Citrus Sinensis ID: 030760

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPAASPQLRTQTSAATTPDRSSNLDFSLSQIEIDRLE
ccccEEEEEEEccHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEccccccEEEEEccccccccccccEEEEEccccccccccccccccccccccccccccHHHHHHHccc
cccEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHcHHHHHHHHHHHHHHccccccEEEEEEEEccccHHHHHHHHHHcccEEEEEccccccHHHHHHHcHHHHHHcccEEEEEEEccccccccccccccccccccccccccEEcEEEEcccc
MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHvfpslnsrnrKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMshndisssfnCRVLaikqpaaspqlrtqtsaattpdrssnldfslsqIEIDRLE
MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLhvfpslnsrnrkkLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPaaspqlrtqtsaattpdrssnldfslsqieidrle
MdvkkivvivedvdAARAALLWALQNLLRFGDVVTLLHVFPslnsrnrkklrllrlkGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPAASPQLRTQTSAATTPDRSSNLDFSLSQIEIDRLE
****KIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAI**************************************
**VKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVF*******************QLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLA***************************************
MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPA*******************NLDFSLSQIEIDRLE
*DVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPA*******************NLDFSLSQIEIDRL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPAASPQLRTQTSAATTPDRSSNLDFSLSQIEIDRLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
224118866213 predicted protein [Populus trichocarpa] 0.970 0.784 0.738 2e-57
356516902200 PREDICTED: uncharacterized protein LOC10 0.976 0.84 0.655 1e-56
356566068247 PREDICTED: uncharacterized protein LOC10 0.982 0.684 0.651 4e-55
356513896197 PREDICTED: uncharacterized protein LOC10 0.965 0.842 0.593 8e-54
356565236197 PREDICTED: uncharacterized protein LOC10 0.965 0.842 0.587 5e-52
359491416210 PREDICTED: uncharacterized protein LOC10 0.906 0.742 0.679 3e-49
449439683207 PREDICTED: uncharacterized protein LOC10 0.988 0.821 0.585 3e-47
255541850175 conserved hypothetical protein [Ricinus 0.982 0.965 0.676 2e-46
297847168219 universal stress protein family protein 0.970 0.762 0.538 7e-44
21536911219 unknown [Arabidopsis thaliana] 0.982 0.771 0.533 8e-44
>gi|224118866|ref|XP_002317926.1| predicted protein [Populus trichocarpa] gi|222858599|gb|EEE96146.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 130/176 (73%), Positives = 150/176 (85%), Gaps = 9/176 (5%)

Query: 1   MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVF-PSLNS-RNRKKLRLLRLKG 58
           MDV+KIVV+VEDVDAAR AL WAL NLLRFGD +TLLHVF P++NS R++ K+RLLRLKG
Sbjct: 1   MDVRKIVVVVEDVDAARTALKWALHNLLRFGDFITLLHVFSPAMNSSRSKNKIRLLRLKG 60

Query: 59  YQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAM 118
           YQLALSFKDICN+FFNTNVEIIVTEGDQEG +IAA+VREIGASALVVGLHDRSFL+KLAM
Sbjct: 61  YQLALSFKDICNNFFNTNVEIIVTEGDQEGGKIAAMVREIGASALVVGLHDRSFLYKLAM 120

Query: 119 SHNDISSSFNCRVLAIKQPAASPQLRT---QTSAATTPDRS-SNLDFSLSQIEIDR 170
           +HN I++SF+CRVLAIK P   P  R+   + SAA  PD S S++DF  SQIEI R
Sbjct: 121 AHNSIANSFSCRVLAIKPPPL-PLWRSTCARASAARAPDISISSMDF--SQIEIGR 173

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356516902|ref|XP_003527131.1| PREDICTED: uncharacterized protein LOC100778166 [Glycine max] Back     alignment and taxonomy information
>gi|356566068|ref|XP_003551257.1| PREDICTED: uncharacterized protein LOC100817650 [Glycine max] Back     alignment and taxonomy information
>gi|356513896|ref|XP_003525644.1| PREDICTED: uncharacterized protein LOC100801011 [Glycine max] Back     alignment and taxonomy information
>gi|356565236|ref|XP_003550848.1| PREDICTED: uncharacterized protein LOC100804459 [Glycine max] Back     alignment and taxonomy information
>gi|359491416|ref|XP_002275136.2| PREDICTED: uncharacterized protein LOC100249148 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449439683|ref|XP_004137615.1| PREDICTED: uncharacterized protein LOC101206357 [Cucumis sativus] gi|449487033|ref|XP_004157475.1| PREDICTED: uncharacterized LOC101206357 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255541850|ref|XP_002511989.1| conserved hypothetical protein [Ricinus communis] gi|223549169|gb|EEF50658.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297847168|ref|XP_002891465.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297337307|gb|EFH67724.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21536911|gb|AAM61243.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
TAIR|locus:2028516219 AT1G48960 "AT1G48960" [Arabido 0.906 0.712 0.520 3.1e-35
TAIR|locus:2028516 AT1G48960 "AT1G48960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 381 (139.2 bits), Expect = 3.1e-35, P = 3.1e-35
 Identities = 87/167 (52%), Positives = 110/167 (65%)

Query:    15 AARAALLWALQNLLRFGDVVTLLHVF-PXXXXXXXXXXXXXXXXGYQLALSFKDICNDFF 73
             AAR AL WAL NLLR GDV+ LLHV+ P                GY LALSF++IC+ FF
Sbjct:    16 AARTALQWALHNLLRQGDVIVLLHVYSPPPRKKKSTAARLLRRHGYNLALSFREICDSFF 75

Query:    74 NTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLA 133
             NTN EIIV EGD +G  IA +V+EIGAS L+VGLH  SFL++ A+S  D++ +FNC+V+A
Sbjct:    76 NTNTEIIVREGDDDGRMIAQVVKEIGASMLLVGLHQNSFLYRWAISGIDVARNFNCKVMA 135

Query:   134 IKQPAA--SPQLRTQ---TSAAT---TPDRSSNLDFSLSQIEIDRLE 172
             IKQP+   SP ++ +   TS AT   T D  +N DFS  QIEI  L+
Sbjct:   136 IKQPSPELSPPVKVKGHKTSKATATATSDCLTNFDFS--QIEISGLQ 180


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.322   0.134   0.380    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      172       143   0.00091  102 3  11 22  0.39    31
                                                     30  0.48    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  577 (61 KB)
  Total size of DFA:  127 KB (2081 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  13.72u 0.10s 13.82t   Elapsed:  00:00:00
  Total cpu time:  13.72u 0.10s 13.82t   Elapsed:  00:00:00
  Start:  Thu May  9 19:32:44 2013   End:  Thu May  9 19:32:44 2013
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0002238 "response to molecule of fungal origin" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 3e-11
pfam00582139 pfam00582, Usp, Universal stress protein family 8e-11
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 8e-09
COG0589154 COG0589, UspA, Universal stress protein UspA and r 2e-04
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 57.4 bits (139), Expect = 3e-11
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 5   KIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRKKLRLLRLKGYQLALS 64
           +I+V V+  + +  AL WA +   R G  + LLHV     S   +   LL  +   L  +
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDPPPSSAAELAELLEEEARALLEA 60

Query: 65  FKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKL 116
            ++   +     VE +V EGD   A I     E+GA  +V+G   RS L +L
Sbjct: 61  LREALAE-AGVKVETVVLEGDPAEA-ILEAAEELGADLIVMGSRGRSGLRRL 110

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
PRK09982142 universal stress protein UspD; Provisional 99.95
PRK15005144 universal stress protein F; Provisional 99.93
PRK15456142 universal stress protein UspG; Provisional 99.93
PRK10116142 universal stress protein UspC; Provisional 99.93
PRK15118144 universal stress global response regulator UspA; P 99.93
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.92
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.91
PRK11175 305 universal stress protein UspE; Provisional 99.91
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.89
cd01987124 USP_OKCHK USP domain is located between the N-term 99.86
PRK11175305 universal stress protein UspE; Provisional 99.85
cd00293130 USP_Like Usp: Universal stress protein family. The 99.82
COG0589154 UspA Universal stress protein UspA and related nuc 99.78
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.66
PRK10490 895 sensor protein KdpD; Provisional 99.24
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.09
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.57
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.63
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.32
PLN03159832 cation/H(+) antiporter 15; Provisional 97.19
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.97
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 96.86
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 95.9
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 95.61
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 94.85
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 94.76
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 94.28
PRK06029185 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov 94.19
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 94.1
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 93.71
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 93.65
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 93.38
PRK12342254 hypothetical protein; Provisional 93.25
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 93.21
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 92.94
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 92.8
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 92.77
PRK03359256 putative electron transfer flavoprotein FixA; Revi 92.65
COG2086260 FixA Electron transfer flavoprotein, beta subunit 92.56
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 92.42
PRK13820 394 argininosuccinate synthase; Provisional 92.14
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 92.01
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 91.32
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 90.63
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 90.13
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 89.92
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 89.66
cd01713173 PAPS_reductase This domain is found in phosphoaden 89.54
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 88.64
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 88.16
TIGR00421181 ubiX_pad polyprenyl P-hydroxybenzoate and phenylac 87.67
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 86.99
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 86.9
COG0151 428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 86.89
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 86.28
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 86.2
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 86.16
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 85.93
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 84.95
COG0452 392 Dfp Phosphopantothenoylcysteine synthetase/decarbo 84.5
cd01995169 ExsB ExsB is a transcription regulator related pro 84.05
PLN02496209 probable phosphopantothenoylcysteine decarboxylase 83.95
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 83.35
PRK00919 307 GMP synthase subunit B; Validated 83.27
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 82.96
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 82.63
PRK10867 433 signal recognition particle protein; Provisional 82.56
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 81.02
cd01997 295 GMP_synthase_C The C-terminal domain of GMP synthe 80.29
TIGR00884 311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 80.14
TIGR02699174 archaeo_AfpA archaeoflavoprotein AfpA. The prototy 80.14
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information 
Probab=99.95  E-value=2.6e-26  Score=160.30  Aligned_cols=136  Identities=15%  Similarity=0.197  Sum_probs=103.8

Q ss_pred             CCceEEEEEecCCHHHHHHHHHHHHhhccCCCEEEEEEEecCCCccch-----HHHHHHHHHHHHHHHHHHHHhhhhcCC
Q 030760            1 MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNR-----KKLRLLRLKGYQLALSFKDICNDFFNT   75 (172)
Q Consensus         1 m~~k~Ilv~~d~s~~s~~al~~a~~la~~~~~~l~~l~V~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (172)
                      |.|+|||||+|+|+.+..++++|..+|+..+++++++||.++......     ......+...+...+.+++..+.....
T Consensus         1 ~~~k~ILvavD~S~~s~~al~~A~~lA~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~   80 (142)
T PRK09982          1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP   80 (142)
T ss_pred             CCceEEEEEecCCcchHHHHHHHHHHHHHhCCeEEEEEEccCcchhchhhhccchHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            889999999999999999999999999999999999999876432111     111122222233333444444433345


Q ss_pred             cEEEEEecCCchHHHHHHHHHHhCCCEEEEeecCCcchhHhhhhHHHHhccCCceEEEEeCCC
Q 030760           76 NVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHNDISSSFNCRVLAIKQPA  138 (172)
Q Consensus        76 ~~~~~~~~g~~~~~~I~~~a~~~~~DllVmg~~~~~~~~~~~~gs~~i~~~~~~PVlvv~~~~  138 (172)
                      .++..+..|++. +.|+++|++.++||||||++ ++++.+++.-+.+++++++||||++|..+
T Consensus        81 ~~~~~v~~G~p~-~~I~~~A~~~~aDLIVmG~~-~~~~~~~~~va~~V~~~s~~pVLvv~~~~  141 (142)
T PRK09982         81 KTKLRIERGEMP-ETLLEIMQKEQCDLLVCGHH-HSFINRLMPAYRGMINKMSADLLIVPFID  141 (142)
T ss_pred             cceEEEEecCHH-HHHHHHHHHcCCCEEEEeCC-hhHHHHHHHHHHHHHhcCCCCEEEecCCC
Confidence            677888889995 99999999999999999986 88888877324599999999999999654

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>TIGR00421 ubiX_pad polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PLN02496 probable phosphopantothenoylcysteine decarboxylase Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
3fg9_A156 Protein of universal stress protein USPA family; A 1e-06
3loq_A294 Universal stress protein; structural genomics, PSI 5e-05
3dlo_A155 Universal stress protein; unknown function, struct 2e-04
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 3e-04
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score = 48.7 bits (116), Expect = 8e-08
 Identities = 27/140 (19%), Positives = 46/140 (32%), Gaps = 27/140 (19%)

Query: 4   KKIVVIV---------EDVDAARAALLWALQNLLRFGD---VVTLLHVFP---------- 41
            K++V V             + + A  W L+ ++R       + LLHV            
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVD 65

Query: 42  ---SLNSRNRKKLRLLRLKGYQLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREI 98
              +     R   +  + KG  L   F + C++      E  +  GD     I   V+ +
Sbjct: 66  SIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHE-IGVGCEAWIKTGD-PKDVICQEVKRV 123

Query: 99  GASALVVGLHDRSFLHKLAM 118
               LVVG        K+ +
Sbjct: 124 RPDFLVVGSRGLGRFQKVFV 143
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.95
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.94
3tnj_A150 Universal stress protein (USP); structural genomic 99.94
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.94
3fg9_A156 Protein of universal stress protein USPA family; A 99.93
3dlo_A155 Universal stress protein; unknown function, struct 99.93
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.93
2z08_A137 Universal stress protein family; uncharacterized c 99.93
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.93
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.93
3fdx_A143 Putative filament protein / universal stress PROT; 99.92
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.91
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.9
3olq_A 319 Universal stress protein E; structural genomics, P 99.9
3loq_A294 Universal stress protein; structural genomics, PSI 99.89
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.88
3olq_A319 Universal stress protein E; structural genomics, P 99.88
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.88
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.87
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.87
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.87
3loq_A294 Universal stress protein; structural genomics, PSI 99.86
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.85
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.75
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 95.28
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 95.09
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 93.1
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 92.98
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 92.54
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 92.1
1mvl_A209 PPC decarboxylase athal3A; flavoprotein, active si 91.98
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 91.57
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 91.4
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 89.13
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 88.44
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 88.34
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 88.22
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 87.79
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 87.59
1qzu_A206 Hypothetical protein MDS018; alpha-beta sandwich, 87.5
1o97_C264 Electron transferring flavoprotein beta-subunit; F 87.14
1p3y_1194 MRSD protein; flavoprotein, FMN, rossmann fold, HF 87.03
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 86.88
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 86.44
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 86.28
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 86.28
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 86.0
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 84.87
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 84.84
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 83.55
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 83.46
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 81.86
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 81.58
2j4d_A 525 Cryptochrome 3, cryptochrome DASH; DNA-binding pro 80.79
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 80.69
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 80.66
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 80.58
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 80.37
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 80.27
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 80.22
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 80.15
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 80.06
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.95  E-value=8.2e-27  Score=161.52  Aligned_cols=133  Identities=19%  Similarity=0.195  Sum_probs=107.6

Q ss_pred             CCceEEEEEecCCHHHHHHHHHHHHhhccCCCEEEEEEEecCCCccchH----HHHHHHHHHH---HHHHHHHHHhhhhc
Q 030760            1 MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRNRK----KLRLLRLKGY---QLALSFKDICNDFF   73 (172)
Q Consensus         1 m~~k~Ilv~~d~s~~s~~al~~a~~la~~~~~~l~~l~V~~~~~~~~~~----~~~~~~~~~~---~~~~~~~~~~~~~~   73 (172)
                      |+|++||||+|+++.+..++++|..++...+++|+++||.+........    .....+...+   ...+.+.+.+... 
T Consensus         3 ~~~~~ILv~~D~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~-   81 (146)
T 3s3t_A            3 ARYTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPALDPVLSELLDAEAAHAKDAMRQRQQFVATT-   81 (146)
T ss_dssp             CCCCEEEEECCSSHHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-
T ss_pred             CccceEEEEcCCCHHHHHHHHHHHHHHHhcCCEEEEEEEecCccccccccccccHHHHHHHHHHHHHHHHHHHHHHHhc-
Confidence            7899999999999999999999999999999999999999876443211    1122222222   3333333333333 


Q ss_pred             CC-cEEEEEecCCchHHHHHH-HHHHhCCCEEEEeecCCcchhHhhhhHH--HHhccCCceEEEEe
Q 030760           74 NT-NVEIIVTEGDQEGARIAA-LVREIGASALVVGLHDRSFLHKLAMSHN--DISSSFNCRVLAIK  135 (172)
Q Consensus        74 ~~-~~~~~~~~g~~~~~~I~~-~a~~~~~DllVmg~~~~~~~~~~~~gs~--~i~~~~~~PVlvv~  135 (172)
                      ++ ++++.+..|++. +.|++ ++++.++||||||+++++.+.++++||+  +++++++||||+||
T Consensus        82 g~~~~~~~~~~g~~~-~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl~~~~~pVlvV~  146 (146)
T 3s3t_A           82 SAPNLKTEISYGIPK-HTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVIR  146 (146)
T ss_dssp             SCCCCEEEEEEECHH-HHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHHHHCSSEEEEEC
T ss_pred             CCcceEEEEecCChH-HHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHhccCCCCEEEeC
Confidence            67 889999999985 99999 9999999999999999999999999985  99999999999986
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>1mvl_A PPC decarboxylase athal3A; flavoprotein, active site mutant C175S; HET: FMN; 2.00A {Arabidopsis thaliana} SCOP: c.34.1.1 PDB: 1mvn_A* 1e20_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>1qzu_A Hypothetical protein MDS018; alpha-beta sandwich, lyase; HET: FMN; 2.91A {Homo sapiens} SCOP: c.34.1.1 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>1p3y_1 MRSD protein; flavoprotein, FMN, rossmann fold, HFCD family, oxdidative decarboxylation, cystein, lantibiotics, mersacidin, oxidore; HET: FAD; 2.54A {Bacillus SP} SCOP: c.34.1.1 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 5e-05
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 6e-05
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 6e-05
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 6e-05
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 2e-04
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 0.004
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Universal stress protein A, UspA
species: Haemophilus influenzae [TaxId: 727]

 Score = 39.2 bits (90), Expect = 5e-05
 Identities = 15/136 (11%), Positives = 46/136 (33%), Gaps = 5/136 (3%)

Query: 4   KKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFP----SLNSRNRKKLRLLRLKGY 59
           K I+V V+  + +   L  A+    R    ++++HV               +  ++ +  
Sbjct: 3   KHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSSMQDRIS 62

Query: 60  QLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMS 119
                      +  +  +   ++     G  ++  + +     LV G H   +   ++ +
Sbjct: 63  TETQKALLDLAESVDYPISEKLSGSGDLGQVLSDAIEQYDVDLLVTGHHQDFWSKLMSST 122

Query: 120 HNDISSSFNCRVLAIK 135
              +++     +L + 
Sbjct: 123 RQVMNTI-KIDMLVVP 137
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.96
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.95
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.93
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.92
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.92
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.9
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.43
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 93.54
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 93.09
d1qzua_181 4'-phosphopantothenoylcysteine decarboxylase (PPC 92.79
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 92.54
d1efpb_246 Small, beta subunit of electron transfer flavoprot 92.11
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 92.08
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.61
d1g5qa_174 Epidermin modifying enzyme (peptidyl-cysteine deca 91.49
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 91.47
d3clsc1262 Small, beta subunit of electron transfer flavoprot 91.2
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 90.38
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 90.15
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 88.87
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 88.87
d1mvla_182 4'-phosphopantothenoylcysteine decarboxylase (PPC 88.15
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 88.14
d2qy9a2211 GTPase domain of the signal recognition particle r 83.11
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 80.79
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.96  E-value=8.6e-29  Score=172.81  Aligned_cols=135  Identities=19%  Similarity=0.204  Sum_probs=108.0

Q ss_pred             CCceEEEEEecCCHHHHHHHHHHHHhhccCCCEEEEEEEecCCCccc-----------------hH-HHHHHHHHHH---
Q 030760            1 MDVKKIVVIVEDVDAARAALLWALQNLLRFGDVVTLLHVFPSLNSRN-----------------RK-KLRLLRLKGY---   59 (172)
Q Consensus         1 m~~k~Ilv~~d~s~~s~~al~~a~~la~~~~~~l~~l~V~~~~~~~~-----------------~~-~~~~~~~~~~---   59 (172)
                      |+|||||||+|+|+.+..+++||.++|++.+++|+++||.++.....                 .. .....+...+   
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAK   80 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999986643210                 00 1111111222   


Q ss_pred             HHHHHHHHHhhhhcCCcEEEEEecCCchHHHHHHHHHHhCCCEEEEeecCCcchhHhhhhHH--HHhccCCceEEEEeCC
Q 030760           60 QLALSFKDICNDFFNTNVEIIVTEGDQEGARIAALVREIGASALVVGLHDRSFLHKLAMSHN--DISSSFNCRVLAIKQP  137 (172)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~I~~~a~~~~~DllVmg~~~~~~~~~~~~gs~--~i~~~~~~PVlvv~~~  137 (172)
                      +..+.+.+.+.. .+++++..+..|++. +.|++++++.++||||||+++++++.++++||+  +|+++++|||||||++
T Consensus        81 ~~l~~~~~~~~~-~gv~~~~~~~~G~~~-~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~~  158 (160)
T d1mjha_          81 NKMENIKKELED-VGFKVKDIIVVGIPH-EEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRK  158 (160)
T ss_dssp             HHHHHHHHHHHH-TTCEEEEEEEEECHH-HHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECCC
T ss_pred             HHHHHHHHHHHh-cCCeEEEEEEeccHH-HHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcCC
Confidence            223333333333 488999999999986 999999999999999999999999999999986  9999999999999975
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzua_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvla_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure