Citrus Sinensis ID: 030710

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MHLEGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
cccccccHHccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHcccccHHHHcccccccccccEEEEEEccccccccccHHHHHHHccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHc
cccccEEEEEEcccccHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccHHHcccccccEEEEEEEEEEcccccEEccccHHHHHHccccHHHcccccEEEEEccccHHHHcccHHHHHHHHHHHHHcc
MHLEGLISdvlqepgvaeedfAQIDTARLIKKflggrspkppcvpkeigfrglpdlrtlpswlseedvnyyaskfsqkgftgglnyyrcldlnwellapwtgaqikipvkfmvgdldityhipgireyiqnggfkkdvpglqEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
MHLEGLISdvlqepgvaeEDFAQIDTARLIKKflggrspkppcvpkeigfrglpDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINqekadevssHIYDFIKQF
MHLEGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
*****************EEDFAQIDTARLIKKFLGGR***PPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFI***
MHLEGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
MHLEGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
MHLEGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLEGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q6Q2C2555 Bifunctional epoxide hydr yes no 0.687 0.214 0.312 1e-10
P34913555 Bifunctional epoxide hydr yes no 0.878 0.273 0.25 2e-08
P80299554 Bifunctional epoxide hydr yes no 0.884 0.276 0.265 3e-07
P34914554 Bifunctional epoxide hydr yes no 0.884 0.276 0.265 2e-06
Q9H6B9360 Epoxide hydrolase 3 OS=Ho no no 0.578 0.277 0.3 0.0002
>sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 Back     alignment and function desciption
 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 6/125 (4%)

Query: 11  LQEPGVAEEDFAQIDTARLIKKFLGGRSPK--PPCVPKEIG--FRGLPDLRTLPSWLSEE 66
            QEPGVAE +  Q +  R  K F              +E+G  F G P+  +L   ++EE
Sbjct: 387 FQEPGVAEAELEQ-NLDRTFKNFFRAHDETFLTTNRVRELGGLFVGTPEEPSLSRLVTEE 445

Query: 67  DVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIR 126
           D+ +Y  +F + GF G LN+YR ++ NW+     +G +I IP   +  + D+  H P + 
Sbjct: 446 DIQFYVQQFKKSGFRGPLNWYRNMERNWQWGCKGSGRKILIPALMVTAENDLVLH-PKMS 504

Query: 127 EYIQN 131
           ++++N
Sbjct: 505 KHMEN 509
Acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Also determines steady-state levels of physiological mediators. Has low phosphatase activity.
Sus scrofa (taxid: 9823)
EC: 3EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 0
>sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 Back     alignment and function description
>sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 Back     alignment and function description
>sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 Back     alignment and function description
>sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
224128448 317 predicted protein [Populus trichocarpa] 0.942 0.514 0.754 2e-70
118483787 317 unknown [Populus trichocarpa] 0.942 0.514 0.748 1e-69
224068364 316 predicted protein [Populus trichocarpa] 0.942 0.515 0.730 8e-69
255564222 316 epoxide hydrolase, putative [Ricinus com 0.942 0.515 0.736 2e-67
356572746 317 PREDICTED: epoxide hydrolase 2-like [Gly 0.942 0.514 0.725 2e-67
46090793 316 soluble epoxide hydrolase [Citrus jambhi 0.942 0.515 0.723 5e-65
18411917 324 putative epoxide hydrolase [Arabidopsis 0.942 0.503 0.687 2e-64
255564220 315 epoxide hydrolase, putative [Ricinus com 0.936 0.514 0.699 4e-64
297814077 324 hypothetical protein ARALYDRAFT_490337 [ 0.942 0.503 0.674 1e-63
300608166 316 epoxide hydrolase 2 [Prunus persica] 0.942 0.515 0.674 7e-63
>gi|224128448|ref|XP_002320333.1| predicted protein [Populus trichocarpa] gi|222861106|gb|EEE98648.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (87%)

Query: 11  LQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNY 70
            QEPG  EEDFAQ+DTAR+I+KFL  R+PKPPC+PKE+GFRGLPD   LPSWLSE+D+NY
Sbjct: 154 FQEPGEVEEDFAQMDTARIIRKFLTSRNPKPPCIPKEVGFRGLPDNPNLPSWLSEKDINY 213

Query: 71  YASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQ 130
           YA KF+Q GFTGGLNYYRCLDLNWEL+A WTG QIK+PVKF+VGDLDITY++PG ++YI 
Sbjct: 214 YAGKFNQTGFTGGLNYYRCLDLNWELMAAWTGLQIKVPVKFIVGDLDITYNMPGAQDYIS 273

Query: 131 NGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF 173
            GG KK VP LQEV +MEGVAHF+NQEK +EVSSHIYDFIK+F
Sbjct: 274 KGGLKKYVPFLQEVAIMEGVAHFLNQEKPEEVSSHIYDFIKKF 316

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118483787|gb|ABK93786.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224068364|ref|XP_002302724.1| predicted protein [Populus trichocarpa] gi|222844450|gb|EEE81997.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255564222|ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis] gi|223537670|gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356572746|ref|XP_003554527.1| PREDICTED: epoxide hydrolase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|46090793|dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri] Back     alignment and taxonomy information
>gi|18411917|ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana] gi|3193297|gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana] gi|7268994|emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana] gi|20856515|gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana] gi|23308303|gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana] gi|332656757|gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255564220|ref|XP_002523107.1| epoxide hydrolase, putative [Ricinus communis] gi|223537669|gb|EEF39292.1| epoxide hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297814077|ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. lyrata] gi|297320759|gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|300608166|emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2133234324 AT4G02340 [Arabidopsis thalian 0.936 0.5 0.691 4.2e-63
TAIR|locus:2078067331 AT3G05600 [Arabidopsis thalian 0.913 0.477 0.518 3.1e-44
TAIR|locus:2129835375 AT4G15960 [Arabidopsis thalian 0.936 0.432 0.466 1.2e-42
TAIR|locus:2043868321 SEH "soluble epoxide hydrolase 0.936 0.504 0.509 4e-42
TAIR|locus:2043808320 AT2G26750 [Arabidopsis thalian 0.936 0.506 0.496 2.8e-41
TAIR|locus:1005716317304 AT4G15955 [Arabidopsis thalian 0.687 0.391 0.529 1.1e-34
TAIR|locus:2080938323 AT3G51000 [Arabidopsis thalian 0.959 0.513 0.433 1.4e-32
UNIPROTKB|O06266322 ephA "Epoxide hydrolase" [Myco 0.878 0.472 0.311 2.5e-19
UNIPROTKB|Q0BYL3327 HNE_2751 "Putative epoxide hyd 0.907 0.480 0.325 6.8e-17
UNIPROTKB|Q0BZI5320 HNE_2413 "Putative epoxide hyd 0.872 0.471 0.325 5.9e-15
TAIR|locus:2133234 AT4G02340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 644 (231.8 bits), Expect = 4.2e-63, P = 4.2e-63
 Identities = 112/162 (69%), Positives = 135/162 (83%)

Query:    12 QEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYY 71
             QEPG  EEDFAQ+DT +LI +F   R+P+PPC+PK +GFRGLPD  +LP+WL+E+DV +Y
Sbjct:   155 QEPGEIEEDFAQVDTKKLITRFFTSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVRFY 214

Query:    72 ASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQN 131
               KFSQKGFTGGLNYYR L+L+WEL APWTG QIK+PVKF+VGDLDITY+IPG +EYI  
Sbjct:   215 GDKFSQKGFTGGLNYYRALNLSWELTAPWTGLQIKVPVKFIVGDLDITYNIPGTKEYIHE 274

Query:   132 GGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF 173
             GG KK VP LQEV+VMEGV HF++QEK DEV+ HIY F K+F
Sbjct:   275 GGLKKHVPFLQEVVVMEGVGHFLHQEKPDEVTDHIYGFFKKF 316
GO:0003824 "catalytic activity" evidence=IEA
GO:0004301 "epoxide hydrolase activity" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2078067 AT3G05600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129835 AT4G15960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043868 SEH "soluble epoxide hydrolase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043808 AT2G26750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716317 AT4G15955 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080938 AT3G51000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O06266 ephA "Epoxide hydrolase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYL3 HNE_2751 "Putative epoxide hydrolase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BZI5 HNE_2413 "Putative epoxide hydrolase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XIV2465
SubName- Full=Putative uncharacterized protein; (317 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 2e-04
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information 
 Score = 40.8 bits (94), Expect = 2e-04
 Identities = 14/87 (16%), Positives = 31/87 (35%), Gaps = 6/87 (6%)

Query: 86  YYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVI 145
               L    +       A+I +P   + G+ D        R           +P    ++
Sbjct: 201 LAAALLALLDRDLRAALARITVPTLIIHGEDDPVVPAELARRL------AAALPNDARLV 254

Query: 146 VMEGVAHFINQEKADEVSSHIYDFIKQ 172
           V+ G  HF + E  +  ++ +  F+++
Sbjct: 255 VIPGAGHFPHLEAPEAFAAALLAFLER 281

Length = 282

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.92
PRK03592295 haloalkane dehalogenase; Provisional 99.48
PLN02679360 hydrolase, alpha/beta fold family protein 99.42
PLN02965255 Probable pheophorbidase 99.36
PLN02824294 hydrolase, alpha/beta fold family protein 99.35
PRK03204286 haloalkane dehalogenase; Provisional 99.31
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.29
PRK10349256 carboxylesterase BioH; Provisional 99.29
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.27
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.25
KOG2984277 consensus Predicted hydrolase [General function pr 99.23
PRK00870302 haloalkane dehalogenase; Provisional 99.22
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.22
PRK10673255 acyl-CoA esterase; Provisional 99.19
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.18
PRK07581339 hypothetical protein; Validated 99.16
PLN02578354 hydrolase 99.13
PRK08775343 homoserine O-acetyltransferase; Provisional 99.12
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.1
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.09
PRK06489360 hypothetical protein; Provisional 99.09
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.07
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.06
PLN02385349 hydrolase; alpha/beta fold family protein 99.04
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.04
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.04
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.02
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.97
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.95
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.94
PLN02894402 hydrolase, alpha/beta fold family protein 98.94
PHA02857276 monoglyceride lipase; Provisional 98.88
PLN02511388 hydrolase 98.87
PRK06765389 homoserine O-acetyltransferase; Provisional 98.86
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.85
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.78
PRK10749330 lysophospholipase L2; Provisional 98.76
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.73
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.71
PRK05855 582 short chain dehydrogenase; Validated 98.7
PLN02298330 hydrolase, alpha/beta fold family protein 98.7
PLN02211273 methyl indole-3-acetate methyltransferase 98.67
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 98.61
PLN02652395 hydrolase; alpha/beta fold family protein 98.6
PRK10985324 putative hydrolase; Provisional 98.51
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.4
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.28
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.27
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.25
PLN02872395 triacylglycerol lipase 98.14
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.13
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 98.12
COG1647243 Esterase/lipase [General function prediction only] 98.07
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.07
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 97.94
PRK07868 994 acyl-CoA synthetase; Validated 97.87
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 97.7
COG3208244 GrsT Predicted thioesterase involved in non-riboso 97.67
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.66
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.54
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.49
PRK11460232 putative hydrolase; Provisional 97.46
PRK10566249 esterase; Provisional 97.35
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 97.27
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.27
KOG2931326 consensus Differentiation-related gene 1 protein ( 97.08
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 96.96
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 96.95
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 96.95
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 96.93
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 96.91
PRK11071190 esterase YqiA; Provisional 96.89
KOG1455313 consensus Lysophospholipase [Lipid transport and m 96.81
KOG1552258 consensus Predicted alpha/beta hydrolase [General 96.8
KOG2565469 consensus Predicted hydrolases or acyltransferases 96.78
KOG2564343 consensus Predicted acetyltransferases and hydrola 96.74
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.67
PRK13604307 luxD acyl transferase; Provisional 96.46
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 96.44
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 96.26
KOG1838409 consensus Alpha/beta hydrolase [General function p 96.14
KOG4667269 consensus Predicted esterase [Lipid transport and 96.02
COG2945210 Predicted hydrolase of the alpha/beta superfamily 95.77
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 95.63
COG0400207 Predicted esterase [General function prediction on 95.49
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 95.35
PLN02442283 S-formylglutathione hydrolase 94.91
KOG3043242 consensus Predicted hydrolase related to dienelact 94.91
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 94.89
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 94.88
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 94.84
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 94.81
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 94.79
COG1073299 Hydrolases of the alpha/beta superfamily [General 94.77
COG0412236 Dienelactone hydrolase and related enzymes [Second 94.6
PLN02209437 serine carboxypeptidase 94.56
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 94.5
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 94.42
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 94.35
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 94.34
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 93.98
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 92.82
PF06850202 PHB_depo_C: PHB de-polymerase C-terminus; InterPro 91.9
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 91.85
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 91.6
PRK10162318 acetyl esterase; Provisional 91.54
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 91.5
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 90.8
PRK10115686 protease 2; Provisional 90.25
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 89.8
KOG1551371 consensus Uncharacterized conserved protein [Funct 89.19
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 88.98
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 88.01
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 86.17
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 86.04
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 85.94
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 85.9
PLN00021313 chlorophyllase 83.9
COG4757281 Predicted alpha/beta hydrolase [General function p 82.22
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 82.15
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 82.13
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 81.99
COG4188365 Predicted dienelactone hydrolase [General function 80.78
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information 
Probab=99.92  E-value=1.1e-24  Score=164.31  Aligned_cols=156  Identities=46%  Similarity=0.803  Sum_probs=126.0

Q ss_pred             cccchhccCCcChHHHhhccCCHHHHHHHHHhcCCCCCCCCCCccccCCCCCCCCCCCCCCHHHHHHHHHHhccCCCcch
Q 030710            4 EGLISDVLQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGG   83 (173)
Q Consensus         4 ~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (173)
                      +++|++.||.|+.++.++++.+.+.+....+....+.+...+.        .....+.|+|+++++.|...+...|+++.
T Consensus       165 ~~~y~~~fQ~~~~~E~~~s~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~w~t~edi~~~~~~f~~~g~~gp  236 (322)
T KOG4178|consen  165 KSYYICLFQEPGKPETELSKDDTEMLVKTFRTRKTPGPLIVPK--------QPNENPLWLTEEDIAFYVSKFQIDGFTGP  236 (322)
T ss_pred             ccceeEeccccCcchhhhccchhHHhHHhhhccccCCccccCC--------CCCCccchhhHHHHHHHHhcccccccccc
Confidence            5788999999999999998856655555555544333222222        11122679999999999999988789999


Q ss_pred             hhhhhhcccCccccCCCCCCCcCCceEEEeeCCCcCCCCcchhhHhhhccccccCCCCceeEEeCCCCCChhhhCHHHHH
Q 030710           84 LNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVS  163 (173)
Q Consensus        84 ~~~yr~~~~~~~~~~~~~~~~i~vP~l~i~G~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~GH~~~~e~p~~v~  163 (173)
                      +||||++.++|+ ...+.+.+|++|+++|||+.|++.+.+..     .+.+++.+|++.+.++++|+|||+++|+|++||
T Consensus       237 lNyyrn~~r~w~-a~~~~~~~i~iPv~fi~G~~D~v~~~p~~-----~~~~rk~vp~l~~~vv~~~~gH~vqqe~p~~v~  310 (322)
T KOG4178|consen  237 LNYYRNFRRNWE-AAPWALAKITIPVLFIWGDLDPVLPYPIF-----GELYRKDVPRLTERVVIEGIGHFVQQEKPQEVN  310 (322)
T ss_pred             chhhHHHhhCch-hccccccccccceEEEEecCcccccchhH-----HHHHHHhhccccceEEecCCcccccccCHHHHH
Confidence            999999999987 66677889999999999999999887633     478899999876889999999999999999999


Q ss_pred             HHHHHHHHhC
Q 030710          164 SHIYDFIKQF  173 (173)
Q Consensus       164 ~~i~~fl~~~  173 (173)
                      ++|.+|+.++
T Consensus       311 ~~i~~f~~~~  320 (322)
T KOG4178|consen  311 QAILGFINSF  320 (322)
T ss_pred             HHHHHHHHhh
Confidence            9999999863

>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3cxu_A328 Structure Of A Y149f Mutant Of Epoxide Hydrolase Fr 4e-54
2cjp_A328 Structure Of Potato (Solanum Tuberosum) Epoxide Hyd 4e-54
3ans_A336 Human Soluble Epoxide Hydrolase In Complex With A S 1e-09
3pdc_A344 Crystal Structure Of Hydrolase Domain Of Human Solu 1e-09
1s8o_A555 Human Soluble Epoxide Hydrolase Length = 555 1e-09
2zjf_A362 Crystal Structure Of Mycobacterium Tuberculosis Epo 2e-09
2e3j_A356 The Crystal Structure Of Epoxide Hydrolase B (Rv193 2e-09
1cqz_A554 Crystal Structure Of Murine Soluble Epoxide Hydrola 2e-07
>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From Solanum Tuberosum Length = 328 Back     alignment and structure 
Iteration: 1

 Score =  206 bits (525), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 95/164 (57%), Positives = 120/164 (73%), Gaps = 1/164 (0%)
Query: 11  LQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDL-RTLPSWLSEEDVN 69
            Q PG  E +FA I    ++KK L  R P P   PK  G   +PD    L SWLSEE+++
Sbjct: 165 FQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELD 224
Query: 70  YYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYI 129
           YYA+KF Q GFTG +NYYR L +NWEL APWTGAQ+K+P KF+VG+ D+ YHIPG +EYI
Sbjct: 225 YYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYI 284
Query: 130 QNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF 173
            NGGFKKDVP L+EV+V+EG AHF++QE+  E+S HIYDFI++F
Sbjct: 285 HNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF 328
>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase I (Steh1) Length = 328 Back     alignment and structure
>pdb|3ANS|A Chain A, Human Soluble Epoxide Hydrolase In Complex With A Synthetic Inhibitor Length = 336 Back     alignment and structure
>pdb|3PDC|A Chain A, Crystal Structure Of Hydrolase Domain Of Human Soluble Epoxide Hydrolase Complexed With A Benzoxazole Inhibitor Length = 344 Back     alignment and structure
>pdb|1S8O|A Chain A, Human Soluble Epoxide Hydrolase Length = 555 Back     alignment and structure
>pdb|2ZJF|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Epoxide Hydrolase B Complexed With An Inhibitor Length = 362 Back     alignment and structure
>pdb|2E3J|A Chain A, The Crystal Structure Of Epoxide Hydrolase B (Rv1938) From Mycobacterium Tuberculosis At 2.1 Angstrom Length = 356 Back     alignment and structure
>pdb|1CQZ|A Chain A, Crystal Structure Of Murine Soluble Epoxide Hydrolase. Length = 554 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 6e-65
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 4e-49
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 3e-36
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 2e-31
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 4e-27
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 3e-23
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 1e-20
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 9e-20
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 5e-19
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 2e-17
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 2e-14
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 1e-13
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 3e-13
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 7e-11
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 8e-11
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 2e-10
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 2e-09
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 1e-08
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 6e-08
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 1e-07
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 3e-06
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 1e-05
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 2e-05
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 3e-05
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 4e-05
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 4e-05
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 5e-05
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 1e-04
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 1e-04
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 2e-04
1iup_A282 META-cleavage product hydrolase; aromatic compound 6e-04
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 8e-04
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 8e-04
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 Back     alignment and structure
 Score =  201 bits (512), Expect = 6e-65
 Identities = 95/164 (57%), Positives = 120/164 (73%), Gaps = 1/164 (0%)

Query: 11  LQEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGLPDLRT-LPSWLSEEDVN 69
            Q PG  E +FA I    ++KK L  R P P   PK  G   +PD    L SWLSEE+++
Sbjct: 165 FQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELD 224

Query: 70  YYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYI 129
           YYA+KF Q GFTG +NYYR L +NWEL APWTGAQ+K+P KF+VG+ D+ YHIPG +EYI
Sbjct: 225 YYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYI 284

Query: 130 QNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF 173
            NGGFKKDVP L+EV+V+EG AHF++QE+  E+S HIYDFI++F
Sbjct: 285 HNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF 328
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.66
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.56
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.53
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.53
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.51
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.48
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.47
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.44
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.15
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.42
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.42
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.41
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.39
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.38
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.37
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.36
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.36
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.35
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.35
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.35
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.34
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.33
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.33
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.32
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.32
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.31
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.3
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.3
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.3
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.29
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.28
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.28
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.28
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.27
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.27
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.27
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.27
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.26
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.25
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.23
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.21
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.21
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.2
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.18
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.18
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.18
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.18
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.18
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.15
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.14
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.13
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.13
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.12
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.12
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.12
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.1
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.1
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.1
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.1
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.09
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.08
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.07
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.07
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.06
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.06
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.06
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.06
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.06
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.06
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.05
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.03
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.01
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.01
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.01
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.96
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.95
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.95
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.94
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.9
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.88
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.87
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.86
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.86
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.85
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.85
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.85
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.84
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.83
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.82
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.82
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.78
3h04_A275 Uncharacterized protein; protein with unknown func 98.78
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.75
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.74
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.74
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.73
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.73
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.72
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.67
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.63
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.63
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.6
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.59
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.58
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.58
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.57
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.55
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.55
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.52
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.5
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.5
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.46
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.46
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.45
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.44
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.43
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.42
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.4
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.4
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.39
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.38
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.35
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.33
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.33
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.31
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.29
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.28
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.26
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.26
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.25
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.25
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.25
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.24
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.24
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.23
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.22
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.22
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.21
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.21
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.19
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.16
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.16
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.12
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.1
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.1
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.07
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.03
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.99
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.98
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 97.95
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.94
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.92
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 97.87
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.86
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 97.83
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.83
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 97.72
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.71
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.71
3tej_A329 Enterobactin synthase component F; nonribosomal pe 97.68
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.64
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 97.63
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.62
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.6
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.58
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 97.57
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 97.56
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.56
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.55
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.54
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.53
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 97.42
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.42
3d59_A383 Platelet-activating factor acetylhydrolase; secret 97.4
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 97.4
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 97.38
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.37
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 97.35
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.32
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.31
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.28
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.24
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 97.23
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.18
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.16
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.06
3lp5_A250 Putative cell surface hydrolase; structural genom 96.79
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 96.77
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 96.72
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 96.66
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 96.54
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 96.49
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 96.4
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 96.33
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 96.26
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 96.22
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 96.2
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 96.03
1ivy_A452 Human protective protein; carboxypeptidase, serine 96.02
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 95.76
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 95.39
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 95.33
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 95.23
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 95.05
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 94.75
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 94.38
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 94.31
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 92.99
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 90.36
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 88.41
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
Probab=99.66  E-value=7.5e-16  Score=117.43  Aligned_cols=114  Identities=67%  Similarity=1.300  Sum_probs=84.4

Q ss_pred             CCCCCHHHHHHHHHHhccCCCcchhhhhhhcccCccccCCCCCCCcCCceEEEeeCCCcCCCCcchhhHhhhccccccCC
Q 030710           60 PSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVP  139 (173)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~~~~~~~~yr~~~~~~~~~~~~~~~~i~vP~l~i~G~~D~~~~~~~~~~~~~~~~~~~~~~  139 (173)
                      +.+++++.++.|...+...++.+.+++|+....++.........++++|||+|+|++|.+++.....+++.++.+.+.+|
T Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~P~lii~G~~D~~~~~~~~~~~~~~~~~~~~~p  294 (328)
T 2cjp_A          215 SSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVP  294 (328)
T ss_dssp             GTTSCHHHHHHHHHHHHHHCSHHHHHHHHTHHHHHHHTGGGTTCCCCSCEEEEEETTCGGGGSTTHHHHHHHSHHHHHST
T ss_pred             cCCCCHHHHHHHHHHhcccCCcchHHHHHhcccchhhhhhccCCccCCCEEEEEeCCcccccCcchhhhhhhhhHHHHhc
Confidence            46778888888888887767888888888764333221111245799999999999999987642111110145667788


Q ss_pred             CCceeEEeCCCCCChhhhCHHHHHHHHHHHHHhC
Q 030710          140 GLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF  173 (173)
Q Consensus       140 ~~~~~~~i~~~GH~~~~e~p~~v~~~i~~fl~~~  173 (173)
                      +.+++++++++||+++.|+|++|++.|.+||+++
T Consensus       295 ~~~~~~~i~~~gH~~~~e~p~~~~~~i~~fl~~~  328 (328)
T 2cjp_A          295 LLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF  328 (328)
T ss_dssp             TBCCCEEETTCCSCHHHHSHHHHHHHHHHHHTTC
T ss_pred             CCeeEEEcCCCCCCcchhCHHHHHHHHHHHHHhC
Confidence            8635899999999999999999999999999764
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1zd3a2322 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, 2e-13
d1qo7a_394 c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg 7e-11
d2rhwa1283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 2e-06
d1ehya_293 c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba 6e-06
d1b6ga_310 c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte 6e-06
d1bn7a_291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 8e-06
d1j1ia_268 c.69.1.10 (A:) Meta cleavage compound hydrolase Ca 8e-06
d1va4a_271 c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce 3e-05
d1hkha_279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 3e-05
d1brta_277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 4e-05
d1c4xa_281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 9e-05
d1a88a_275 c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li 2e-04
d1m33a_256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 2e-04
d1q0ra_297 c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { 3e-04
d1uk8a_271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 9e-04
d1mj5a_298 c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona 0.001
d1a8sa_273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 0.001
d1r3da_264 c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio 0.002
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Epoxide hydrolase
domain: Mammalian epoxide hydrolase, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.5 bits (155), Expect = 2e-13
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 12/164 (7%)

Query: 12  QEPGVAEEDFAQIDTARLIKKFLGGRSPKPPCVPKEIGFRGL----PDLRTLPSWLSEED 67
           QEPGVAE +  Q + +R  K            + K     GL    P+  +L   ++EE+
Sbjct: 162 QEPGVAEAELEQ-NLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEE 220

Query: 68  VNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIRE 127
           + +Y  +F + GF G LN+YR ++ NW+      G +I IP   +  + D        + 
Sbjct: 221 IQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQH 280

Query: 128 YIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIK 171
                  +  +P L+    +E   H+   +K  EV+  +  ++ 
Sbjct: 281 ------MEDWIPHLK-RGHIEDCGHWTQMDKPTEVNQILIKWLD 317
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394 Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310 Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268 Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.73
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.57
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.47
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.4
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.39
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.37
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.37
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.37
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.37
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.37
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.36
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.35
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.34
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.34
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.33
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.32
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.31
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.31
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.29
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.21
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.13
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.06
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.04
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.03
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.95
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.94
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.83
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.75
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.67
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.67
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.53
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.49
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.32
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.31
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.02
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.0
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.98
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.96
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.96
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 97.89
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.87
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 97.87
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 97.7
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.68
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.67
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.58
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 97.57
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.41
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.38
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.36
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 97.28
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.24
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 97.17
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 96.92
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.92
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 96.9
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 96.83
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.81
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 96.75
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 96.74
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.63
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 96.17
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 94.93
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 94.33
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 94.15
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 92.39
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 91.48
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 91.24
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 87.28
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 84.12
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 82.61
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Epoxide hydrolase
domain: Mammalian epoxide hydrolase, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.73  E-value=2e-17  Score=123.13  Aligned_cols=107  Identities=23%  Similarity=0.468  Sum_probs=88.2

Q ss_pred             CCCCCHHHHHHHHHHhccCCCcchhhhhhhcccCccccCCCCCCCcCCceEEEeeCCCcCCCCcchhhHhhhccccccCC
Q 030710           60 PSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVP  139 (173)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~~~~~~~~yr~~~~~~~~~~~~~~~~i~vP~l~i~G~~D~~~~~~~~~~~~~~~~~~~~~~  139 (173)
                      ...++++.+..+.+.+...++++..++|+....++.........+|++|||+|+|++|.++++...      +.+.+.+|
T Consensus       213 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~Pvl~i~G~~D~~~~~~~~------~~~~~~~~  286 (322)
T d1zd3a2         213 SRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMS------QHMEDWIP  286 (322)
T ss_dssp             CTTCCHHHHHHHHHHHHHHTTHHHHHTTSCHHHHHHHHHTTTTCCCCSCEEEEEETTCSSSCGGGG------TTGGGTCT
T ss_pred             hhhccHHHHHHHHHHHhhcccccccccccccccccccchhhhcccCCCCEEEEEeCCCCCCCHHHH------HHHHHhCC
Confidence            456788999999999888788888888877644433222223568999999999999999887553      78889999


Q ss_pred             CCceeEEeCCCCCChhhhCHHHHHHHHHHHHHhC
Q 030710          140 GLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF  173 (173)
Q Consensus       140 ~~~~~~~i~~~GH~~~~e~p~~v~~~i~~fl~~~  173 (173)
                      +. ++++++++||++++|+|++|++.|.+||+++
T Consensus       287 ~~-~~~~i~~~gH~~~~e~p~~v~~~i~~FL~~~  319 (322)
T d1zd3a2         287 HL-KRGHIEDCGHWTQMDKPTEVNQILIKWLDSD  319 (322)
T ss_dssp             TC-EEEEETTCCSCHHHHSHHHHHHHHHHHHHHH
T ss_pred             CC-EEEEECCCCCchHHhCHHHHHHHHHHHHhhc
Confidence            99 9999999999999999999999999999863
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure