Citrus Sinensis ID: 030722

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIATEH
ccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccEcccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHccccccccEEccccHHHHccccccHHHcccccccccHHHHHHHHHHHcccccEEEEccc
malssisplsikslnfcsssskgpyqlhalskpLWVACQissktesdgqfpdcsnnqcagpyaklkNWRVFVSTALAAAVVASCSSNISALADLNKYeaetrgefgigsaaqfgsADLRKAVHVKEnfrranftsadmresdfsgskfngAYLEKAVAYKANFTGTLIATEH
malssisplsiKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENfrranftsadmresdfsgSKFNGAYLEKAVAYKANFTGTLIATEH
MAlssisplsikslNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRvfvstalaaavvascssnisaLADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIATEH
************************YQLHALSKPLWVACQIS**********DCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFR*****************KFNGAYLEKAVAYKANFTGTLI****
********LSI***************************************************AKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIA***
MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISS********PDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIATEH
**************************L*ALSKPLWVACQISSKTESDGQFPDCSNNQC******LKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIAT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIATEH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q8H1Q1 280 Thylakoid lumenal protein yes no 0.930 0.571 0.583 3e-36
>sp|Q8H1Q1|TL225_ARATH Thylakoid lumenal protein At1g12250, chloroplastic OS=Arabidopsis thaliana GN=At1g12250 PE=1 SV=1 Back     alignment and function desciption
 Score =  151 bits (381), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 122/168 (72%), Gaps = 8/168 (4%)

Query: 1   MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQ--- 57
           MA SS+SPL +KSL+   SSS      +   + L    Q+SS+  S+ +  D SN +   
Sbjct: 1   MAFSSLSPLPMKSLDISRSSSSVSRSPYHFQRYLLRRLQLSSR--SNLEIKDSSNTREGC 58

Query: 58  CAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSAD 117
           C+   A+   W+  +S A+AAAV+AS SS + A+A+LN++EA+TRGEFGIGSAAQ+GSAD
Sbjct: 59  CSS--AESNTWKRILSAAMAAAVIAS-SSGVPAMAELNRFEADTRGEFGIGSAAQYGSAD 115

Query: 118 LRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTG 165
           L K VH  ENFRRANFTSADMRESDFSGS FNGAYLEKAVAYKANF+G
Sbjct: 116 LSKTVHSNENFRRANFTSADMRESDFSGSTFNGAYLEKAVAYKANFSG 163

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
255583634 280 conserved hypothetical protein [Ricinus 0.947 0.582 0.678 7e-53
224071571 275 predicted protein [Populus trichocarpa] 0.918 0.574 0.648 9e-51
297741150261 unnamed protein product [Vitis vinifera] 0.837 0.551 0.660 1e-46
449459702 279 PREDICTED: thylakoid lumenal protein At1 0.936 0.577 0.618 2e-46
359474379 596 PREDICTED: uncharacterized protein LOC10 0.837 0.241 0.660 2e-46
297741151201 unnamed protein product [Vitis vinifera] 0.843 0.721 0.640 2e-45
388505216 273 unknown [Lotus japonicus] 0.854 0.538 0.619 1e-42
255638223199 unknown [Glycine max] 0.860 0.743 0.636 6e-42
356540500260 PREDICTED: thylakoid lumenal protein At1 0.831 0.55 0.606 1e-39
357481967147 Thylakoid lumenal protein [Medicago trun 0.843 0.986 0.581 3e-39
>gi|255583634|ref|XP_002532572.1| conserved hypothetical protein [Ricinus communis] gi|223527699|gb|EEF29806.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 112/165 (67%), Positives = 127/165 (76%), Gaps = 2/165 (1%)

Query: 1   MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAG 60
           MA +SISPLSIKS+N   SSS+ PY L + SKP  + CQ++  TE + +  DCS  +   
Sbjct: 1   MAFTSISPLSIKSVNISPSSSRSPYHLPSQSKPFHILCQLA--TEREDRILDCSTTRYKV 58

Query: 61  PYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRK 120
            ++K KNWR  VSTALAAA   +    + A ADLNK+EAE RGEFGIGSAAQFGSADLRK
Sbjct: 59  HHSKPKNWRTLVSTALAAAAAVNLGFGLPAAADLNKFEAELRGEFGIGSAAQFGSADLRK 118

Query: 121 AVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTG 165
           AVHV ENFRRANFTSADMRESDFSGS FNGAYLEKAVAYKANFTG
Sbjct: 119 AVHVNENFRRANFTSADMRESDFSGSTFNGAYLEKAVAYKANFTG 163

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224071571|ref|XP_002303521.1| predicted protein [Populus trichocarpa] gi|222840953|gb|EEE78500.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297741150|emb|CBI31881.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449459702|ref|XP_004147585.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Cucumis sativus] gi|449520611|ref|XP_004167327.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359474379|ref|XP_002265958.2| PREDICTED: uncharacterized protein LOC100250522 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741151|emb|CBI31882.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388505216|gb|AFK40674.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255638223|gb|ACU19425.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356540500|ref|XP_003538726.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357481967|ref|XP_003611269.1| Thylakoid lumenal protein [Medicago truncatula] gi|355512604|gb|AES94227.1| Thylakoid lumenal protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
TAIR|locus:2202033 280 AT1G12250 "AT1G12250" [Arabido 0.819 0.503 0.533 6e-32
TAIR|locus:2202033 AT1G12250 "AT1G12250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 6.0e-32, P = 6.0e-32
 Identities = 80/150 (53%), Positives = 96/150 (64%)

Query:    18 SSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQ--CAGPYAKLKNWRXXXXXX 75
             SS S+ PY  H   + L    Q+SS+  S+ +  D SN +  C    A+   W+      
Sbjct:    21 SSVSRSPY--H-FQRYLLRRLQLSSR--SNLEIKDSSNTREGCCSS-AESNTWKRILSAA 74

Query:    76 XXXXXXXXXXXXXXXLADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTS 135
                            +A+LN++EA+TRGEFGIGSAAQ+GSADL K VH  ENFRRANFTS
Sbjct:    75 MAAAVIASSSGVPA-MAELNRFEADTRGEFGIGSAAQYGSADLSKTVHSNENFRRANFTS 133

Query:   136 ADMRESDFSGSKFNGAYLEKAVAYKANFTG 165
             ADMRESDFSGS FNGAYLEKAVAYKANF+G
Sbjct:   134 ADMRESDFSGSTFNGAYLEKAVAYKANFSG 163


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.315   0.128   0.383    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      172       139   0.00091  102 3  11 22  0.45    31
                                                     30  0.46    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  599 (64 KB)
  Total size of DFA:  145 KB (2088 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  11.50u 0.07s 11.57t   Elapsed:  00:00:08
  Total cpu time:  11.50u 0.07s 11.57t   Elapsed:  00:00:08
  Start:  Thu May  9 18:01:11 2013   End:  Thu May  9 18:01:19 2013
GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00030850
hypothetical protein (275 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_VII0722
photosystem II stability/assembly factor (394 aa)
   •  • 0.423

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 2e-06
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-05
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 4e-05
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 2e-04
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 4e-04
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 8e-04
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 8e-04
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 0.001
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 0.003
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 0.003
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information 
 Score = 42.4 bits (101), Expect = 2e-06
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 127 NFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTG 165
           N   AN   AD+R +D SG+   GA L  A    AN +G
Sbjct: 2   NLSGANLRGADLRGADLSGADLTGANLSGANLSGANLSG 40

These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A(D/N)LXX, where X can be any amino acid. Length = 40
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
PRK15377 782 E3 ubiquitin-protein ligase SopA; Provisional 99.21
PF1359978 Pentapeptide_4: Pentapeptide repeats (9 copies); P 99.15
PF1359978 Pentapeptide_4: Pentapeptide repeats (9 copies); P 99.15
PRK15377 782 E3 ubiquitin-protein ligase SopA; Provisional 99.07
KOG1665302 consensus AFH1-interacting protein FIP2, contains 98.99
PRK09718 512 hypothetical protein; Validated 98.93
PRK09718 512 hypothetical protein; Validated 98.78
>PRK15377 E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information 
Probab=99.21  E-value=7.1e-12  Score=118.42  Aligned_cols=79  Identities=15%  Similarity=0.185  Sum_probs=36.4

Q ss_pred             HhchhhhhcCCccCCC-CCceeccCcccceeeccceecCce-eccccccc----------ccccCcccccceecCccccC
Q 030722           93 DLNKYEAETRGEFGIG-SAAQFGSADLRKAVHVKENFRRAN-FTSADMRE----------SDFSGSKFNGAYLEKAVAYK  160 (172)
Q Consensus        93 ~l~~~~~~~~~~~~~~-~g~dF~~~dL~~a~F~~a~L~~an-Fs~A~L~~----------a~Fs~a~L~gA~f~~a~l~~  160 (172)
                      .++....+..+|.+.+ .|++|.+++|.+++|.+++|++++ |.+|+|.+          ++|.+|+|++++|++++|.+
T Consensus       181 dl~~A~Le~vdFsg~DLSGADFsg~DLSgAnFsgA~Lr~AdiL~gAdLsgAnLs~AdLs~AnFsgcnLs~AnLs~A~L~~  260 (782)
T PRK15377        181 RLRQEAGEELTYADRDFSNADFRNINFSKINPSGFMLRDGDIIKGFNFSNSKFTYSDISHLHFDECRFTYSTLSDVVCSN  260 (782)
T ss_pred             ccccCcCccCCcCCCcCCCCCCCCCcccCCcchhhcccCCCCcCCCccCCeEcccchhhhhhhheeeecccccCcCEeCC
Confidence            4444444455555555 555555555555555444444443 33333333          33333444444444444444


Q ss_pred             ceecCCcCCCC
Q 030722          161 ANFTGTLIATE  171 (172)
Q Consensus       161 a~f~gAdLs~A  171 (172)
                      ++|.+|+|.+|
T Consensus       261 AdFsgAdLkgA  271 (782)
T PRK15377        261 TKFSNSDMNEA  271 (782)
T ss_pred             CEecCCCCCCC
Confidence            44444444443

>PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A Back     alignment and domain information
>PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A Back     alignment and domain information
>PRK15377 E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 3e-11
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 2e-07
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 5e-07
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 2e-05
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 8e-05
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 3e-09
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 8e-07
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 7e-06
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 2e-05
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 3e-05
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 4e-08
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 3e-07
2bm5_A 186 MFPA, RV3361C, pentapeptide repeat family protein; 8e-07
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 1e-06
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-06
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-06
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 3e-06
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 4e-06
2bm5_A 186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-06
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-06
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 1e-05
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 6e-08
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-07
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 6e-07
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-06
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-06
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-06
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-06
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 5e-06
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-05
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-05
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-05
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 7e-05
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-04
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 1e-07
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 1e-07
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 7e-07
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 4e-06
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 4e-06
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 6e-06
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 7e-06
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 1e-05
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 1e-05
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 2e-05
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-05
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 8e-04
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-07
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 1e-06
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-06
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 6e-06
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 6e-05
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-04
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 5e-04
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 5e-04
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 6e-07
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-07
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 8e-07
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 2e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 2e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 2e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 5e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 9e-06
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-05
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-05
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-05
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 4e-05
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-05
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 7e-05
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 2e-04
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 1e-06
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 3e-06
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 1e-05
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 1e-04
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-04
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-04
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 8e-04
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 3e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 7e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 7e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 8e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 8e-06
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-05
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-05
2j8k_A 201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-05
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-05
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 1e-06
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 2e-06
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 3e-06
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 4e-06
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 5e-04
2w7z_A 214 EFSQNR, pentapeptide repeat family protein; glutar 2e-06
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 5e-06
2w7z_A 214 EFSQNR, pentapeptide repeat family protein; glutar 5e-06
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 1e-05
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 5e-05
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 5e-05
2w7z_A 214 EFSQNR, pentapeptide repeat family protein; glutar 1e-04
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 5e-06
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 6e-06
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 2e-05
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 2e-05
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 5e-05
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 6e-05
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
 Score = 57.9 bits (141), Expect = 3e-11
 Identities = 18/74 (24%), Positives = 31/74 (41%)

Query: 92  ADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGA 151
            DL   + +       GS+A +    L       ++   A FT+AD+ +S+FS +   GA
Sbjct: 33  PDLGTDDDDKAMAMVTGSSASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGA 92

Query: 152 YLEKAVAYKANFTG 165
               +    A+  G
Sbjct: 93  VFNGSALIGADLHG 106
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.47
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 99.43
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.43
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.39
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.38
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 99.3
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 99.29
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 99.28
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.15
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.14
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
Probab=99.47  E-value=3.8e-14  Score=108.74  Aligned_cols=75  Identities=23%  Similarity=0.243  Sum_probs=33.8

Q ss_pred             hhhhhcCCccCCC-CCceeccCcccceeeccceecCceecccccccccccCcccccceecCccccCceecCCcCCC
Q 030722           96 KYEAETRGEFGIG-SAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGTLIAT  170 (172)
Q Consensus        96 ~~~~~~~~~~~~~-~g~dF~~~dL~~a~F~~a~L~~anFs~A~L~~a~Fs~a~L~gA~f~~a~l~~a~f~gAdLs~  170 (172)
                      .......++.+.. .+++|.+++|.+++|.+++|.+++|.+|+|++++|++|+|++++|.+|+|.+++|++|+|++
T Consensus        15 ~~~l~~~~f~~~~l~~~~f~~~~l~~a~f~~a~l~~a~f~~a~l~~a~f~~a~l~~a~f~~a~l~~a~f~~a~l~~   90 (152)
T 3n90_A           15 GQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEG   90 (152)
T ss_dssp             TCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred             CCCccCCcCCCCCcCcCccCCCeeCCCEeCCCCCCCCCccccCcCCCEeCCCCcCCCCCCCCCcCCCCcCCCCCCC
Confidence            3333334444444 44444444444444444444444444444444444444444444444444444444444443
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 4e-05
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 6e-05
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 2e-04
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 3e-04
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 3e-04
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 0.001
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 0.002
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-04
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 0.002
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 0.003
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: NP275-NP276
species: Nostoc punctiforme [TaxId: 272131]

 Score = 39.9 bits (92), Expect = 4e-05
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 109 SAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAV 157
           S A   +ADL  A     +  +AN   A +  ++ +G+    A LE  +
Sbjct: 123 SEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTI 171
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.37
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.14
d2bm5a1181 Hypothetical protein Rv3361c (MT3469) {Mycobacteri 99.13
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.11
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: Lumenal RFR-domain protein
species: Cyanothece sp. atcc 51142 [TaxId: 43989]

Probab=99.37  E-value=9.5e-14  Score=101.98  Aligned_cols=29  Identities=17%  Similarity=0.230  Sum_probs=11.2

Q ss_pred             cccCcccccceecCccccCceecCCcCCC
Q 030722          142 DFSGSKFNGAYLEKAVAYKANFTGTLIAT  170 (172)
Q Consensus       142 ~Fs~a~L~gA~f~~a~l~~a~f~gAdLs~  170 (172)
                      +|++++|.+++|.++++.+++|+|+||++
T Consensus        72 ~~~~a~~~~a~l~~a~~~~a~l~~adfs~  100 (132)
T d2f3la1          72 DLTNAVLTEAIMMRTKFDDAKITGADFSL  100 (132)
T ss_dssp             BCTTCBCTTCEEEEEECTTCBCTTCBCTT
T ss_pred             hhccCCcCCCCcCCCCcCCCEECcCCCCC
Confidence            33333333333333333344444444433
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure