +GP
Sbjct: 7   QIVIRGRVQGVGFRYWTMREAIRLGVAGWVRNRRDGSVEALFAGPADAVADMVARCRNGP 66

Query: 148 SDAVVTGLQVFP 159
             A V  ++  P
Sbjct: 67  GAARVDAVEDQP 78

Nitrobacter hamburgensis (strain X14 / DSM 10229) (taxid: 323097)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 7
>sp|A5VFP2|ACYP_SPHWW Acylphosphatase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q2RQZ4|ACYP_RHORT Acylphosphatase OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q21YG7|ACYP_RHOFD Acylphosphatase OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q89JL8|ACYP_BRAJA Acylphosphatase OS=Bradyrhizobium japonicum (strain USDA 110) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q211P4|ACYP_RHOPB Acylphosphatase OS=Rhodopseudomonas palustris (strain BisB18) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q3SRU5|ACYP_NITWN Acylphosphatase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q135C2|ACYP_RHOPS Acylphosphatase OS=Rhodopseudomonas palustris (strain BisB5) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q6N510|ACYP_RHOPA Acylphosphatase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=acyP PE=3 SV=1 Back     alignment and function description
>sp|Q07L15|ACYP_RHOP5 Acylphosphatase OS=Rhodopseudomonas palustris (strain BisA53) GN=acyP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
255556922194 acylphosphatase, putative [Ricinus commu 0.517 0.463 0.833 7e-38
359481404105 PREDICTED: acylphosphatase-like [Vitis v 0.540 0.895 0.840 1e-37
356548274150 PREDICTED: acylphosphatase-like [Glycine 0.551 0.64 0.793 4e-36
449451044202 PREDICTED: uncharacterized protein LOC10 0.712 0.613 0.626 5e-36
449482429202 PREDICTED: uncharacterized protein LOC10 0.545 0.470 0.768 2e-35
15242739171 acylphosphatase [Arabidopsis thaliana] g 0.775 0.789 0.549 2e-31
297810409171 acylphosphatase family [Arabidopsis lyra 0.747 0.760 0.552 3e-31
110742841165 hypothetical protein [Arabidopsis thalia 0.775 0.818 0.549 3e-31
29028786106 At5g03370 [Arabidopsis thaliana] 0.517 0.849 0.711 1e-30
21593449171 unknown [Arabidopsis thaliana] 0.517 0.526 0.7 3e-30
>gi|255556922|ref|XP_002519494.1| acylphosphatase, putative [Ricinus communis] gi|223541357|gb|EEF42908.1| acylphosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%)

Query: 85  KTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCC 144
           KTVRV++KGRVQGVFYRNWTIENA QLGLKGWVRNRRDGSVEALFSG+ D V+EMEQRC 
Sbjct: 105 KTVRVMIKGRVQGVFYRNWTIENANQLGLKGWVRNRRDGSVEALFSGDSDKVQEMEQRCR 164

Query: 145 HGPSDAVVTGLQVFPSNDDPGTGFVRKQTV 174
           HGP DA+VTGLQVFP +DDPGTGF RK T+
Sbjct: 165 HGPPDAMVTGLQVFPCDDDPGTGFHRKPTI 194

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359481404|ref|XP_002277067.2| PREDICTED: acylphosphatase-like [Vitis vinifera] gi|147797990|emb|CAN62952.1| hypothetical protein VITISV_040968 [Vitis vinifera] gi|297741642|emb|CBI32774.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548274|ref|XP_003542528.1| PREDICTED: acylphosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|449451044|ref|XP_004143272.1| PREDICTED: uncharacterized protein LOC101221855 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449482429|ref|XP_004156279.1| PREDICTED: uncharacterized protein LOC101231444 [Cucumis sativus] Back     alignment and taxonomy information
>gi|15242739|ref|NP_195957.1| acylphosphatase [Arabidopsis thaliana] gi|7378618|emb|CAB83294.1| putative protein [Arabidopsis thaliana] gi|332003210|gb|AED90593.1| acylphosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810409|ref|XP_002873088.1| acylphosphatase family [Arabidopsis lyrata subsp. lyrata] gi|297318925|gb|EFH49347.1| acylphosphatase family [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|110742841|dbj|BAE99319.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|29028786|gb|AAO64772.1| At5g03370 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593449|gb|AAM65416.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
TAIR|locus:2142599171 AT5G03370 [Arabidopsis thalian 0.545 0.555 0.578 1.8e-25
TIGR_CMR|GSU_088991 GSU_0889 "acylphosphatase" [Ge 0.304 0.582 0.396 6.1e-07
UNIPROTKB|P8414291 acyP "Acylphosphatase" [Pyroco 0.316 0.604 0.410 7e-06
TIGR_CMR|CPS_224889 CPS_2248 "acylphosphatase" [Co 0.333 0.651 0.344 1.5e-05
FB|FBgn0085190125 CG34161 [Drosophila melanogast 0.367 0.512 0.312 8.1e-05
ASPGD|ASPL0000051681112 AN2098 [Emericella nidulans (t 0.442 0.687 0.272 0.00027
UNIPROTKB|F1NR40108 ACYP1 "Acylphosphatase" [Gallu 0.247 0.398 0.395 0.00027
UNIPROTKB|P0703299 ACYP1 "Acylphosphatase-1" [Gal 0.247 0.434 0.395 0.00027
TIGR_CMR|CBU_199595 CBU_1995 "acylphosphatase" [Co 0.327 0.6 0.333 0.00035
TAIR|locus:2142599 AT5G03370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
 Identities = 55/95 (57%), Positives = 66/95 (69%)

Query:    80 QSPPAKTXXXXXXXXXXXXFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEM 139
             QS  +KT             YRNWT+ENA QLG+KGWVRNRRDGSVEALFSG P++V EM
Sbjct:    77 QSDSSKTVRVVIKGRVQGVCYRNWTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEM 136

Query:   140 EQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQTV 174
              QRC  GP  A+VTGL+ FPS ++PG+ F  + TV
Sbjct:   137 HQRCRRGPPAAMVTGLEAFPSTEEPGSSFEYRSTV 171
GO:0003998 "acylphosphatase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TIGR_CMR|GSU_0889 GSU_0889 "acylphosphatase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P84142 acyP "Acylphosphatase" [Pyrococcus horikoshii OT3 (taxid:70601)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2248 CPS_2248 "acylphosphatase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
FB|FBgn0085190 CG34161 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051681 AN2098 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR40 ACYP1 "Acylphosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P07032 ACYP1 "Acylphosphatase-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1995 CBU_1995 "acylphosphatase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.691
3rd Layer3.6.1.70.737

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
PRK1442199 PRK14421, PRK14421, acylphosphatase; Provisional 2e-28
pfam0070890 pfam00708, Acylphosphatase, Acylphosphatase 6e-27
COG125492 COG1254, AcyP, Acylphosphatases [Energy production 2e-25
PRK1442392 PRK14423, PRK14423, acylphosphatase; Provisional 1e-22
PRK1442594 PRK14425, PRK14425, acylphosphatase; Provisional 3e-19
PRK1442494 PRK14424, PRK14424, acylphosphatase; Provisional 6e-18
PRK1444291 PRK14442, PRK14442, acylphosphatase; Provisional 3e-17
PRK1445189 PRK14451, PRK14451, acylphosphatase; Provisional 1e-15
PRK1443891 PRK14438, PRK14438, acylphosphatase; Provisional 1e-15
PRK1444492 PRK14444, PRK14444, acylphosphatase; Provisional 2e-15
PRK1444890 PRK14448, PRK14448, acylphosphatase; Provisional 1e-14
PRK1444193 PRK14441, PRK14441, acylphosphatase; Provisional 2e-14
PRK14452107 PRK14452, PRK14452, acylphosphatase; Provisional 2e-14
PRK1444591 PRK14445, PRK14445, acylphosphatase; Provisional 2e-14
PRK1445091 PRK14450, PRK14450, acylphosphatase; Provisional 6e-14
PRK1443092 PRK14430, PRK14430, acylphosphatase; Provisional 1e-13
PRK1444795 PRK14447, PRK14447, acylphosphatase; Provisional 1e-12
PRK1442897 PRK14428, PRK14428, acylphosphatase; Provisional 2e-12
PRK1442091 PRK14420, PRK14420, acylphosphatase; Provisional 2e-12
PRK1442990 PRK14429, PRK14429, acylphosphatase; Provisional 8e-12
PRK1443691 PRK14436, PRK14436, acylphosphatase; Provisional 2e-11
PRK1444688 PRK14446, PRK14446, acylphosphatase; Provisional 2e-11
PRK1442692 PRK14426, PRK14426, acylphosphatase; Provisional 3e-11
PRK1443387 PRK14433, PRK14433, acylphosphatase; Provisional 1e-10
PRK1444990 PRK14449, PRK14449, acylphosphatase; Provisional 1e-10
PRK14437109 PRK14437, PRK14437, acylphosphatase; Provisional 1e-10
PRK1444090 PRK14440, PRK14440, acylphosphatase; Provisional 3e-10
PRK1443590 PRK14435, PRK14435, acylphosphatase; Provisional 6e-10
PRK1443492 PRK14434, PRK14434, acylphosphatase; Provisional 2e-09
PRK1442794 PRK14427, PRK14427, acylphosphatase; Provisional 2e-09
PRK1442293 PRK14422, PRK14422, acylphosphatase; Provisional 4e-07
PRK1443293 PRK14432, PRK14432, acylphosphatase; Provisional 7e-07
COG0068 750 COG0068, HypF, Hydrogenase maturation factor [Post 3e-06
PRK14439163 PRK14439, PRK14439, acylphosphatase; Provisional 2e-05
>gnl|CDD|237711 PRK14421, PRK14421, acylphosphatase; Provisional Back     alignment and domain information 
 Score =  101 bits (253), Expect = 2e-28
 Identities = 50/96 (52%), Positives = 58/96 (60%), Gaps = 7/96 (7%)

Query: 86  TVR-VVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCC 144
            VR V ++GRVQGV YR W    A  LGL+GWVRNRRDGSVEALF+G  D+V EM  RC 
Sbjct: 4   IVRQVTIRGRVQGVGYRAWVARTAEALGLEGWVRNRRDGSVEALFAGPADAVAEMIARCR 63

Query: 145 HGPSDAVVTGLQVFPSNDD------PGTGFVRKQTV 174
            GPS A V  ++  P+  D      PG  F    TV
Sbjct: 64  RGPSAARVDAVEDEPAAPDALNLRRPGERFSILPTV 99

Length = 99
>gnl|CDD|216072 pfam00708, Acylphosphatase, Acylphosphatase Back     alignment and domain information
>gnl|CDD|224174 COG1254, AcyP, Acylphosphatases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237713 PRK14423, PRK14423, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172901 PRK14425, PRK14425, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184674 PRK14424, PRK14424, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172918 PRK14442, PRK14442, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|237715 PRK14451, PRK14451, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172914 PRK14438, PRK14438, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172920 PRK14444, PRK14444, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172924 PRK14448, PRK14448, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172917 PRK14441, PRK14441, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|237716 PRK14452, PRK14452, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172921 PRK14445, PRK14445, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184683 PRK14450, PRK14450, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172906 PRK14430, PRK14430, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172923 PRK14447, PRK14447, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172904 PRK14428, PRK14428, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|237710 PRK14420, PRK14420, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184676 PRK14429, PRK14429, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172912 PRK14436, PRK14436, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172922 PRK14446, PRK14446, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184675 PRK14426, PRK14426, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184679 PRK14433, PRK14433, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184682 PRK14449, PRK14449, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172913 PRK14437, PRK14437, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172916 PRK14440, PRK14440, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184681 PRK14435, PRK14435, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184680 PRK14434, PRK14434, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172903 PRK14427, PRK14427, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|237712 PRK14422, PRK14422, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184678 PRK14432, PRK14432, acylphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223146 COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237714 PRK14439, PRK14439, acylphosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PRK1443092 acylphosphatase; Provisional 100.0
PRK1444591 acylphosphatase; Provisional 100.0
PRK1444795 acylphosphatase; Provisional 100.0
PRK1442392 acylphosphatase; Provisional 100.0
PRK1442897 acylphosphatase; Provisional 100.0
PRK1443891 acylphosphatase; Provisional 100.0
PRK1442990 acylphosphatase; Provisional 100.0
PRK1445091 acylphosphatase; Provisional 100.0
PRK1444193 acylphosphatase; Provisional 100.0
PRK1443691 acylphosphatase; Provisional 100.0
PRK1443293 acylphosphatase; Provisional 100.0
PRK1442594 acylphosphatase; Provisional 100.0
PRK1442091 acylphosphatase; Provisional 100.0
PRK1444492 acylphosphatase; Provisional 100.0
PRK1444291 acylphosphatase; Provisional 100.0
PRK1443590 acylphosphatase; Provisional 100.0
PRK1442293 acylphosphatase; Provisional 100.0
PRK1443492 acylphosphatase; Provisional 100.0
PRK1444890 acylphosphatase; Provisional 100.0
PRK1445189 acylphosphatase; Provisional 100.0
PRK1444688 acylphosphatase; Provisional 100.0
PF0070891 Acylphosphatase: Acylphosphatase; InterPro: IPR001 99.98
PRK1442794 acylphosphatase; Provisional 99.98
PRK14437109 acylphosphatase; Provisional 99.98
PRK1443387 acylphosphatase; Provisional 99.98
PRK1444090 acylphosphatase; Provisional 99.98
PRK1442199 acylphosphatase; Provisional 99.98
PRK1442692 acylphosphatase; Provisional 99.98
PRK1444990 acylphosphatase; Provisional 99.98
PRK1442494 acylphosphatase; Provisional 99.97
PRK14452107 acylphosphatase; Provisional 99.97
COG125492 AcyP Acylphosphatases [Energy production and conve 99.97
PRK1444393 acylphosphatase; Provisional 99.97
PRK1443189 acylphosphatase; Provisional 99.97
PRK14439163 acylphosphatase; Provisional 99.96
COG0068 750 HypF Hydrogenase maturation factor [Posttranslatio 99.89
KOG336098 consensus Acylphosphatase [Energy production and c 99.83
COG1054 308 Predicted sulfurtransferase [General function pred 94.95
PF06544128 DUF1115: Protein of unknown function (DUF1115); In 94.79
PRK01415 247 hypothetical protein; Validated 94.62
PRK05320 257 rhodanese superfamily protein; Provisional 92.79
TIGR01160110 SUI1_MOF2 translation initiation factor SUI1, euka 92.44
PF0494093 BLUF: Sensors of blue-light using FAD; InterPro: I 91.95
PF1036975 ALS_ss_C: Small subunit of acetolactate synthase; 90.43
PF04350144 PilO: Pilus assembly protein, PilO; PDB: 2RJZ_B. 85.32
PF04612160 T2SM: Type II secretion system (T2SS), protein M; 80.82
>PRK14430 acylphosphatase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=7.5e-33  Score=205.18  Aligned_cols=91  Identities=41%  Similarity=0.607  Sum_probs=86.1

Q ss_pred             CceEEEEEEEeEEcccchhHHHHHHHHhcCCeEEEEeCCCCcEEEEEEcCHHhHHHHHHHHhcCCCCeEEEEEEEEEcCC
Q 030606           83 PAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSND  162 (174)
Q Consensus        83 ~~~r~~i~ItGrVQGVGFR~fV~rlA~~LgL~G~VrN~~DGsVEI~aeG~ee~Ie~Fi~~L~~gPp~A~V~~Iei~~~e~  162 (174)
                      .|.+++++|+|+|||||||+|++++|.++||+|||+|++||+|||++||++++|++|+++|+++|+.|+|++|++++.++
T Consensus         2 ~~~~~~i~v~G~VQGVGFR~~~~~~A~~lgl~G~VrN~~dGsVei~~qG~~~~i~~f~~~l~~gp~~a~V~~v~~~~~~~   81 (92)
T PRK14430          2 TKETWRLVAHGRVQGVGYRAACADAADDLGLGGWVRNRADGTVEVMASGTVRQLEALRAWMEAGPPAAQVTKVEVGPGAG   81 (92)
T ss_pred             ceEEEEEEEEEeecceeeHHHHHHHHHHhCCEEEEEECCCCcEEEEEEcCHHHHHHHHHHHHhCCCceEEEEEEEEEcCC
Confidence            47799999999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             CCCCCcEEeecC
Q 030606          163 DPGTGFVRKQTV  174 (174)
Q Consensus       163 ~~~~~FeIr~t~  174 (174)
                      . .++|+|++|.
T Consensus        82 ~-~~~F~i~~~~   92 (92)
T PRK14430         82 E-FAGFDLRPTA   92 (92)
T ss_pred             C-CCCEEEEEcC
Confidence            5 4899999873

>PRK14445 acylphosphatase; Provisional Back     alignment and domain information
>PRK14447 acylphosphatase; Provisional Back     alignment and domain information
>PRK14423 acylphosphatase; Provisional Back     alignment and domain information
>PRK14428 acylphosphatase; Provisional Back     alignment and domain information
>PRK14438 acylphosphatase; Provisional Back     alignment and domain information
>PRK14429 acylphosphatase; Provisional Back     alignment and domain information
>PRK14450 acylphosphatase; Provisional Back     alignment and domain information
>PRK14441 acylphosphatase; Provisional Back     alignment and domain information
>PRK14436 acylphosphatase; Provisional Back     alignment and domain information
>PRK14432 acylphosphatase; Provisional Back     alignment and domain information
>PRK14425 acylphosphatase; Provisional Back     alignment and domain information
>PRK14420 acylphosphatase; Provisional Back     alignment and domain information
>PRK14444 acylphosphatase; Provisional Back     alignment and domain information
>PRK14442 acylphosphatase; Provisional Back     alignment and domain information
>PRK14435 acylphosphatase; Provisional Back     alignment and domain information
>PRK14422 acylphosphatase; Provisional Back     alignment and domain information
>PRK14434 acylphosphatase; Provisional Back     alignment and domain information
>PRK14448 acylphosphatase; Provisional Back     alignment and domain information
>PRK14451 acylphosphatase; Provisional Back     alignment and domain information
>PRK14446 acylphosphatase; Provisional Back     alignment and domain information
>PF00708 Acylphosphatase: Acylphosphatase; InterPro: IPR001792 Acylphosphatase (3 Back     alignment and domain information
>PRK14427 acylphosphatase; Provisional Back     alignment and domain information
>PRK14437 acylphosphatase; Provisional Back     alignment and domain information
>PRK14433 acylphosphatase; Provisional Back     alignment and domain information
>PRK14440 acylphosphatase; Provisional Back     alignment and domain information
>PRK14421 acylphosphatase; Provisional Back     alignment and domain information
>PRK14426 acylphosphatase; Provisional Back     alignment and domain information
>PRK14449 acylphosphatase; Provisional Back     alignment and domain information
>PRK14424 acylphosphatase; Provisional Back     alignment and domain information
>PRK14452 acylphosphatase; Provisional Back     alignment and domain information
>COG1254 AcyP Acylphosphatases [Energy production and conversion] Back     alignment and domain information
>PRK14443 acylphosphatase; Provisional Back     alignment and domain information
>PRK14431 acylphosphatase; Provisional Back     alignment and domain information
>PRK14439 acylphosphatase; Provisional Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3360 consensus Acylphosphatase [Energy production and conversion] Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>PF06544 DUF1115: Protein of unknown function (DUF1115); InterPro: IPR010541 This entry represents the C terminus of several eukaryotic RWD domain-containing proteins of unknown function Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>TIGR01160 SUI1_MOF2 translation initiation factor SUI1, eukaryotic Back     alignment and domain information
>PF04940 BLUF: Sensors of blue-light using FAD; InterPro: IPR007024 An FAD-binding domain, BLUF, exemplified by the N terminus of the AppA protein, (Q53119 from SWISSPROT), from Rhodobacter sphaeroides, is present in various proteins, primarily from Bacteria Back     alignment and domain information
>PF10369 ALS_ss_C: Small subunit of acetolactate synthase; InterPro: IPR019455 This entry represents the C-terminal domain of the small subunit of acetolactate synthase (the N-terminal domain being an ACT domain) Back     alignment and domain information
>PF04350 PilO: Pilus assembly protein, PilO; PDB: 2RJZ_B Back     alignment and domain information
>PF04612 T2SM: Type II secretion system (T2SS), protein M; InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
2w4d_A90 Acylphosphatase Variant G91a From Pyrococcus Horiko 7e-05
1w2i_A91 Crystal Structuore Of Acylphosphatase From Pyrococc 8e-05
3tnv_A91 Acylphosphatase With Thermophilic Surface And Mesop 2e-04
2bjd_A101 Sulfolobus Solfataricus Acylphosphatase. Triclinic 7e-04
1y9o_A103 1h Nmr Structure Of Acylphosphatase From The Hypert 7e-04
>pdb|2W4D|A Chain A, Acylphosphatase Variant G91a From Pyrococcus Horikoshii Length = 90 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
Query: 103 WTIE-NATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSN 161
           W+++  A +LG+ GWVRN  DGSVEA+  G+ + V+ +      GP  A VT ++V    
Sbjct: 20  WSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQ 79
Query: 162 DDPGTGF 168
                GF
Sbjct: 80  PKGEKGF 86
>pdb|1W2I|A Chain A, Crystal Structuore Of Acylphosphatase From Pyrococcus Horikoshii Complexed With Formate Length = 91 Back     alignment and structure
>pdb|3TNV|A Chain A, Acylphosphatase With Thermophilic Surface And Mesophilic Core Length = 91 Back     alignment and structure
>pdb|2BJD|A Chain A, Sulfolobus Solfataricus Acylphosphatase. Triclinic Space Group Length = 101 Back     alignment and structure
>pdb|1Y9O|A Chain A, 1h Nmr Structure Of Acylphosphatase From The Hyperthermophile Sulfolobus Solfataricus Length = 103 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
3trg_A98 Acylphosphatase; fatty acid and phospholipid metab 2e-35
1ulr_A88 Putative acylphosphatase; hydrolase, structural ge 4e-35
2fhm_A91 Probable acylphosphatase; hydrolase; NMR {Bacillus 4e-34
1w2i_A91 Acylphosphatase; hydrolase, thermophilic, stabilit 7e-34
1aps_A98 Acylphosphatase; hydrolase(acting on acid anhydrid 1e-33
1urr_A102 CG18505 protein; acylphosphatase, enzyme; 1.5A {Dr 3e-33
2bjd_A101 Acylphosphatase; hyperthermophIle, hydrolase; 1.27 4e-33
2vh7_A99 Acylphosphatase-1; hydrolase, acetylation; 1.45A { 3e-32
2gv1_A92 Probable acylphosphatase; globular alpha-helix/bet 9e-31
1gxu_A91 Hydrogenase maturation protein HYPF; phosphatase, 2e-20
3vth_A 761 Hydrogenase maturation factor; carbamoyltransfer, 1e-11
>3trg_A Acylphosphatase; fatty acid and phospholipid metabolism, hydrolase; 1.60A {Coxiella burnetii} Length = 98 Back     alignment and structure
 Score =  118 bits (298), Expect = 2e-35
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 75  NMTDTQSPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPD 134
            MT  +      + V V G+VQGVF+R    + A +L L GWV+N   G VE +  G  D
Sbjct: 3   AMTQ-KEKNETCIHVTVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERD 61

Query: 135 SVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGF 168
           S+  + +    GP  A V+ +       +  + F
Sbjct: 62  SIMILTEWLWEGPPQAAVSNVNWEEIVVEDYSDF 95
>1ulr_A Putative acylphosphatase; hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: d.58.10.1 Length = 88 Back     alignment and structure
>2fhm_A Probable acylphosphatase; hydrolase; NMR {Bacillus subtilis} PDB: 2hlt_A 2hlu_A 3br8_A Length = 91 Back     alignment and structure
>1w2i_A Acylphosphatase; hydrolase, thermophilic, stability, amyloid; 1.5A {Pyrococcus horikoshii} SCOP: d.58.10.1 PDB: 1v3z_A 2w4d_A Length = 91 Back     alignment and structure
>1aps_A Acylphosphatase; hydrolase(acting on acid anhydrides); NMR {Equus caballus} SCOP: d.58.10.1 Length = 98 Back     alignment and structure
>1urr_A CG18505 protein; acylphosphatase, enzyme; 1.5A {Drosophila melanogaster} SCOP: d.58.10.1 Length = 102 Back     alignment and structure
>2bjd_A Acylphosphatase; hyperthermophIle, hydrolase; 1.27A {Sulfolobus solfataricus} PDB: 2bje_A 1y9o_A Length = 101 Back     alignment and structure
>2vh7_A Acylphosphatase-1; hydrolase, acetylation; 1.45A {Homo sapiens} PDB: 2w4c_A 2w4p_A 2k7k_A 2k7j_A 2acy_A Length = 99 Back     alignment and structure
>2gv1_A Probable acylphosphatase; globular alpha-helix/beta-sheet protein, hydrolase; NMR {Escherichia coli} Length = 92 Back     alignment and structure
>1gxu_A Hydrogenase maturation protein HYPF; phosphatase, acylphosphatases, hydrogenase maturations, fibril formation, zinc-finger, complete proteome; 1.27A {Escherichia coli} SCOP: d.58.10.1 PDB: 1gxt_A Length = 91 Back     alignment and structure
>3vth_A Hydrogenase maturation factor; carbamoyltransfer, maturation of [NIFE]-hydrogenase, carbamoylphosphate, iron, HYPE; HET: APC AP2; 2.00A {Thermoanaerobacter tengcongensis} PDB: 3vti_A Length = 761 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
3trg_A98 Acylphosphatase; fatty acid and phospholipid metab 100.0
1ulr_A88 Putative acylphosphatase; hydrolase, structural ge 100.0
1w2i_A91 Acylphosphatase; hydrolase, thermophilic, stabilit 100.0
2fhm_A91 Probable acylphosphatase; hydrolase; NMR {Bacillus 100.0
2vh7_A99 Acylphosphatase-1; hydrolase, acetylation; 1.45A { 100.0
2lxf_A121 Uncharacterized protein; beaver fever, giardiasis, 100.0
1urr_A102 CG18505 protein; acylphosphatase, enzyme; 1.5A {Dr 100.0
2bjd_A101 Acylphosphatase; hyperthermophIle, hydrolase; 1.27 100.0
2gv1_A92 Probable acylphosphatase; globular alpha-helix/bet 100.0
1aps_A98 Acylphosphatase; hydrolase(acting on acid anhydrid 99.98
1gxu_A91 Hydrogenase maturation protein HYPF; phosphatase, 99.97
3vth_A 761 Hydrogenase maturation factor; carbamoyltransfer, 99.93
4g9i_A 772 Hydrogenase maturation protein HYPF; zinc finger, 99.89
4f67_A 265 UPF0176 protein LPG2838; structural genomics, PSI- 94.98
2ogh_A108 Eukaryotic translation initiation factor EIF-1; al 89.81
1yrx_A121 Hypothetical protein RSPH03001874; ferredoxin-like 89.38
2xzm_F101 EIF1; ribosome, translation; 3.93A {Tetrahymena th 88.15
2iyg_A124 APPA, antirepressor of PPSR, sensor of blue light; 87.8
2byc_A137 Blue-light receptor of the BLUF-family; signaling 87.09
2if1_A126 EIF1, SUI1; translation initiation factor; NMR {Ho 86.36
1x0p_A143 Hypothetical protein TLL0078; BLUF, FAD, structura 86.27
3ced_A98 Methionine import ATP-binding protein METN 2; ABC 85.7
2hfn_A153 Synechocystis photoreceptor (SLR1694); beta sheet 85.69
2qsw_A100 Methionine import ATP-binding protein METN 2; ABC 84.92
2qrr_A101 Methionine import ATP-binding protein METN; alpha- 83.83
3dhx_A106 Methionine import ATP-binding protein METN; methio 83.69
>3trg_A Acylphosphatase; fatty acid and phospholipid metabolism, hydrolase; 1.60A {Coxiella burnetii} Back     alignment and structure
Probab=100.00  E-value=8.8e-35  Score=216.22  Aligned_cols=94  Identities=29%  Similarity=0.471  Sum_probs=89.0

Q ss_pred             CCCCCCceEEEEEEEeEEcccchhHHHHHHHHhcCCeEEEEeCCCCcEEEEEEcCHHhHHHHHHHHhcCCCCeEEEEEEE
Q 030606           78 DTQSPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQV  157 (174)
Q Consensus        78 ~~~~~~~~r~~i~ItGrVQGVGFR~fV~rlA~~LgL~G~VrN~~DGsVEI~aeG~ee~Ie~Fi~~L~~gPp~A~V~~Iei  157 (174)
                      .+.++++++++++|+|+|||||||+|++++|++|||+|||+|++||+|||++||++++|++|+++|+++||.|+|++|++
T Consensus         5 ~~~~~~~~~~~i~V~G~VQGVGFR~~v~~~A~~lgL~G~VrN~~dG~Vei~~eG~~~~l~~f~~~l~~gPp~A~V~~v~~   84 (98)
T 3trg_A            5 TQKEKNETCIHVTVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERDSIMILTEWLWEGPPQAAVSNVNW   84 (98)
T ss_dssp             CHHHHHEEEEEEEEEEECSSSCHHHHHHHHHHHTTCEEEEEECTTSCEEEEEEEEHHHHHHHHHHTTTCSTTCEEEEEEE
T ss_pred             ccCchhhEEEEEEEEEeECCCCccHHHHHHHHHcCCeEEEEECCCCEEEEEEEECHHHHHHHHHHHHhCCCCcEEEEEEE
Confidence            34556789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCCCCCCCcEEe
Q 030606          158 FPSNDDPGTGFVRK  171 (174)
Q Consensus       158 ~~~e~~~~~~FeIr  171 (174)
                      ++.++.++.+|+|+
T Consensus        85 ~~~~~~~~~~F~IR   98 (98)
T 3trg_A           85 EEIVVEDYSDFRVR   98 (98)
T ss_dssp             EEESCCCCSSEEEC
T ss_pred             EEcCCCCCCCeEEC
Confidence            99988788999996
>1ulr_A Putative acylphosphatase; hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: d.58.10.1 Back     alignment and structure
>1w2i_A Acylphosphatase; hydrolase, thermophilic, stability, amyloid; 1.5A {Pyrococcus horikoshii} SCOP: d.58.10.1 PDB: 1v3z_A 2w4d_A Back     alignment and structure
>2fhm_A Probable acylphosphatase; hydrolase; NMR {Bacillus subtilis} PDB: 2hlt_A 2hlu_A 3br8_A Back     alignment and structure
>2vh7_A Acylphosphatase-1; hydrolase, acetylation; 1.45A {Homo sapiens} PDB: 2w4c_A 2w4p_A 2k7k_A 2k7j_A 2acy_A Back     alignment and structure
>2lxf_A Uncharacterized protein; beaver fever, giardiasis, seattle structural genomics center infectious disease, ssgcid, structural genomics; NMR {Giardia lamblia} Back     alignment and structure
>1urr_A CG18505 protein; acylphosphatase, enzyme; 1.5A {Drosophila melanogaster} SCOP: d.58.10.1 Back     alignment and structure
>2bjd_A Acylphosphatase; hyperthermophIle, hydrolase; 1.27A {Sulfolobus solfataricus} PDB: 2bje_A 1y9o_A Back     alignment and structure
>2gv1_A Probable acylphosphatase; globular alpha-helix/beta-sheet protein, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1aps_A Acylphosphatase; hydrolase(acting on acid anhydrides); NMR {Equus caballus} SCOP: d.58.10.1 Back     alignment and structure
>1gxu_A Hydrogenase maturation protein HYPF; phosphatase, acylphosphatases, hydrogenase maturations, fibril formation, zinc-finger, complete proteome; 1.27A {Escherichia coli} SCOP: d.58.10.1 PDB: 1gxt_A Back     alignment and structure
>3vth_A Hydrogenase maturation factor; carbamoyltransfer, maturation of [NIFE]-hydrogenase, carbamoylphosphate, iron, HYPE; HET: APC AP2; 2.00A {Thermoanaerobacter tengcongensis} PDB: 3vti_A Back     alignment and structure
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis} Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>2ogh_A Eukaryotic translation initiation factor EIF-1; alpha-beta protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1yrx_A Hypothetical protein RSPH03001874; ferredoxin-like fold, flavin binding, photoreceptor, transcr; HET: FMN D9G; 2.30A {Rhodobacter sphaeroides 2} SCOP: d.58.10.2 PDB: 2bun_A* Back     alignment and structure
>2xzm_F EIF1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_F Back     alignment and structure
>2iyg_A APPA, antirepressor of PPSR, sensor of blue light; signal transduction; HET: FMN; 2.3A {Rhodobacter sphaeroides} PDB: 2iyi_A* Back     alignment and structure
>2byc_A Blue-light receptor of the BLUF-family; signaling protein, photoreceptor, flavin; HET: FMN; 1.9A {Rhodobacter sphaeroides} SCOP: d.58.10.2 Back     alignment and structure
>2if1_A EIF1, SUI1; translation initiation factor; NMR {Homo sapiens} SCOP: d.64.1.1 Back     alignment and structure
>1x0p_A Hypothetical protein TLL0078; BLUF, FAD, structural genomics, electron transport; HET: FAD; 2.00A {Thermosynechococcus elongatus} SCOP: d.58.10.2 Back     alignment and structure
>3ced_A Methionine import ATP-binding protein METN 2; ABC transporter, NIL domain, structur genomics, PSI-2, protein structure initiative; 2.15A {Staphylococcus aureus subsp} SCOP: d.58.18.13 Back     alignment and structure
>2hfn_A Synechocystis photoreceptor (SLR1694); beta sheet ferredoxin-like fold, flavin binding protein, electron transport; HET: FMN; 1.80A {Synechocystis SP} PDB: 2hfo_A* 3mzi_A* Back     alignment and structure
>2qsw_A Methionine import ATP-binding protein METN 2; ABC transporter, structural genomics, APC87322.1, PSI-2, protein structure initiative; 1.50A {Enterococcus faecalis} SCOP: d.58.18.13 Back     alignment and structure
>2qrr_A Methionine import ATP-binding protein METN; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 1.71A {Vibrio parahaemolyticus} SCOP: d.58.18.13 Back     alignment and structure
>3dhx_A Methionine import ATP-binding protein METN; methionine uptake, regulation, amino-acid transport, ATP-BIN hydrolase, inner membrane, membrane; 2.10A {Escherichia coli} SCOP: d.58.18.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d1apsa_98 d.58.10.1 (A:) Acylphosphatase {Horse (Equus cabal 2e-25
d1ulra_87 d.58.10.1 (A:) Acylphosphatase {Thermus thermophil 9e-25
d2acya_98 d.58.10.1 (A:) Acylphosphatase {Cow (Bos taurus) [ 1e-24
d1urra_97 d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit 6e-24
d1w2ia_90 d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikos 7e-24
d1gxua_88 d.58.10.1 (A:) Hydrogenase maturation protein HypF 1e-18
>d1apsa_ d.58.10.1 (A:) Acylphosphatase {Horse (Equus caballus) [TaxId: 9796]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Acylphosphatase/BLUF domain-like
family: Acylphosphatase-like
domain: Acylphosphatase
species: Horse (Equus caballus) [TaxId: 9796]

 Score = 91.5 bits (227), Expect = 2e-25
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 1/91 (1%)

Query: 79  TQSPPAKTVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKE 138
           + + P K+V   V GRVQGV +R +  + A ++G+ GWV+N   G+V     G  + V  
Sbjct: 1   STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNS 60

Query: 139 MEQRCCH-GPSDAVVTGLQVFPSNDDPGTGF 168
           M+      G   + +               +
Sbjct: 61  MKSWLSKVGSPSSRIDRTNFSNEKTISKLEY 91
>d1ulra_ d.58.10.1 (A:) Acylphosphatase {Thermus thermophilus [TaxId: 274]} Length = 87 Back     information, alignment and structure
>d2acya_ d.58.10.1 (A:) Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 97 Back     information, alignment and structure
>d1w2ia_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]} Length = 90 Back     information, alignment and structure
>d1gxua_ d.58.10.1 (A:) Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1ulra_87 Acylphosphatase {Thermus thermophilus [TaxId: 274] 100.0
d1w2ia_90 Acylphosphatase {Pyrococcus horikoshii [TaxId: 539 100.0
d1urra_97 Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila 99.97
d2acya_98 Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1apsa_98 Acylphosphatase {Horse (Equus caballus) [TaxId: 97 99.97
d1gxua_88 Hydrogenase maturation protein HypF N-terminal dom 99.95
d1yrxa1114 Sensor of blue light AppA {Rhodobacter sphaeroides 91.85
d2byca1136 Blue light receptor BlrB {Rhodobacter sphaeroides 89.37
d2f1fa286 Acetolactate synthase small subunit, IlvH {Escheri 89.16
d1x0pa1142 Hypothetical protein Tll0078 {Thermosynechococcus 88.05
d2fgca183 Acetolactate synthase small subunit, IlvH {Thermot 87.14
d2pc6a186 Acetolactate synthase small subunit, IlvH {Nitroso 86.83
d2if1a_126 Eukaryotic translation initiation factor eIF-1 (SU 84.83
d2qswa190 Methionine import ATP-binding protein MetN2 {Enter 80.43
>d1ulra_ d.58.10.1 (A:) Acylphosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Acylphosphatase/BLUF domain-like
family: Acylphosphatase-like
domain: Acylphosphatase
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=2.8e-33  Score=202.43  Aligned_cols=85  Identities=33%  Similarity=0.478  Sum_probs=83.0

Q ss_pred             EEEEEEEeEEcccchhHHHHHHHHhcCCeEEEEeCCCCcEEEEEEcCHHhHHHHHHHHhcCCCCeEEEEEEEEEcCCCCC
Q 030606           86 TVRVVVKGRVQGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPG  165 (174)
Q Consensus        86 r~~i~ItGrVQGVGFR~fV~rlA~~LgL~G~VrN~~DGsVEI~aeG~ee~Ie~Fi~~L~~gPp~A~V~~Iei~~~e~~~~  165 (174)
                      |++++|+|+|||||||+|++++|.++||+|||+|++||+|||++||++++|++|+++|++||+.|+|++|++++.++.++
T Consensus         2 R~~~iV~G~VQGVGFR~~~~~~A~~~~l~G~V~N~~dG~Vei~~~G~~~~v~~f~~~l~~gp~~a~V~~v~~~~~~~~~~   81 (87)
T d1ulra_           2 RLVALVKGRVQGVGYRAFAQKKALELGLSGYAENLPDGRVEVVAEGPKEALELFLHHLKQGPRLARVEAVEVQWGEEAGL   81 (87)
T ss_dssp             EEEEEEEEECSSSSHHHHHHHHHHHTTCEEEEEECTTSCEEEEEESCHHHHHHHHHHHHHCSTTCEEEEEEEEEECCCCC
T ss_pred             eEEEEEEEEEeCccCHHHHHHHHHHcCCeEEEEECCCCCEEEEEEECHHHHHHHHHHHhhCCCCcEEEEEEEEECCCCCC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999998889


Q ss_pred             CCcEE
Q 030606          166 TGFVR  170 (174)
Q Consensus       166 ~~FeI  170 (174)
                      .+|+|
T Consensus        82 ~~F~I   86 (87)
T d1ulra_          82 KGFHV   86 (87)
T ss_dssp             CSEEE
T ss_pred             CCcEE
Confidence            99998
>d1w2ia_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2acya_ d.58.10.1 (A:) Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1apsa_ d.58.10.1 (A:) Acylphosphatase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gxua_ d.58.10.1 (A:) Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrxa1 d.58.10.2 (A:17-130) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2byca1 d.58.10.2 (A:1-136) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x0pa1 d.58.10.2 (A:102-243) Hypothetical protein Tll0078 {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2if1a_ d.64.1.1 (A:) Eukaryotic translation initiation factor eIF-1 (SUI1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qswa1 d.58.18.13 (A:256-345) Methionine import ATP-binding protein MetN2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure