Citrus Sinensis ID: 030729

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MERMNIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSGTAPSTPASSSSPASTSGASSSAFTSFASSVPLVVALLASSLAYMV
cccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHccccEEEEccEEEEEEccccccEEEEcccccccccccccccccccccccEEEEcccccEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHc
cHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccEccccHHHHHcccEEEEccEEEEEEccccccEEEEEcHHHHHHcccccccccccccccEEEEcccccEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcc
MERMNIKRAFLVLIISALTAKEASAaqhtvggsqgwvesadlnswasgqtfkvgdqivfkytpglhsvvelpsesaykscdlgtakdsmnsgndvvklvkpgtryfacgtsghceqGMKVKIttfsgtapstpasssspastsgasssaftsFASSVPLVVALLASSLAYMV
MERMNIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLgtakdsmnsgnDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSGTAPSTPASSSSPASTSGASSSAFTSFASSVPLVVALLASSLAYMV
MERMNIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKIttfsgtapstpasssspastsgasssaftsfassvplvvallasslaYMV
*****IKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDL**********NDVVKLVKPGTRYFACGTSGHCEQGMKVKITT*****************************ASSVPLVVALLASSL****
******K***LVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKI**********************************VPLVVALLASSLAYMV
MERMNIKRAFLVLIISALTAKE************GWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFS************************TSFASSVPLVVALLASSLAYMV
*ERMNIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSG*********************AFTSFASSVPLVVALLASSLAYMV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERMNIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSGTAPSTPASSSSPASTSGASSSAFTSFASSVPLVVALLASSLAYMV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q41001189 Blue copper protein OS=Pi N/A no 0.639 0.582 0.433 1e-17
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.604 0.962 0.401 4e-16
P60496126 Chemocyanin OS=Lilium lon N/A no 0.563 0.769 0.396 1e-15
Q02917187 Early nodulin-55-2 OS=Gly no no 0.674 0.620 0.357 6e-14
P00302107 Stellacyanin OS=Toxicoden N/A no 0.552 0.887 0.376 2e-13
P0030396 Basic blue protein OS=Cuc N/A no 0.546 0.979 0.367 2e-13
Q8LG89129 Basic blue protein OS=Ara no no 0.651 0.868 0.369 3e-13
Q9SK27182 Early nodulin-like protei no no 0.598 0.565 0.403 1e-12
O80517202 Uclacyanin-2 OS=Arabidops no no 0.534 0.455 0.343 6e-12
P29602137 Cucumber peeling cupredox N/A no 0.558 0.700 0.312 9e-11
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 3/113 (2%)

Query: 10  FLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVV 69
           FL+ II+   A  + A  +TVG + GWV   D ++WAS +TF VGD +VF Y  G H+V 
Sbjct: 11  FLLAIINM--ALPSLATVYTVGDTSGWVIGGDYSTWASDKTFAVGDSLVFNYGAGAHTVD 68

Query: 70  ELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKI 122
           E+  ES YKSC  G +  + ++G   + L K G  YF CG  GH   GMK+ I
Sbjct: 69  EVK-ESDYKSCTSGNSISTDSTGATTIPLKKAGKHYFICGVPGHSTGGMKLSI 120

Pisum sativum (taxid: 3888)
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|Q02917|NO552_SOYBN Early nodulin-55-2 OS=Glycine max GN=ENOD55-2 PE=2 SV=1 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description
>sp|P29602|CPC_CUCSA Cucumber peeling cupredoxin OS=Cucumis sativus PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
255536939166 Blue copper protein precursor, putative 0.930 0.963 0.631 1e-48
224055713113 predicted protein [Populus trichocarpa] 0.656 1.0 0.796 2e-46
388517287162 unknown [Lotus japonicus] 0.918 0.975 0.6 4e-46
351725837162 uncharacterized protein LOC100305865 pre 0.930 0.987 0.636 2e-45
225452130176 PREDICTED: blue copper protein [Vitis vi 0.703 0.687 0.677 7e-45
351722208190 uncharacterized protein LOC100306337 pre 0.761 0.689 0.639 2e-41
21553614172 blue copper protein, putative [Arabidops 0.697 0.697 0.647 5e-41
297818286171 hypothetical protein ARALYDRAFT_484503 [ 0.697 0.701 0.647 7e-41
18405269174 plastocyanin-like domain-containing prot 0.697 0.689 0.639 2e-40
449523303174 PREDICTED: blue copper protein-like [Cuc 0.703 0.695 0.645 8e-39
>gi|255536939|ref|XP_002509536.1| Blue copper protein precursor, putative [Ricinus communis] gi|223549435|gb|EEF50923.1| Blue copper protein precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 123/163 (75%), Gaps = 3/163 (1%)

Query: 8   RAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHS 67
           + FL+L   AL  KE  AAQH VGGSQGW ESAD +SW S + FKVGDQ+ FKYT GLHS
Sbjct: 4   KFFLMLFFVALFVKEGMAAQHVVGGSQGWDESADFSSWTSSKKFKVGDQLAFKYTSGLHS 63

Query: 68  VVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSG 127
           VVEL SESAYK+CDLG+  DS+++GNDVVKL K GTRYFACGT GHC+QGMKVKITT +G
Sbjct: 64  VVELASESAYKNCDLGSPLDSLSTGNDVVKLSKEGTRYFACGTLGHCDQGMKVKITTETG 123

Query: 128 TAPSTPASSSSPASTSGASSSAFTSFASSVPLVVALLASSLAY 170
           TAPSTP SSSS  +++  +S +   F S    V+  LA++L Y
Sbjct: 124 TAPSTPDSSSSSHASASMASYSIRPFGS---FVLVALATTLIY 163

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224055713|ref|XP_002298616.1| predicted protein [Populus trichocarpa] gi|222845874|gb|EEE83421.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388517287|gb|AFK46705.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351725837|ref|NP_001237874.1| uncharacterized protein LOC100305865 precursor [Glycine max] gi|255626823|gb|ACU13756.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225452130|ref|XP_002262831.1| PREDICTED: blue copper protein [Vitis vinifera] gi|296090231|emb|CBI40050.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351722208|ref|NP_001237236.1| uncharacterized protein LOC100306337 precursor [Glycine max] gi|255628239|gb|ACU14464.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|21553614|gb|AAM62707.1| blue copper protein, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297818286|ref|XP_002877026.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. lyrata] gi|297322864|gb|EFH53285.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18405269|ref|NP_566810.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana] gi|18252983|gb|AAL62418.1| blue copper protein, putative [Arabidopsis thaliana] gi|30102904|gb|AAP21370.1| At3g27200 [Arabidopsis thaliana] gi|332643757|gb|AEE77278.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449523303|ref|XP_004168663.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
TAIR|locus:2086518174 AT3G27200 [Arabidopsis thalian 0.686 0.678 0.65 6.1e-39
TAIR|locus:2062525261 UCC1 "uclacyanin 1" [Arabidops 0.645 0.425 0.426 7e-22
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.639 0.55 0.392 1.1e-18
TAIR|locus:2206986181 AT1G72230 [Arabidopsis thalian 0.616 0.585 0.477 4.6e-18
TAIR|locus:504956334192 AT5G07475 [Arabidopsis thalian 0.639 0.572 0.375 7.5e-18
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.645 0.627 0.410 5.3e-17
TAIR|locus:2009552174 AT1G22480 [Arabidopsis thalian 0.604 0.597 0.455 6.7e-17
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.639 0.533 0.339 1.4e-16
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.645 0.593 0.353 2.9e-16
TAIR|locus:2081957222 UCC3 "uclacyanin 3" [Arabidops 0.639 0.495 0.359 1.6e-15
TAIR|locus:2086518 AT3G27200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 416 (151.5 bits), Expect = 6.1e-39, P = 6.1e-39
 Identities = 78/120 (65%), Positives = 98/120 (81%)

Query:     4 MNIKRAFLVLIISAL-TAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYT 62
             M ++   ++L+ S L + K A AA+H +GGSQGW +S D +SW+S Q+FKVGDQIVFKY+
Sbjct:     1 MKMQAVLVILVFSGLLSVKTALAARHVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYS 60

Query:    63 PGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKI 122
               LHSVVEL SE+AYKSCDLGT+ +S++SGNDVVKL K GTRYFACGT GHCEQGMK+K+
Sbjct:    61 E-LHSVVELGSETAYKSCDLGTSVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKV 119
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206986 AT1G72230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956334 AT5G07475 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009552 AT1G22480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081957 UCC3 "uclacyanin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.I.3002.1
hypothetical protein (113 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 4e-31
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 2e-22
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score =  107 bits (269), Expect = 4e-31
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)

Query: 39  SADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKL 98
           +AD   WASG+TF+VGD +VF Y  G H+VVE+ +++ Y+SC+      +  +GND++ L
Sbjct: 6   NADYTLWASGKTFRVGDTLVFNYDKGFHNVVEV-TKADYESCNTSKPIRTYTTGNDIIPL 64

Query: 99  VKPGTRYFACGTSGHCEQGM 118
            KPG  YF CG  GHC+ G 
Sbjct: 65  TKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.73
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.67
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.57
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.38
COG3794128 PetE Plastocyanin [Energy production and conversio 98.36
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.28
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.56
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.44
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.93
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 96.52
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 96.39
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 96.27
COG4454158 Uncharacterized copper-binding protein [Inorganic 94.64
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 94.44
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 93.79
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 93.61
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 93.01
PRK02888635 nitrous-oxide reductase; Validated 92.35
COG1622247 CyoA Heme/copper-type cytochrome/quinol oxidases, 88.47
PRK10378 375 inactive ferrous ion transporter periplasmic prote 88.03
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 87.53
PLN02354 552 copper ion binding / oxidoreductase 86.48
PLN02604 566 oxidoreductase 86.44
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 85.24
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 83.68
PLN02835 539 oxidoreductase 80.88
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.5e-45  Score=292.18  Aligned_cols=117  Identities=34%  Similarity=0.643  Sum_probs=107.0

Q ss_pred             HHHHHHHHHHhhhcccceEEEecCCCCCCCCCCcccccCCCeEEecCEEEEEEccCCCcEEEeCCcccCCCCCCCCCCCc
Q 030729            9 AFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDS   88 (172)
Q Consensus         9 ~~~~~~v~~~~~~~a~a~~~~VG~~~GW~~~~nY~~Wa~~~~f~vGDtLvF~y~~~~H~V~~V~~~~~y~~C~~~~~~~~   88 (172)
                      +++++++++++...+.+++|+|||+.||+.+.||++|+++++|++||+|+|+|++++|||+||++ ++|++|+.++++..
T Consensus         4 ~~l~~~~~~~~~~~~~a~~~~VGd~~GW~~~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~-~~Y~~C~~~~pi~~   82 (167)
T PLN03148          4 LLLFCFFALFSASATTATDHIVGANKGWNPGINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQ-TGYDNCTTEGAAGN   82 (167)
T ss_pred             HHHHHHHHHHhhhhccceEEEeCCCCCcCCCCChhHhhcCCCCccCCEEEEEecCCCceEEEECh-HHcCcccCCCCcce
Confidence            34444444466677899999999999999989999999999999999999999999999999998 99999999999999


Q ss_pred             cCCCCcEEEeecCceEEEEcCCCCCccCCCeEEEEecCC
Q 030729           89 MNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSG  127 (172)
Q Consensus        89 ~~~G~~~v~l~~~G~~YFiC~~~~HC~~GmKl~I~V~~~  127 (172)
                      +++|++.|+|+++|+|||||+ .+||++||||.|+|.+.
T Consensus        83 ~tsG~d~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~  120 (167)
T PLN03148         83 WTSGKDFIPLNKAKRYYFICG-NGQCFNGMKVTILVHPL  120 (167)
T ss_pred             ecCCCcEEEecCCccEEEEcC-CCccccCCEEEEEEcCC
Confidence            999999999999999999999 69999999999999754

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 5e-17
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 2e-14
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 2e-11
1f56_A91 Spinach Plantacyanin Length = 91 5e-11
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 2e-09
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
Query: 25  AAQHTVGGSQGWVE--SADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDL 82
           A  H VG S GW      D   WAS   F VGD ++F Y    H+V+++  E  +KSC+ 
Sbjct: 2   ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQ-FKSCNS 60
Query: 83  GTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKI 122
            +   S  SG D + L +PGT YF CG  GHC+ G KV+I
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEI 100
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 3e-39
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 5e-39
1jer_A138 Cucumber stellacyanin; electron transport, copper, 1e-38
2cbp_A96 Cucumber basic protein; electron transport, phytoc 4e-36
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 4e-34
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  128 bits (323), Expect = 3e-39
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 27  QHTVGGSQGWVESADL---NSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLG 83
            + VGG   W   +D     +WA+G+TF+VGD++ F +  G+H V  + ++ A+ +C   
Sbjct: 3   DYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVV-TKDAFDNCKKE 61

Query: 84  TAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITTFSGTAPSTPASSSS 138
                M +    + L   G +Y+ C    HC  G K+ I           A+  +
Sbjct: 62  NPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAGGAGGGATPGA 116
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.38
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.26
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.23
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 99.07
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 99.06
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.05
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 99.04
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.99
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.99
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.97
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.97
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.96
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.94
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.91
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.9
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.9
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.77
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.46
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.33
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.31
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.29
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 98.25
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 98.24
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.17
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 98.17
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 98.02
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.98
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.97
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.79
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.57
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.34
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 97.27
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.2
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 97.16
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 97.11
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.89
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.22
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 95.95
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 95.9
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 95.33
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 95.2
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.09
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 93.96
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 90.16
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 89.49
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 89.29
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 86.54
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 85.18
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 82.3
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=3.3e-43  Score=271.76  Aligned_cols=110  Identities=26%  Similarity=0.634  Sum_probs=99.8

Q ss_pred             cceEEEecCCCCCCCC---CCcccccCCCeEEecCEEEEEEccCCCcEEEe-CCcccCCCCCCCCCCCccCCCCcEEEe-
Q 030729           24 SAAQHTVGGSQGWVES---ADLNSWASGQTFKVGDQIVFKYTPGLHSVVEL-PSESAYKSCDLGTAKDSMNSGNDVVKL-   98 (172)
Q Consensus        24 ~a~~~~VG~~~GW~~~---~nY~~Wa~~~~f~vGDtLvF~y~~~~H~V~~V-~~~~~y~~C~~~~~~~~~~~G~~~v~l-   98 (172)
                      +|++|+|||+.||+++   .||++||++++|++||+|+|+|.+++|+|+|| ++ ++|+.|+.++++..+++|++.|+| 
T Consensus         2 ~a~~~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~-~~y~~C~~s~p~~~~~~G~~~v~L~   80 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETK-QSFDACNFVNSDNDVERTSPVIERL   80 (138)
T ss_dssp             CCCEEETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCH-HHHHHTCCTTSCCCCCCCSCEEEEC
T ss_pred             CceEEEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCch-hhcCccCCCCccccccCCCeEEEec
Confidence            5789999999999999   78999999999999999999999999999999 55 999999999999999999999999 


Q ss_pred             ecCceEEEEcCCCCCccCCCeEEEEecCCCCCCCCC
Q 030729           99 VKPGTRYFACGTSGHCEQGMKVKITTFSGTAPSTPA  134 (172)
Q Consensus        99 ~~~G~~YFiC~~~~HC~~GmKl~I~V~~~~~~~~p~  134 (172)
                      +++|++||||++++||++||||+|+|....++++|+
T Consensus        81 ~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~~~~~  116 (138)
T 1jer_A           81 DELGMHYFVCTVGTHCSNGQKLSINVVAANATVSMP  116 (138)
T ss_dssp             CSSEEEEEECCSTTTGGGTCEEEEEEECCC------
T ss_pred             cCCcCEEEEcCCCCccccCCEEEEEEcCCCCCCCCC
Confidence            999999999999999999999999999876654443
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 8e-37
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 5e-36
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 4e-33
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 2e-31
d1bypa_99 b.6.1.1 (A:) Plastocyanin {White campion (Silene p 4e-04
d2q5ba1105 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Ph 9e-04
d2cj3a1105 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabili 0.002
d2plta_98 b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomon 0.002
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score =  120 bits (303), Expect = 8e-37
 Identities = 35/98 (35%), Positives = 54/98 (55%), Gaps = 4/98 (4%)

Query: 26  AQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTA 85
           A + VGGS GW  + +  SW  G+ F+ GD ++F Y P +H+VV + ++  + +C+    
Sbjct: 1   AVYVVGGSGGW--TFNTESWPKGKRFRAGDILLFNYNPSMHNVVVV-NQGGFSTCNTPAG 57

Query: 86  KDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKIT 123
                SG D +KL   G  YF C   GHC+ GMK+ + 
Sbjct: 58  AKVYTSGRDQIKL-PKGQSYFICNFPGHCQSGMKIAVN 94
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Length = 99 Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Length = 105 Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Length = 105 Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.21
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 99.14
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 99.09
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 99.09
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 99.04
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 99.01
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 99.01
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.98
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.98
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.9
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.83
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.81
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.81
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.75
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.63
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.46
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.17
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 98.02
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.94
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.59
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.51
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 97.21
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 97.12
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 97.11
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 97.1
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 97.0
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 96.77
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 96.72
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 96.48
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 95.76
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 95.5
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 93.73
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 93.64
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 93.0
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 92.6
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 89.22
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 86.31
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 83.04
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 81.66
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=1.8e-39  Score=237.94  Aligned_cols=101  Identities=41%  Similarity=0.817  Sum_probs=96.7

Q ss_pred             ceEEEecCCCCCCCC--CCcccccCCCeEEecCEEEEEEccCCCcEEEeCCcccCCCCCCCCCCCccCCCCcEEEeecCc
Q 030729           25 AAQHTVGGSQGWVES--ADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPG  102 (172)
Q Consensus        25 a~~~~VG~~~GW~~~--~nY~~Wa~~~~f~vGDtLvF~y~~~~H~V~~V~~~~~y~~C~~~~~~~~~~~G~~~v~l~~~G  102 (172)
                      |++|+|||+.||+.+  .||++|+++++|++||+|+|+|+++.|+|+||++ ++|+.|+..+++..+++|++.|+|+++|
T Consensus         2 at~~~VGg~~gW~~~~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~-~~y~~C~~~~~~~~~~~G~~~v~l~~~g   80 (104)
T d1ws8a_           2 ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQ-EQFKSCNSSSPAASYTSGADSIPLKRPG   80 (104)
T ss_dssp             CCEEETTGGGCSCSSSCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECH-HHHHHTCCSSCSEEECSSEEEEECCSSE
T ss_pred             CcEEEeCCcCccCcCCCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECH-HHhcCCcCCCccccccCCCeEEEEecCc
Confidence            789999999999975  4799999999999999999999999999999988 9999999999999999999999999999


Q ss_pred             eEEEEcCCCCCccCCCeEEEEecC
Q 030729          103 TRYFACGTSGHCEQGMKVKITTFS  126 (172)
Q Consensus       103 ~~YFiC~~~~HC~~GmKl~I~V~~  126 (172)
                      ++||||++++||++|||+.|+|++
T Consensus        81 ~~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          81 TFYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             EEEEECCSTTTTTTTCEEEEEECC
T ss_pred             cEEEECCCcchhhCCCEEEEEECC
Confidence            999999999999999999999974
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure