Citrus Sinensis ID: 030626


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MSVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
ccHHcHHHHHHccccEEEEcccccccccccccHHHHHHHcccccEEEEcHHHHHHHHHHccEEEEcccccccccccEEEEccccccccccccccccEEEEcccccccccccccccEEEEEEccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccc
cccccHHHHHHHcccEEEEccccccHHHHccHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEccccccccccEEEEcccccccEcccccccEEEEEEEEEEEEcccccccEEEEEEEccccEEEEEEEcccccEEEEEccccHHccHHHHHHHHHHHHHHHHHHHHcccc
MSVNYLVSYCrknprgvlispgpgapqdsgislqtvlelgptvplfgvCMGLQcigeafggkivrsplgvmhgksslvyydekgedgllaglsnpftagryHSLViekesfpsdalevtawTEDGLIMAARHKKYkhlqgvqfhpesiittEGKTIVRNFIKMIVRKEAADSQN
MSVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKhlqgvqfhpesiittegktIVRNFIKMIVRKEAADSQN
MSVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
***NYLVSYCRKNPRGVLI**********GISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVR********
MSVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKM***********
MSVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
*SVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEA*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVNYLVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
P48261190 Anthranilate synthase com N/A no 0.844 0.773 0.572 2e-45
P51362189 Anthranilate synthase com N/A no 0.839 0.772 0.490 3e-39
Q1XDC5189 Anthranilate synthase com N/A no 0.833 0.767 0.48 2e-37
Q08654 589 Anthranilate synthase com yes no 0.844 0.249 0.490 1e-36
P00901198 Anthranilate synthase com yes no 0.827 0.727 0.483 5e-35
P20576201 Anthranilate synthase com yes no 0.821 0.711 0.474 1e-33
P28819194 Para-aminobenzoate/anthra yes no 0.862 0.773 0.464 6e-33
P00903187 Para-aminobenzoate syntha N/A no 0.816 0.759 0.466 7e-33
P06193187 Para-aminobenzoate syntha yes no 0.827 0.770 0.426 3e-32
P00902194 Anthranilate synthase com yes no 0.844 0.757 0.455 3e-32
>sp|P48261|TRPG_CYAPA Anthranilate synthase component II OS=Cyanophora paradoxa GN=trpG PE=3 SV=1 Back     alignment and function desciption
 Score =  181 bits (460), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 5/152 (3%)

Query: 13  NPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMH 72
           N +G++ISP PG P+DSGIS   +  LG  +P+ GVC+G Q IG  FGGKI+++P  ++H
Sbjct: 43  NIQGIIISPCPGGPEDSGISQGIIKYLGNQIPILGVCLGHQTIGHVFGGKIIKAP-KLIH 101

Query: 73  GKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARH 132
           GK S++++D KG   +   L NP TA RYHSL+IEKES P D LE+TAWTEDGLIM  +H
Sbjct: 102 GKPSIIFHDGKG---VFQNLKNPITATRYHSLIIEKESCP-DELEITAWTEDGLIMGIQH 157

Query: 133 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMI 164
           KKYK LQG+QFHPESI+T  GK I++NFI  +
Sbjct: 158 KKYKQLQGIQFHPESILTESGKQILQNFINCL 189





Cyanophora paradoxa (taxid: 2762)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: 2EC: 7
>sp|P51362|TRPG_PORPU Anthranilate synthase component II OS=Porphyra purpurea GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|Q1XDC5|TRPG_PORYE Anthranilate synthase component II OS=Porphyra yezoensis GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|Q08654|TRPG_THEMA Anthranilate synthase component II OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 Back     alignment and function description
>sp|P00901|TRPG_PSEPU Anthranilate synthase component II OS=Pseudomonas putida GN=trpG PE=1 SV=2 Back     alignment and function description
>sp|P20576|TRPG_PSEAE Anthranilate synthase component II OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=4 SV=2 Back     alignment and function description
>sp|P28819|PABA_BACSU Para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II OS=Bacillus subtilis (strain 168) GN=pabA PE=4 SV=1 Back     alignment and function description
>sp|P00903|PABA_ECOLI Para-aminobenzoate synthase glutamine amidotransferase component II OS=Escherichia coli (strain K12) GN=pabA PE=1 SV=1 Back     alignment and function description
>sp|P06193|PABA_SALTY Para-aminobenzoate synthase glutamine amidotransferase component II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabA PE=4 SV=1 Back     alignment and function description
>sp|P00902|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter sp. (strain ADP1) GN=trpG PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
356558733272 PREDICTED: anthranilate synthase compone 0.931 0.595 0.907 4e-82
356558731 278 PREDICTED: anthranilate synthase compone 0.931 0.582 0.907 4e-82
224108213 276 anthranilate synthase, beta subunit, ASB 0.936 0.590 0.896 2e-81
356521181 276 PREDICTED: anthranilate synthase compone 0.931 0.586 0.901 5e-81
255573238 281 Anthranilate synthase component II, puta 0.936 0.580 0.871 3e-80
217072976270 unknown [Medicago truncatula] gi|3884985 0.931 0.6 0.864 5e-80
297845630 277 hypothetical protein ARALYDRAFT_472860 [ 0.908 0.570 0.879 5e-80
225424454 285 PREDICTED: anthranilate synthase compone 0.913 0.557 0.874 6e-80
25403004 469 probable anthranilate synthase beta subu 0.913 0.339 0.861 8e-80
224101933240 anthranilate synthase, beta subunit, ASB 0.913 0.662 0.899 1e-79
>gi|356558733|ref|XP_003547657.1| PREDICTED: anthranilate synthase component II-like isoform 2 [Glycine max] Back     alignment and taxonomy information
 Score =  308 bits (790), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 147/162 (90%), Positives = 152/162 (93%)

Query: 11  RKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGV 70
           RKNPRGVLISPGPG PQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSP GV
Sbjct: 111 RKNPRGVLISPGPGEPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPHGV 170

Query: 71  MHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAA 130
           MHGKSS+VYYDEKGEDGLLAGLSNPF AGRYHSLVIEKESFP D LE TAWTEDGLIMAA
Sbjct: 171 MHGKSSMVYYDEKGEDGLLAGLSNPFLAGRYHSLVIEKESFPHDELEATAWTEDGLIMAA 230

Query: 131 RHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADS 172
           RHKKYKHLQGVQFHPESIIT EGKTIVRNF+K+I ++EA  S
Sbjct: 231 RHKKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKREAGGS 272




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356558731|ref|XP_003547656.1| PREDICTED: anthranilate synthase component II-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224108213|ref|XP_002314761.1| anthranilate synthase, beta subunit, ASB1 [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase, beta subunit, ASB1 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521181|ref|XP_003529236.1| PREDICTED: anthranilate synthase component II-like [Glycine max] Back     alignment and taxonomy information
>gi|255573238|ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|217072976|gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK37352.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297845630|ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225424454|ref|XP_002281633.1| PREDICTED: anthranilate synthase component II-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|25403004|pir||B86381 probable anthranilate synthase beta subunit [imported] - Arabidopsis thaliana Back     alignment and taxonomy information
>gi|224101933|ref|XP_002312481.1| anthranilate synthase, beta subunit, ASB2 [Populus trichocarpa] gi|222852301|gb|EEE89848.1| anthranilate synthase, beta subunit, ASB2 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
TAIR|locus:2826037235 AT1G24807 [Arabidopsis thalian 0.913 0.676 0.861 4e-74
TAIR|locus:2826092222 AT1G24909 [Arabidopsis thalian 0.913 0.716 0.861 4e-74
TAIR|locus:2826077222 AT1G25083 [Arabidopsis thalian 0.913 0.716 0.861 4e-74
TAIR|locus:2825965222 AT1G25155 [Arabidopsis thalian 0.913 0.716 0.861 4e-74
TAIR|locus:2174378273 AT5G57890 [Arabidopsis thalian 0.913 0.582 0.861 6.5e-74
TIGR_CMR|BA_0069195 BA_0069 "para-aminobenzoate sy 0.821 0.733 0.483 5.1e-35
UNIPROTKB|Q74AH3190 trpG "Anthranilate synthase, g 0.827 0.757 0.493 8.3e-35
TIGR_CMR|GSU_2382190 GSU_2382 "anthranilate synthas 0.827 0.757 0.493 8.3e-35
UNIPROTKB|Q5LRH9193 trpG "Anthranilate synthase co 0.839 0.756 0.503 1.3e-34
TIGR_CMR|CHY_1586189 CHY_1586 "para-aminobenzoate/a 0.821 0.756 0.489 1.3e-34
TAIR|locus:2826037 AT1G24807 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 748 (268.4 bits), Expect = 4.0e-74, P = 4.0e-74
 Identities = 137/159 (86%), Positives = 151/159 (94%)

Query:    11 RKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGV 70
             RKNPRGVLISPGPG PQDSGISLQTVLELGP VPLFGVCMGLQCIGEAFGGKIVRSP GV
Sbjct:    73 RKNPRGVLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGV 132

Query:    71 MHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAA 130
             MHGKSS+V+YDEKGE+GL +GLSNPF  GRYHSLVIEK++FPSD LEVTAWTEDGL+MAA
Sbjct:   133 MHGKSSMVHYDEKGEEGLFSGLSNPFIVGRYHSLVIEKDTFPSDELEVTAWTEDGLVMAA 192

Query:   131 RHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEA 169
             RH+KYKH+QGVQFHPESIITTEGKTIVRNFIK++ +K++
Sbjct:   193 RHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKDS 231




GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2826092 AT1G24909 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826077 AT1G25083 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825965 AT1G25155 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174378 AT5G57890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0069 BA_0069 "para-aminobenzoate synthase glutamine amidotransferase, component II" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AH3 trpG "Anthranilate synthase, glutamine amidotransferase subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2382 GSU_2382 "anthranilate synthase component II" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LRH9 trpG "Anthranilate synthase component II" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1586 CHY_1586 "para-aminobenzoate/anthranilate synthase glutamine amidotransferase, component II" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.3.270.914
3rd Layer4.1.30.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
PLN02335222 PLN02335, PLN02335, anthranilate synthase 1e-121
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 9e-76
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 8e-70
CHL00101190 CHL00101, trpG, anthranilate synthase component 2 9e-70
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 1e-68
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotr 1e-56
PRK07649195 PRK07649, PRK07649, para-aminobenzoate/anthranilat 1e-55
PRK07765214 PRK07765, PRK07765, para-aminobenzoate synthase co 3e-53
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 8e-52
TIGR00566188 TIGR00566, trpG_papA, glutamine amidotransferase o 9e-48
PRK08007187 PRK08007, PRK08007, para-aminobenzoate synthase co 9e-48
PRK06774191 PRK06774, PRK06774, para-aminobenzoate synthase co 2e-45
PRK08857193 PRK08857, PRK08857, para-aminobenzoate synthase co 6e-45
PRK13566720 PRK13566, PRK13566, anthranilate synthase; Provisi 1e-43
TIGR01815717 TIGR01815, TrpE-clade3, anthranilate synthase, alp 5e-33
PRK09522 531 PRK09522, PRK09522, bifunctional glutamine amidotr 2e-26
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase 3e-24
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd 3e-20
TIGR01823 742 TIGR01823, PabB-fungal, aminodeoxychorismate synth 5e-20
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine am 6e-20
PLN02889 918 PLN02889, PLN02889, oxo-acid-lyase/anthranilate sy 8e-19
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 5e-18
PRK05637208 PRK05637, PRK05637, anthranilate synthase componen 2e-17
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Valida 1e-16
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 9e-16
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synt 5e-14
cd01741188 cd01741, GATase1_1, Subgroup of proteins having th 2e-13
PRK12838354 PRK12838, PRK12838, carbamoyl phosphate synthase s 3e-13
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotrans 1e-12
PLN02771415 PLN02771, PLN02771, carbamoyl-phosphate synthase ( 2e-11
cd01745189 cd01745, GATase1_2, Subgroup of proteins having th 7e-11
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small s 9e-11
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase s 1e-10
COG2071243 COG2071, COG2071, Predicted glutamine amidotransfe 2e-10
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase argin 6e-09
PLN02347 536 PLN02347, PLN02347, GMP synthetase 2e-08
PRK09065237 PRK09065, PRK09065, glutamine amidotransferase; Pr 9e-08
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 1e-07
TIGR01855196 TIGR01855, IMP_synth_hisH, imidazole glycerol phos 3e-06
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino a 3e-04
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synth 0.002
PRK08250235 PRK08250, PRK08250, glutamine amidotransferase; Pr 0.002
PRK13152201 PRK13152, hisH, imidazole glycerol phosphate synth 0.004
PRK13143200 PRK13143, hisH, imidazole glycerol phosphate synth 0.004
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information
 Score =  339 bits (871), Expect = e-121
 Identities = 141/159 (88%), Positives = 151/159 (94%)

Query: 11  RKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGV 70
           RKNPRGVLISPGPG PQDSGISLQTVLELGP VPLFGVCMGLQCIGEAFGGKIVRSP GV
Sbjct: 60  RKNPRGVLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGV 119

Query: 71  MHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAA 130
           MHGKSS V+YDEKGE+GL +GL NPFTAGRYHSLVIEK++FPSD LEVTAWTEDGLIMAA
Sbjct: 120 MHGKSSPVHYDEKGEEGLFSGLPNPFTAGRYHSLVIEKDTFPSDELEVTAWTEDGLIMAA 179

Query: 131 RHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEA 169
           RH+KYKH+QGVQFHPESIITTEGKTIVRNFIK+I +KE+
Sbjct: 180 RHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIIEKKES 218


Length = 222

>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|214365 CHL00101, trpG, anthranilate synthase component 2 Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|233027 TIGR00566, trpG_papA, glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>gnl|CDD|181194 PRK08007, PRK08007, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|180689 PRK06774, PRK06774, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181566 PRK08857, PRK08857, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|237429 PRK13566, PRK13566, anthranilate synthase; Provisional Back     alignment and domain information
>gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>gnl|CDD|181927 PRK09522, PRK09522, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235882 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|233588 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|215481 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|180178 PRK05637, PRK05637, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|233378 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178370 PLN02771, PLN02771, carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|223579 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|224982 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214392 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|181635 PRK09065, PRK09065, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|219535 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information
>gnl|CDD|233601 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>gnl|CDD|223196 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237288 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|181323 PRK08250, PRK08250, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|171876 PRK13152, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|237289 PRK13143, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PLN02335222 anthranilate synthase 100.0
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 100.0
PRK08007187 para-aminobenzoate synthase component II; Provisio 100.0
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 100.0
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 100.0
PRK05670189 anthranilate synthase component II; Provisional 100.0
CHL00101190 trpG anthranilate synthase component 2 100.0
PRK06774191 para-aminobenzoate synthase component II; Provisio 100.0
PRK06895190 putative anthranilate synthase component II; Provi 100.0
PRK05637208 anthranilate synthase component II; Provisional 100.0
PRK08857193 para-aminobenzoate synthase component II; Provisio 100.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 100.0
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 100.0
PRK07765214 para-aminobenzoate synthase component II; Provisio 100.0
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 100.0
PRK00758184 GMP synthase subunit A; Validated 100.0
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 100.0
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 100.0
PLN02347 536 GMP synthetase 100.0
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 100.0
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 100.0
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 100.0
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 100.0
PRK00074 511 guaA GMP synthase; Reviewed 99.98
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.98
PRK09065237 glutamine amidotransferase; Provisional 99.98
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.97
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.97
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.97
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.97
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.97
PRK13566720 anthranilate synthase; Provisional 99.97
PRK07567242 glutamine amidotransferase; Provisional 99.97
PRK05665240 amidotransferase; Provisional 99.97
COG2071243 Predicted glutamine amidotransferases [General fun 99.97
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.97
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.97
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.96
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.96
PRK08250235 glutamine amidotransferase; Provisional 99.96
PRK06490239 glutamine amidotransferase; Provisional 99.96
PRK07053234 glutamine amidotransferase; Provisional 99.96
PRK06186229 hypothetical protein; Validated 99.95
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.95
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.95
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 99.95
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.95
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.94
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.94
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.94
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 99.94
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.94
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.94
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.94
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.94
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.94
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.94
PRK05380533 pyrG CTP synthetase; Validated 99.93
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.93
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.93
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.93
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.93
PLN02327557 CTP synthase 99.93
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 99.92
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.92
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.92
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.92
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.89
PRK05368302 homoserine O-succinyltransferase; Provisional 99.89
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.88
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 99.87
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.87
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 99.87
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.86
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 99.84
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.84
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.82
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.76
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.69
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.67
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.65
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.63
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 99.62
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 99.54
COG0311194 PDX2 Predicted glutamine amidotransferase involved 99.53
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 99.53
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 99.39
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 99.32
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 99.28
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 99.22
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 99.17
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 99.02
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 99.0
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.95
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 98.94
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 98.69
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 98.5
PHA033661304 FGAM-synthase; Provisional 98.48
COG1897307 MetA Homoserine trans-succinylase [Amino acid tran 98.48
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.47
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.38
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 98.35
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 98.08
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 97.89
PRK00784488 cobyric acid synthase; Provisional 97.87
TIGR00313475 cobQ cobyric acid synthase CobQ. 97.86
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 97.83
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 97.75
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 97.7
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 97.64
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 97.59
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 97.58
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 97.55
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.54
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 97.54
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 97.45
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 97.43
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 97.39
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 97.23
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 97.15
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 97.08
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 97.08
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 97.03
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 97.03
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 96.89
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 96.79
PRK04155287 chaperone protein HchA; Provisional 96.69
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 96.64
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 96.6
PRK11574196 oxidative-stress-resistance chaperone; Provisional 96.59
PF09825 367 BPL_N: Biotin-protein ligase, N terminal; InterPro 96.56
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 96.56
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 96.49
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 96.4
COG3442250 Predicted glutamine amidotransferase [General func 96.35
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 95.83
PRK09393322 ftrA transcriptional activator FtrA; Provisional 95.29
KOG2764247 consensus Putative transcriptional regulator DJ-1 94.17
PRK11249752 katE hydroperoxidase II; Provisional 93.06
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 92.61
COG4090154 Uncharacterized protein conserved in archaea [Func 92.04
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 90.99
PF09897147 DUF2124: Uncharacterized protein conserved in arch 88.83
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 88.17
COG4977328 Transcriptional regulator containing an amidase do 86.51
PLN02884411 6-phosphofructokinase 86.51
cd00363338 PFK Phosphofructokinase, a key regulatory enzyme i 84.71
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 84.32
PTZ00286 459 6-phospho-1-fructokinase; Provisional 83.56
TIGR02477 539 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosp 81.35
PRK00561259 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 80.91
PRK07085 555 diphosphate--fructose-6-phosphate 1-phosphotransfe 80.84
PRK06555 403 pyrophosphate--fructose-6-phosphate 1-phosphotrans 80.64
PRK14072 416 6-phosphofructokinase; Provisional 80.57
PRK06830443 diphosphate--fructose-6-phosphate 1-phosphotransfe 80.54
PF0907548 STb_secrete: Heat-stable enterotoxin B, secretory; 80.39
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 80.35
PRK04761246 ppnK inorganic polyphosphate/ATP-NAD kinase; Revie 80.18
>PLN02335 anthranilate synthase Back     alignment and domain information
Probab=100.00  E-value=5.1e-40  Score=247.25  Aligned_cols=165  Identities=85%  Similarity=1.363  Sum_probs=142.5

Q ss_pred             HHHHHhcCCCEEEeCCCCCCCCCcchhHHHHHHcCCCCcEEeehHhHHHHHHHhCCeeccCCCcccccccceeEeccCCC
Q 030626            6 LVSYCRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGE   85 (174)
Q Consensus         6 ~~~~~~~~~dgiii~GG~~~~~~~~~~~~~i~~~~~~~PilGIC~G~Qll~~~~gg~v~~~~~~~~~~~~~~~~~~~~~~   85 (174)
                      .+++..+++|+|||+|||+++++.+...+.+++.+.++|+||||+|||+|+.++||++.+.+.+..+|.+.++.......
T Consensus        55 ~~~~~~~~~d~iVisgGPg~p~d~~~~~~~~~~~~~~~PiLGIClG~QlLa~alGg~v~~~~~~~~~G~~~~v~~~~~~~  134 (222)
T PLN02335         55 VEELKRKNPRGVLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSPVHYDEKGE  134 (222)
T ss_pred             HHHHHhcCCCEEEEcCCCCChhhccchHHHHHHhCCCCCEEEecHHHHHHHHHhCCEEEeCCCccccCceeeeEECCCCC
Confidence            34555668999999999999998877777777778889999999999999999999999987656688888777665446


Q ss_pred             CCcccCCCCceeecccccceecccCCCCCCcEEEEEcCCCceEEEeeCCCCceEEEecCCCCcCCCchHHHHHHHHHHHH
Q 030626           86 DGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIV  165 (174)
Q Consensus        86 ~~l~~~~~~~~~~~~~H~~~v~~~~l~~~~~~~~a~s~~~~i~a~~~~~~~~~~g~QfHPE~~~~~~~~~l~~~f~~~~~  165 (174)
                      +++|.+++..+.++++|+++++++++++..++++|+++++.|+++++++++++||+|||||+..+++|..||+||++.+.
T Consensus       135 ~~Lf~~l~~~~~v~~~H~~~v~~~~lp~~~~~v~a~~~~~~v~ai~~~~~~~i~GvQfHPE~~~~~~g~~i~~nF~~~~~  214 (222)
T PLN02335        135 EGLFSGLPNPFTAGRYHSLVIEKDTFPSDELEVTAWTEDGLIMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIIE  214 (222)
T ss_pred             ChhhhCCCCCCEEEechhheEecccCCCCceEEEEEcCCCCEEEEEecCCCCEEEEEeCCCCCCChhHHHHHHHHHHHHH
Confidence            78999999999999999999986666655599999999999999999988779999999999888999999999999887


Q ss_pred             HHHHh
Q 030626          166 RKEAA  170 (174)
Q Consensus       166 ~~~~~  170 (174)
                      ++++.
T Consensus       215 ~~~~~  219 (222)
T PLN02335        215 KKESE  219 (222)
T ss_pred             hhccc
Confidence            66554



>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>COG4090 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>PF09897 DUF2124: Uncharacterized protein conserved in archaea (DUF2124); InterPro: IPR009183 There are currently no experimental data for members of this group of archaeal proteins, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>PLN02884 6-phosphofructokinase Back     alignment and domain information
>cd00363 PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>PTZ00286 6-phospho-1-fructokinase; Provisional Back     alignment and domain information
>TIGR02477 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotransferase Back     alignment and domain information
>PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK07085 diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>PRK06555 pyrophosphate--fructose-6-phosphate 1-phosphotransferase; Validated Back     alignment and domain information
>PRK14072 6-phosphofructokinase; Provisional Back     alignment and domain information
>PRK06830 diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>PF09075 STb_secrete: Heat-stable enterotoxin B, secretory; InterPro: IPR015160 Members of this family assume a helical secondary structure, with two alpha helices forming a disulphide cross-linked alpha-helical hairpin Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK04761 ppnK inorganic polyphosphate/ATP-NAD kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1qdl_B195 The Crystal Structure Of Anthranilate Synthase From 1e-25
1i7q_B193 Anthranilate Synthase From S. Marcescens Length = 1 1e-20
1i1q_B192 Structure Of The Cooperative Allosteric Anthranilat 2e-20
1wl8_A189 Crystal Structure Of Ph1346 Protein From Pyrococcus 2e-10
2d7j_A209 Crystal Structure Analysis Of Glutamine Amidotransf 3e-10
1gpm_A 525 Escherichia Coli Gmp Synthetase Complexed With Amp 7e-09
2ywb_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 3e-07
2vpi_A218 Human Gmp Synthetase - Glutaminase Domain Length = 3e-07
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 5e-07
1m6v_B382 Crystal Structure Of The G359f (Small Subunit) Poin 5e-07
2ywc_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 6e-07
1t36_B382 Crystal Structure Of E. Coli Carbamoyl Phosphate Sy 6e-07
1jdb_C382 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-06
1c30_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 2e-05
1cs0_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 3e-05
1a9x_B379 Carbamoyl Phosphate Synthetase: Caught In The Act O 2e-04
2a9v_A212 Crystal Structure Of A Putative Gmp Synthase Subuni 2e-04
3tqi_A 527 Structure Of The Gmp Synthase (Guaa) From Coxiella 3e-04
3uow_A 556 Crystal Structure Of Pf10_0123, A Gmp Synthetase Fr 3e-04
>pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus Length = 195 Back     alignment and structure

Iteration: 1

Score = 112 bits (279), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 7/157 (4%) Query: 11 RKNPRGVLISPGPGAPQ---DSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSP 67 R +P ++ISPGPG P+ D G+SL + LG P+ GVC+G Q IG AFG KI R Sbjct: 43 RIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKI-RRA 101 Query: 68 LGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLI 127 V HGK S + L G++ F A RYHSLV+++ P ++A ED I Sbjct: 102 RKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISA--EDNEI 159 Query: 128 MAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMI 164 MA H++Y + GVQFHPES+ T+ G I+ NF+ + Sbjct: 160 MAIHHEEYP-IYGVQFHPESVGTSLGYKILYNFLNRV 195
>pdb|1I7Q|B Chain B, Anthranilate Synthase From S. Marcescens Length = 193 Back     alignment and structure
>pdb|1I1Q|B Chain B, Structure Of The Cooperative Allosteric Anthranilate Synthase From Salmonella Typhimurium Length = 192 Back     alignment and structure
>pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 Back     alignment and structure
>pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 Back     alignment and structure
>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>pdb|2VPI|A Chain A, Human Gmp Synthetase - Glutaminase Domain Length = 218 Back     alignment and structure
>pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
>pdb|1M6V|B Chain B, Crystal Structure Of The G359f (Small Subunit) Point Mutant Of Carbamoyl Phosphate Synthetase Length = 382 Back     alignment and structure
>pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
>pdb|1T36|B Chain B, Crystal Structure Of E. Coli Carbamoyl Phosphate Synthetase Small Subunit Mutant C248d Complexed With Uridine 5'-Monophosphate Length = 382 Back     alignment and structure
>pdb|1JDB|C Chain C, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 382 Back     alignment and structure
>pdb|1C30|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small Subunit Mutation C269s Length = 382 Back     alignment and structure
>pdb|1CS0|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase Complexed At Cys269 In The Small Subunit With The Tetrahedral Mimic L-glutamate Gamma-semialdehyde Length = 382 Back     alignment and structure
>pdb|1A9X|B Chain B, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 379 Back     alignment and structure
>pdb|2A9V|A Chain A, Crystal Structure Of A Putative Gmp Synthase Subunit A Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45 A Resolution Length = 212 Back     alignment and structure
>pdb|3TQI|A Chain A, Structure Of The Gmp Synthase (Guaa) From Coxiella Burnetii Length = 527 Back     alignment and structure
>pdb|3UOW|A Chain A, Crystal Structure Of Pf10_0123, A Gmp Synthetase From Plasmodium Falciparum Length = 556 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 5e-78
1i1q_B192 Anthranilate synthase component II; tryptophan bio 3e-76
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 1e-34
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 2e-25
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 4e-18
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 4e-18
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 6e-18
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 7e-18
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 1e-17
2a9v_A212 GMP synthase; structural genomics, joint center fo 9e-17
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 4e-16
3uow_A 556 GMP synthetase; structural genomics consortium, SG 7e-15
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 1e-13
3l7n_A236 Putative uncharacterized protein; glutamine amidot 5e-11
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 6e-11
1q7r_A219 Predicted amidotransferase; structural genomics, Y 2e-10
3m3p_A250 Glutamine amido transferase; structural genomics, 3e-10
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 1e-09
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 2e-09
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 2e-08
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 2e-07
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 3e-06
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 3e-05
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure
 Score =  229 bits (587), Expect = 5e-78
 Identities = 65/157 (41%), Positives = 91/157 (57%), Gaps = 7/157 (4%)

Query: 11  RKNPRGVLISPGPGAP---QDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSP 67
           R +P  ++ISPGPG P   +D G+SL  +  LG   P+ GVC+G Q IG AFG KI R+ 
Sbjct: 43  RIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRAR 102

Query: 68  LGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLI 127
             V HGK S +         L  G++  F A RYHSLV+++   P   ++  +  ED  I
Sbjct: 103 K-VFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRP-LIVDAISA-EDNEI 159

Query: 128 MAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMI 164
           MA  H++Y  + GVQFHPES+ T+ G  I+ NF+  +
Sbjct: 160 MAIHHEEYP-IYGVQFHPESVGTSLGYKILYNFLNRV 195


>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Length = 645 Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Length = 236 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Length = 191 Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Length = 219 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Length = 196 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Length = 186 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Length = 379 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Length = 208 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Length = 227 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 100.0
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 100.0
2a9v_A212 GMP synthase; structural genomics, joint center fo 100.0
1i1q_B192 Anthranilate synthase component II; tryptophan bio 100.0
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 100.0
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 100.0
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.98
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.98
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.98
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.98
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.97
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.97
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.97
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.97
3m3p_A250 Glutamine amido transferase; structural genomics, 99.96
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.96
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.96
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.95
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.95
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.95
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.95
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.95
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.94
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.94
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.94
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.92
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.92
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.92
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.91
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.91
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.9
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.88
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.87
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.86
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.85
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.2
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 97.72
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 97.69
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 97.61
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 97.6
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 97.48
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 97.47
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 97.36
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 97.25
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 97.21
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 97.17
3cne_A175 Putative protease I; structural genomics, PSI-2, M 97.15
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 97.06
3gra_A202 Transcriptional regulator, ARAC family; transcript 97.02
2fex_A188 Conserved hypothetical protein; structural genomic 96.99
1u9c_A224 APC35852; structural genomics, protein structure i 96.93
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 96.89
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 96.7
3er6_A209 Putative transcriptional regulator protein; struct 96.67
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 96.61
3n7t_A247 Macrophage binding protein; seattle structural gen 96.58
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 96.38
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 96.24
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 96.22
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 96.18
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 96.02
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 96.0
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 95.96
3mgk_A211 Intracellular protease/amidase related enzyme (THI 95.91
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 95.89
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 95.86
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 95.76
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 95.1
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 94.74
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 94.64
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 93.28
2r47_A157 Uncharacterized protein MTH_862; unknown function, 89.82
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 86.4
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 82.96
1ehs_A48 STB, heat-stable enterotoxin B; disulfide; NMR {Es 80.75
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
Probab=100.00  E-value=7.9e-36  Score=219.93  Aligned_cols=150  Identities=43%  Similarity=0.707  Sum_probs=124.5

Q ss_pred             HHHHHhcCCCEEEeCCCCCCCCCcc--hh-HHHHHHcCCCCcEEeehHhHHHHHHHhCCeeccCCCcccccccceeEecc
Q 030626            6 LVSYCRKNPRGVLISPGPGAPQDSG--IS-LQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDE   82 (174)
Q Consensus         6 ~~~~~~~~~dgiii~GG~~~~~~~~--~~-~~~i~~~~~~~PilGIC~G~Qll~~~~gg~v~~~~~~~~~~~~~~~~~~~   82 (174)
                      .+++...++|||||+||++++.+..  .+ .+.+++...++|+||||+|||+|+.++||++.+.+. ..+|.+..+....
T Consensus        38 ~~~~~~~~~dglil~gG~~~~~~~~~~~~~~~~i~~~~~~~PvLGIC~G~QlL~~~~gg~v~~~~~-~~~g~~~~v~~~~  116 (195)
T 1qdl_B           38 IKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARK-VFHGKISNIILVN  116 (195)
T ss_dssp             HHHHHHHCCSEEEECCCSSCTTSHHHHTTHHHHHHHHTTTSCEEEETHHHHHHHHHTTCEEEEEEE-EEEEEEEEEEECC
T ss_pred             HHHHhhCCCCEEEECCCCCChhhhhhhhHHHHHHHHhcCCCcEEEEehHHHHHHHHhCCEEeccCC-CcCCCceEEEECC
Confidence            3466655799999999999988742  13 355555677899999999999999999999988763 4567666555542


Q ss_pred             CCCC--CcccCCCCceeecccccceecccCCCCCCcEEEEEc-CCCceEEEeeCCCCceEEEecCCCCcCCCchHHHHHH
Q 030626           83 KGED--GLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWT-EDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRN  159 (174)
Q Consensus        83 ~~~~--~l~~~~~~~~~~~~~H~~~v~~~~l~~~~~~~~a~s-~~~~i~a~~~~~~~~~~g~QfHPE~~~~~~~~~l~~~  159 (174)
                        .+  ++|+++++.+.++++|++.+..   ++++++++|++ +++.++|++.++++ ++|+|||||+..++.+.+||++
T Consensus       117 --~~~~~l~~~~~~~~~v~~~H~~~v~~---l~~~~~vla~s~~~g~i~a~~~~~~~-~~gvQfHPE~~~~~~g~~l~~~  190 (195)
T 1qdl_B          117 --NSPLSLYYGIAKEFKATRYHSLVVDE---VHRPLIVDAISAEDNEIMAIHHEEYP-IYGVQFHPESVGTSLGYKILYN  190 (195)
T ss_dssp             --SSCCSTTTTCCSEEEEEEEEEEEEEC---CCTTEEEEEEESSSCCEEEEEESSSS-EEEESSBTTSTTCTTHHHHHHH
T ss_pred             --CCHhHHHhcCCCceEEeccccchhhh---CCCCcEEEEEECCCCcEEEEEeCCCC-EEEEecCCCCCCCccHHHHHHH
Confidence              44  8999998889999999999975   67899999999 89999999998765 9999999999877889999999


Q ss_pred             HHH
Q 030626          160 FIK  162 (174)
Q Consensus       160 f~~  162 (174)
                      |++
T Consensus       191 f~~  193 (195)
T 1qdl_B          191 FLN  193 (195)
T ss_dssp             HHH
T ss_pred             HHh
Confidence            997



>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>2r47_A Uncharacterized protein MTH_862; unknown function, structural genomics, APC5901, PSI-2; 1.88A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ehs_A STB, heat-stable enterotoxin B; disulfide; NMR {Escherichia coli} SCOP: g.2.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 3e-27
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 5e-24
d1gpma2205 c.23.16.1 (A:3-207) GMP synthetase {Escherichia co 9e-21
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 3e-20
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 6e-17
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 7e-15
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 7e-15
d2nv0a1195 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bac 3e-09
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 1e-07
d1o1ya_230 c.23.16.1 (A:) Hypothetical protein TM1158 {Thermo 6e-06
d2abwa1218 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protei 9e-05
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 2e-04
d1q7ra_202 c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus 3e-04
d2ghra1281 c.23.16.8 (A:17-297) Homoserine O-succinyltransfer 6e-04
d1ka9h_195 c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i 0.002
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Carbamoyl phosphate synthetase, small subunit C-terminal domain
species: Escherichia coli [TaxId: 562]
 Score =  100 bits (249), Expect = 3e-27
 Identities = 31/154 (20%), Positives = 60/154 (38%), Gaps = 13/154 (8%)

Query: 13  NPRGVLISPGPGAPQDSGISLQTVLE-LGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVM 71
           NP G+ +S GPG P     ++  + + L   +P+FG+C+G Q +  A G K V+   G  
Sbjct: 80  NPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHH 139

Query: 72  HGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAAR 131
            G   +   ++                 + H   +++ + P++         DG +    
Sbjct: 140 GGNHPVKDVEKN----------VVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIH 189

Query: 132 HKKYKHLQGVQFHPESIITTE-GKTIVRNFIKMI 164
                     Q +PE+         +  +FI++I
Sbjct: 190 RTDKP-AFSFQGNPEASPGPHDAAPLFDHFIELI 222


>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Length = 230 Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 218 Back     information, alignment and structure
>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 100.0
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 100.0
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 100.0
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 100.0
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 100.0
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 100.0
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 99.97
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.95
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.94
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.93
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.93
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.91
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.9
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.87
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.87
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.86
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.83
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.39
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 97.44
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 97.26
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 97.15
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 97.11
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 96.97
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 96.83
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 96.74
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 96.73
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 95.97
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 94.77
d1ehsa_48 Heat-stable enterotoxin B {Escherichia coli [TaxId 80.75
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: GMP synthase subunit A, GuaAA
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=100.00  E-value=8.4e-37  Score=223.55  Aligned_cols=152  Identities=24%  Similarity=0.350  Sum_probs=126.7

Q ss_pred             CCCEEEeCCCCCCCCCcchhHHHHHH--cCCCCcEEeehHhHHHHHHHhCCeeccCCCcccccccceeEeccCCCCCccc
Q 030626           13 NPRGVLISPGPGAPQDSGISLQTVLE--LGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLA   90 (174)
Q Consensus        13 ~~dgiii~GG~~~~~~~~~~~~~i~~--~~~~~PilGIC~G~Qll~~~~gg~v~~~~~~~~~~~~~~~~~~~~~~~~l~~   90 (174)
                      ++||||++||+++..+...++..+.+  ...++|+||||+|||+|+.++||++.+..... ++ +..+..  ...+++|+
T Consensus        42 ~~dgiIl~Gg~~~~~~~~~~~~~l~~~~~~~~~PilGIC~G~Qll~~~~gg~~~~~~~~~-~~-~~~~~~--~~~~~l~~  117 (196)
T d2a9va1          42 GLDGLVLSGGAPNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPE-FG-KTKVSV--MHSENIFG  117 (196)
T ss_dssp             TCSEEEEEEECSCGGGTGGGHHHHHHHHHHCCSCEEEETHHHHHHHHHTTCEEEEEEEEE-EE-EEEEEE--SCCCGGGT
T ss_pred             cCCcEEEeccccccccccchhhhHHHHHhhcCceEEEeehhhhhhhhccccccccccccc-cc-cceEEE--ecCCcccc
Confidence            68999999999998877766555543  35689999999999999999999998876322 22 222222  24678999


Q ss_pred             CCCCceeecccccceecccCCCCCCcEEEEEcCCCceEEEeeCCCCceEEEecCCCCcCCCchHHHHHHHHHHHHHHHHh
Q 030626           91 GLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAA  170 (174)
Q Consensus        91 ~~~~~~~~~~~H~~~v~~~~l~~~~~~~~a~s~~~~i~a~~~~~~~~~~g~QfHPE~~~~~~~~~l~~~f~~~~~~~~~~  170 (174)
                      ++++.+.++++|++.+..   ++++++++|+++++.++++++++++ +||+|||||+..+++|.+||+||++.|.+.+..
T Consensus       118 ~~~~~~~~~~~H~~~v~~---~~~~~~v~a~~~~~~v~ai~~~~~~-i~gvQfHPE~~~s~~G~~il~~F~~~~~~~~~~  193 (196)
T d2a9va1         118 GLPSEITVWENHNDEIIN---LPDDFTLAASSATCQVQGFYHKTRP-IYATQFHPEVEHTQYGRDIFRNFIGICASYREI  193 (196)
T ss_dssp             TCCSEEEEEEEEEEEEES---CCTTEEEEEECSSCSCSEEEESSSS-EEEESSCTTSTTSTTHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCceEEEecceeEEEe---CCCccceeecccccchheEEECCCC-EEEEEeCcccCCCccHHHHHHHHHHHHHHHHHh
Confidence            999999999999999986   7799999999999999999999876 999999999878889999999999999987765


Q ss_pred             hc
Q 030626          171 DS  172 (174)
Q Consensus       171 ~~  172 (174)
                      ++
T Consensus       194 ~~  195 (196)
T d2a9va1         194 QK  195 (196)
T ss_dssp             HH
T ss_pred             cc
Confidence            43



>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ehsa_ g.2.1.1 (A:) Heat-stable enterotoxin B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure