Citrus Sinensis ID: 030778

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKKVNKEVSGFSLF
cccccccccccccccccccccHHHHHHccccccEEEEEccHHHHHHHHHHHccEEEccccccEEEEEEEEEEcccccEEEccccccccccccccccEEEEEEEEccccEEEEEccccccccccccccccccccccccccccEEcccccccccccHHHHHHHcccccccccc
ccccccccccEEEEEcccccccccHHHcccccccEEEEEHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHcccccccEccccccccccEEEEEEEEccccEEEEEEcccEcccccEEccccccccccccccccEEccccHHHHHHHHHHHHcccccccccccc
meissknneivdvsyvddecseqswMLRSLSESTVACITGDYAMQNVILQMGLRllapggmqIRQLHRWILKCHACYTITAEIgrifcpkcgnggtlRKVAVTVGENgivlasrrpritlrgtkfslpmpqggrdaiTKNLIlredqlpqkylyprnkkkvnkevsgfslf
meissknneivdvsyVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVgengivlasrrpritlrgtkfslpmpqggrDAITKNLILREDQlpqkylyprnkkkvnkevsgfslf
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKKVNKEVSGFSLF
*********IVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLP******DAITKNLILREDQL**KYL******************
**************************LRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLP***********NLILREDQ*******************GFSLF
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKKVNK********
*******NEIVDVSYVDD***EQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNK*******S**SLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKKVNKEVSGFSLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q5RBB3411 RNA-binding protein NOB1 yes no 0.783 0.326 0.455 5e-27
Q9ULX3412 RNA-binding protein NOB1 yes no 0.783 0.325 0.448 7e-27
Q4R537412 RNA-binding protein NOB1 N/A no 0.730 0.303 0.462 1e-26
Q3T042413 RNA-binding protein NOB1 yes no 0.783 0.324 0.448 1e-26
Q6VEU1410 RNA-binding protein NOB1 yes no 0.783 0.326 0.427 4e-26
Q8BW10403 RNA-binding protein NOB1 yes no 0.783 0.332 0.427 8e-26
Q9UTK0388 20S-pre-rRNA D-site endon yes no 0.654 0.288 0.427 9e-21
Q08444459 20S-pre-rRNA D-site endon yes no 0.678 0.252 0.352 8e-12
O29862166 Putative ribonuclease Vap yes no 0.362 0.373 0.358 4e-05
>sp|Q5RBB3|NOB1_PONAB RNA-binding protein NOB1 OS=Pongo abelii GN=NOB1 PE=2 SV=1 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 94/145 (64%), Gaps = 11/145 (7%)

Query: 35  VACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG 94
           V C+T D+AMQNV+LQMGL +LA  GM IR+   +IL+CH C+  T+++ R+FC  CGN 
Sbjct: 231 VGCVTTDFAMQNVLLQMGLHVLAVNGMLIREARSYILRCHGCFKTTSDMSRVFCSHCGN- 289

Query: 95  GTLRKVAVTVGENGIVLA--SRRPRI-TLRGTKFSLPMPQGGRDAITKNLILREDQ-LPQ 150
            TL+KV+VTV ++G +    SR P++   RG ++SLP P+GG+ AI  +L   EDQ  PQ
Sbjct: 290 KTLKKVSVTVSDDGTLHMHFSRNPKVLNPRGLRYSLPTPKGGKYAINPHLT--EDQRFPQ 347

Query: 151 KYLYPRNKKKVN----KEVSGFSLF 171
             L  + ++K N      V+G S F
Sbjct: 348 LRLSRKARQKTNVFAPDYVAGVSPF 372
May play a role in mRNA degradation.
Pongo abelii (taxid: 9601)
>sp|Q9ULX3|NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens GN=NOB1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R537|NOB1_MACFA RNA-binding protein NOB1 OS=Macaca fascicularis GN=NOB1 PE=2 SV=1 Back     alignment and function description
>sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 Back     alignment and function description
>sp|Q6VEU1|NOB1_RAT RNA-binding protein NOB1 OS=Rattus norvegicus GN=Nob1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BW10|NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus GN=Nob1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 Back     alignment and function description
>sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 Back     alignment and function description
>sp|O29862|VAPC8_ARCFU Putative ribonuclease VapC8 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=vapC8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
449452344 617 PREDICTED: RNA-binding protein NOB1-like 0.982 0.272 0.833 1e-82
449495836 617 PREDICTED: LOW QUALITY PROTEIN: RNA-bind 0.982 0.272 0.833 3e-82
255537423 628 RNA-binding protein nob1, putative [Rici 0.982 0.267 0.833 2e-81
224071796 588 predicted protein [Populus trichocarpa] 0.988 0.287 0.830 4e-80
356513405 632 PREDICTED: uncharacterized protein LOC10 0.976 0.264 0.791 9e-78
297742539 560 unnamed protein product [Vitis vinifera] 0.982 0.3 0.791 1e-77
359474015 633 PREDICTED: RNA-binding protein NOB1-like 0.982 0.265 0.791 1e-77
147800398 621 hypothetical protein VITISV_020978 [Viti 0.982 0.270 0.791 2e-77
357520491 613 RNA-binding protein NOB1 [Medicago trunc 0.947 0.264 0.797 4e-77
356528162 634 PREDICTED: uncharacterized protein LOC10 0.976 0.263 0.767 1e-75
>gi|449452344|ref|XP_004143919.1| PREDICTED: RNA-binding protein NOB1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  310 bits (794), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 157/168 (93%)

Query: 1   MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGG 60
           ME +S+ NE VD+S VDD  S+QSWMLRSLSES+VAC+TGDYAMQNV+LQMGLRLLAPGG
Sbjct: 404 MEDASQTNESVDMSNVDDVSSDQSWMLRSLSESSVACVTGDYAMQNVLLQMGLRLLAPGG 463

Query: 61  MQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITL 120
           MQIRQLHRWILKCHACY +TAEIGRIFCPKCGNGGTLRKVAVTVGENG+VLA+R+PRITL
Sbjct: 464 MQIRQLHRWILKCHACYNVTAEIGRIFCPKCGNGGTLRKVAVTVGENGVVLAARKPRITL 523

Query: 121 RGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKKVNKEVSGF 168
           RGTKFSLP+PQGGRDAITKNL+LREDQLPQK+L+P+ KKKVNK+   F
Sbjct: 524 RGTKFSLPLPQGGRDAITKNLVLREDQLPQKFLHPKTKKKVNKQGDEF 571

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449495836|ref|XP_004159959.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein NOB1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255537423|ref|XP_002509778.1| RNA-binding protein nob1, putative [Ricinus communis] gi|223549677|gb|EEF51165.1| RNA-binding protein nob1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224071796|ref|XP_002303575.1| predicted protein [Populus trichocarpa] gi|222841007|gb|EEE78554.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513405|ref|XP_003525404.1| PREDICTED: uncharacterized protein LOC100800291 [Glycine max] Back     alignment and taxonomy information
>gi|297742539|emb|CBI34688.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474015|ref|XP_002269627.2| PREDICTED: RNA-binding protein NOB1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147800398|emb|CAN66411.1| hypothetical protein VITISV_020978 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357520491|ref|XP_003630534.1| RNA-binding protein NOB1 [Medicago truncatula] gi|355524556|gb|AET05010.1| RNA-binding protein NOB1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356528162|ref|XP_003532674.1| PREDICTED: uncharacterized protein LOC100785714 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
TAIR|locus:2163071602 NOB1 [Arabidopsis thaliana (ta 0.953 0.270 0.768 8.2e-67
UNIPROTKB|Q9ULX3412 NOB1 "RNA-binding protein NOB1 0.730 0.303 0.469 3.2e-26
RGD|735222410 Nob1 "NIN1/RPN12 binding prote 0.730 0.304 0.446 8.4e-26
UNIPROTKB|Q3T042413 NOB1 "RNA-binding protein NOB1 0.730 0.302 0.462 1.1e-25
MGI|MGI:1914869403 Nob1 "NIN1/RPN12 binding prote 0.730 0.310 0.446 1.8e-25
FB|FBgn0030177472 CG2972 [Drosophila melanogaste 0.777 0.281 0.441 2.7e-21
POMBASE|SPAC1486.09388 SPAC1486.09 "ribosome biogenes 0.748 0.329 0.392 2.3e-20
WB|WBGene00021843364 Y54E10BR.4 [Caenorhabditis ele 0.672 0.315 0.388 7.8e-16
UNIPROTKB|G4MQ79467 MGG_09254 "20S-pre-rRNA D-site 0.649 0.237 0.357 2.1e-14
ASPGD|ASPL0000014547431 AN8253 [Emericella nidulans (t 0.573 0.227 0.401 1.3e-13
TAIR|locus:2163071 NOB1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 679 (244.1 bits), Expect = 8.2e-67, P = 8.2e-67
 Identities = 126/164 (76%), Positives = 147/164 (89%)

Query:     1 MEISSKNNEIVDVSYV-DDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPG 59
             +EI+S+  +  + S + DD  SEQSW LR+LSES+VACITGDYAMQNVILQMGLRLLAPG
Sbjct:   389 LEIASEAEDTFEASSIGDDGSSEQSWSLRALSESSVACITGDYAMQNVILQMGLRLLAPG 448

Query:    60 GMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRIT 119
             GMQIRQLHRWILKCHACYT+T EIGRIFCPKCGNGGTLRKVAVT+G NG ++A+ +PRIT
Sbjct:   449 GMQIRQLHRWILKCHACYTVTPEIGRIFCPKCGNGGTLRKVAVTIGANGAIIAACKPRIT 508

Query:   120 LRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKKVNK 163
             LRGT++S+PMP+GGR+AITKNLILREDQLPQK L+PR KKK +K
Sbjct:   509 LRGTQYSIPMPKGGREAITKNLILREDQLPQKLLHPRTKKKASK 552
GO:0005634 "nucleus" evidence=ISM
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0000469 "cleavage involved in rRNA processing" evidence=IDA
GO:0004521 "endoribonuclease activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006364 "rRNA processing" evidence=IMP
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
UNIPROTKB|Q9ULX3 NOB1 "RNA-binding protein NOB1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|735222 Nob1 "NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T042 NOB1 "RNA-binding protein NOB1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1914869 Nob1 "NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0030177 CG2972 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPAC1486.09 SPAC1486.09 "ribosome biogenesis protein Nob1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
WB|WBGene00021843 Y54E10BR.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G4MQ79 MGG_09254 "20S-pre-rRNA D-site endonuclease NOB1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000014547 AN8253 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
pfam0877273 pfam08772, NOB1_Zn_bind, Nin one binding (NOB1) Zn 1e-31
COG1439177 COG1439, COG1439, Predicted nucleic acid-binding p 4e-12
>gnl|CDD|192150 pfam08772, NOB1_Zn_bind, Nin one binding (NOB1) Zn-ribbon like Back     alignment and domain information 
 Score =  108 bits (271), Expect = 1e-31
 Identities = 36/74 (48%), Positives = 52/74 (70%), Gaps = 3/74 (4%)

Query: 62  QIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENG--IVLASRRPRIT 119
           +I+QL RWIL+CHAC+  T ++ + FCPKCGN  TLR+VAV+V E+G   +   +  +  
Sbjct: 1   RIKQLRRWILRCHACFKTTPDMTKQFCPKCGN-ATLRRVAVSVDEDGEIKLHLKKNFQWN 59

Query: 120 LRGTKFSLPMPQGG 133
            RGT +S+P P+GG
Sbjct: 60  TRGTIYSIPKPKGG 73

This domain corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 (Nin one binding). Length = 73
>gnl|CDD|224356 COG1439, COG1439, Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
KOG2463376 consensus Predicted RNA-binding protein Nob1p invo 100.0
PF0877273 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik 100.0
COG1439177 Predicted nucleic acid-binding protein, consists o 99.9
PRK12496164 hypothetical protein; Provisional 99.78
TIGR03875206 RNA_lig_partner RNA ligase partner, MJ_0950 family 97.62
PRK04358217 hypothetical protein; Provisional 97.46
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 96.64
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 96.5
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 96.35
PF08745205 UPF0278: UPF0278 family; InterPro: IPR022785 This 96.31
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.24
PF1324023 zinc_ribbon_2: zinc-ribbon domain 95.54
COG1545140 Predicted nucleic-acid-binding protein containing 95.39
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 95.03
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 95.01
PF1217237 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35 94.99
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 94.97
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 94.82
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 94.66
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 94.48
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.22
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 94.06
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 93.65
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.34
PF1501787 AF1Q: Drug resistance and apoptosis regulator 93.21
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 93.19
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 93.02
COG1592166 Rubrerythrin [Energy production and conversion] 92.97
PF10263157 SprT-like: SprT-like family; InterPro: IPR006640 T 92.96
COG3364112 Zn-ribbon containing protein [General function pre 92.88
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 92.64
COG209364 DNA-directed RNA polymerase, subunit E'' [Transcri 92.42
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.29
PF0413553 Nop10p: Nucleolar RNA-binding protein, Nop10p fami 92.16
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 91.93
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 91.48
PRK0639364 rpoE DNA-directed RNA polymerase subunit E''; Vali 90.95
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 90.63
COG226059 Predicted Zn-ribbon RNA-binding protein [Translati 90.56
COG1645131 Uncharacterized Zn-finger containing protein [Gene 90.38
PRK0835161 DNA-directed RNA polymerase subunit E''; Validated 90.34
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 90.32
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 90.18
PRK04351149 hypothetical protein; Provisional 90.15
PRK07591 421 threonine synthase; Validated 90.05
TIGR03844 398 cysteate_syn cysteate synthase. Members of this fa 90.0
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 89.72
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 89.64
COG1198 730 PriA Primosomal protein N' (replication factor Y) 89.4
PRK00241256 nudC NADH pyrophosphatase; Reviewed 88.83
PRK14714 1337 DNA polymerase II large subunit; Provisional 88.59
PRK06450 338 threonine synthase; Validated 88.36
TIGR00595 505 priA primosomal protein N'. All proteins in this f 88.25
PRK00420112 hypothetical protein; Validated 88.0
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 87.61
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 87.54
COG233182 Uncharacterized protein conserved in bacteria [Fun 87.49
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 87.48
PF07295146 DUF1451: Protein of unknown function (DUF1451); In 87.25
PRK06260 397 threonine synthase; Validated 87.22
PF1277350 DZR: Double zinc ribbon 87.09
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 86.82
PF1277350 DZR: Double zinc ribbon 86.47
PRK14559 645 putative protein serine/threonine phosphatase; Pro 86.2
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 86.05
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 86.03
PRK11032160 hypothetical protein; Provisional 85.53
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 84.77
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 84.75
PRK07218423 replication factor A; Provisional 84.4
COG026750 RpmG Ribosomal protein L33 [Translation, ribosomal 84.34
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 84.29
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 84.22
smart00731146 SprT SprT homologues. Predicted to have roles in t 84.2
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 83.19
TIGR02827586 RNR_anaer_Bdell anaerobic ribonucleoside-triphosph 82.99
PRK05978148 hypothetical protein; Provisional 82.97
TIGR003541095 polC DNA polymerase, archaeal type II, large subun 82.79
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 81.87
PRK14873 665 primosome assembly protein PriA; Provisional 81.75
TIGR00354 1095 polC DNA polymerase, archaeal type II, large subun 81.68
PF14319111 Zn_Tnp_IS91: Transposase zinc-binding domain 81.65
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 81.44
cd01675555 RNR_III Class III ribonucleotide reductase. Ribonu 81.16
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 81.08
PRK05580 679 primosome assembly protein PriA; Validated 80.91
PF06676148 DUF1178: Protein of unknown function (DUF1178); In 80.55
PLN0020986 ribosomal protein S27; Provisional 80.37
PRK040231121 DNA polymerase II large subunit; Validated 80.15
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 80.05
>KOG2463 consensus Predicted RNA-binding protein Nob1p involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-56  Score=391.56  Aligned_cols=147  Identities=44%  Similarity=0.768  Sum_probs=133.1

Q ss_pred             CCCCCCCceeecCC--------------CCceeeEecchHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccc
Q 030778           17 DDECSEQSWMLRSL--------------SESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAE   82 (171)
Q Consensus        17 ~~~~~~~~Wi~~~~--------------~~~~va~~TdDyAmQNVllqlGL~~~s~~g~~I~~~k~wvlrC~~C~k~~~~   82 (171)
                      .||.++++|||++.              .+..|||+|+||||||||+||||+++++.|++|+++++|+|||||||+++++
T Consensus       175 ~ed~DdDgwitp~ni~~~~~e~~al~~pe~~~Vac~TtDfamQNVlLqm~L~l~~~~G~~Ir~~r~~iLRCh~Cfsit~~  254 (376)
T KOG2463|consen  175 EEDADDDGWITPSNITEAIIELGALNRPENQLVACLTTDFAMQNVLLQMNLNLLAMSGMKIRSVRSYILRCHGCFSITSE  254 (376)
T ss_pred             ccccccccccccchHHHHHHhhhcccccccceeeeecccHHHHHHHHHhcccccCccchhhhhhhhheeEeeeeeEecCc
Confidence            34444444999872              4678999999999999999999999999999999999999999999999999


Q ss_pred             cCccccCCCCCCCceeEEEEEeCCCceEEecc--CcccccccceeecCCCCCCCCCCCCCeeecCCCCcccccchhhhhc
Q 030778           83 IGRIFCPKCGNGGTLRKVAVTVGENGIVLASR--RPRITLRGTKFSLPMPQGGRDAITKNLILREDQLPQKYLYPRNKKK  160 (171)
Q Consensus        83 ~~k~fCp~CG~~~TL~Rvsvsv~~~G~~~~~~--~~~~n~RG~~ySlPkpkgGk~~~~~~~IL~EDQ~~~~~~~~k~~~k  160 (171)
                      |++.|||+||+. ||+||+|||+++|+++.|.  |++||+||++||||+|||||++  .|+||+|||+++++...++|+|
T Consensus       255 m~k~FCp~CG~~-TL~K~aVsv~~dG~~~~h~k~r~~~n~RG~~YSlp~PkGgk~~--kN~~LrEDQ~~~q~~~~q~rkk  331 (376)
T KOG2463|consen  255 MPKDFCPSCGHK-TLTKCAVSVDEDGNGQTHFKKRFQWNNRGLQYSLPKPKGGKVA--KNPILREDQPEPQRRYVQTRKK  331 (376)
T ss_pred             cchhcccccCCC-eeeEEEEEecCCCceeEEeecccccccCcceeecCCCCCCccc--cCccccccCchHHHHHHHHHHh
Confidence            999999999999 9999999999999987764  5679999999999999999997  8999999999888877778777


Q ss_pred             -cCCCCC
Q 030778          161 -VNKEVS  166 (171)
Q Consensus       161 -~~~~d~  166 (171)
                       .++|++
T Consensus       332 ~~~~~~~  338 (376)
T KOG2463|consen  332 VKKPLNE  338 (376)
T ss_pred             hhccccc
Confidence             889998

>PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 Back     alignment and domain information
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03875 RNA_lig_partner RNA ligase partner, MJ_0950 family Back     alignment and domain information
>PRK04358 hypothetical protein; Provisional Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF08745 UPF0278: UPF0278 family; InterPro: IPR022785 This entry contains proteins of the UPF0278 family and proteins containing PIN domains Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PF12172 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35_N); InterPro: IPR022002 This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF15017 AF1Q: Drug resistance and apoptosis regulator Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) Back     alignment and domain information
>COG3364 Zn-ribbon containing protein [General function prediction only] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF04135 Nop10p: Nucleolar RNA-binding protein, Nop10p family; InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>PRK04351 hypothetical protein; Provisional Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PRK11032 hypothetical protein; Provisional Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information
>PRK07218 replication factor A; Provisional Back     alignment and domain information
>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>smart00731 SprT SprT homologues Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit Back     alignment and domain information
>PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>cd01675 RNR_III Class III ribonucleotide reductase Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PF06676 DUF1178: Protein of unknown function (DUF1178); InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2con_A79 Solution Structure Of Rsgi Ruh-035, A Zn-Ribbon Mod 3e-09
>pdb|2CON|A Chain A, Solution Structure Of Rsgi Ruh-035, A Zn-Ribbon Module In Mouse Cdna Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
Query: 57  APGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLA--SR 114
           + G   +R+   +IL+CH C+  T+++ R+FC  CGN  TL+KV+VT+ ++G +    SR
Sbjct: 2   SSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGN-KTLKKVSVTINDDGTLHMHFSR 60
Query: 115 RPRI-TLRGTKFS 126
            P++   RG ++S
Sbjct: 61  NPKVLNPRGLRYS 73

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 8e-31
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 1e-19
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Length = 79 Back     alignment and structure
 Score =  105 bits (265), Expect = 8e-31
 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 5/80 (6%)

Query: 57  APGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIV---LAS 113
           + G   +R+   +IL+CH C+  T+++ R+FC  CGN  TL+KV+VT+ ++G +    + 
Sbjct: 2   SSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGN-KTLKKVSVTINDDGTLHMHFSR 60

Query: 114 RRPRITLRGTKFSLPMPQGG 133
               +  RG ++S   P  G
Sbjct: 61  NPKVLNPRGLRYS-SGPSSG 79
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 100.0
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 99.68
3irb_A145 Uncharacterized protein from DUF35 family; 1381535 96.62
2gnr_A145 Conserved hypothetical protein; 13815350, structur 96.48
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 95.52
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 94.54
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 94.5
3i8o_A142 KH domain-containing protein MJ1533; APC89320.5, m 93.87
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 93.51
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 93.03
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 92.74
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 92.5
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 92.31
3ix7_A134 Uncharacterized protein TTHA0540; unknown function 92.15
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 90.63
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 90.12
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 88.51
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 88.07
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 87.82
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 87.78
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 87.62
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 86.45
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 86.42
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 86.23
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 85.16
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 84.73
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 84.66
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 83.68
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 83.42
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 82.84
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 82.46
3bbo_366 Ribosomal protein L33; large ribosomal subunit, sp 82.07
1ryq_A69 DNA-directed RNA polymerase, subunit E''; structur 80.48
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Back     alignment and structure
Probab=100.00  E-value=4.3e-35  Score=211.61  Aligned_cols=75  Identities=35%  Similarity=0.821  Sum_probs=71.4

Q ss_pred             cCCCCcceeeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEEecc--Ccc-cccccceeecCCCCC
Q 030778           57 APGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASR--RPR-ITLRGTKFSLPMPQG  132 (171)
Q Consensus        57 s~~g~~I~~~k~wvlrC~~C~k~~~~~~k~fCp~CG~~~TL~Rvsvsv~~~G~~~~~~--~~~-~n~RG~~ySlPkpkg  132 (171)
                      +++|++|+++++|+|||||||+++++|+++|||+|||+ ||+||+|+||+||++++|+  +++ ||+||++||||+|+|
T Consensus         2 s~~G~~Ir~~k~~iLrC~aCf~~t~~~~k~FCp~CGn~-TL~Rvsvsvd~~G~~~~hl~~n~~~~n~RG~~ySlPkpkG   79 (79)
T 2con_A            2 SSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGNK-TLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYSSGPSSG   79 (79)
T ss_dssp             CCCCCCCCCCCCEEEECSSSCCEESCSSCCSCSSSCCS-CCEEEECBCCSSCCCBCCCCCCCCCCCCCCCCCCCCCCCC
T ss_pred             CCCceEeeeeeeeeeEecccceECCCcccccccccCcc-cceEEEEEECCCCcEEEeccCCccccccCCCCccCCCCCC
Confidence            68999999999999999999999999999999999998 9999999999999988775  578 999999999999997
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>3i8o_A KH domain-containing protein MJ1533; APC89320.5, methanocaldococcus jannaschii DSM 2661, structural genomics, PSI-2; 2.64A {Methanocaldococcus jannaschii} Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>3ix7_A Uncharacterized protein TTHA0540; unknown function, thermus thermophilus HB8, structural genom 2, protein structure initiative; HET: MSE; 2.15A {Thermus thermophilus} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>3bbo_3 Ribosomal protein L33; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d2cona166 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin o 3e-26
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Length = 66 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: NOB1 zinc finger-like
family: NOB1 zinc finger-like
domain: RNA-binding protein NOB1 (Nin one binding)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 92.8 bits (231), Expect = 3e-26
 Identities = 23/67 (34%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 63  IRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENG---IVLASRRPRIT 119
           +R+   +IL+CH C+  T+++ R+FC  CGN  TL+KV+VT+ ++G   +  +     + 
Sbjct: 1   VREARSYILRCHGCFKTTSDMNRVFCGHCGN-KTLKKVSVTINDDGTLHMHFSRNPKVLN 59

Query: 120 LRGTKFS 126
            RG ++S
Sbjct: 60  PRGLRYS 66

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d2cona166 RNA-binding protein NOB1 (Nin one binding) {Mouse 99.94
d2gnra1137 Hypothetical protein SSO2064 {Sulfolobus solfatari 96.16
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.68
d2apob155 Ribosome biogenesis protein Nop10 {Archaeon Methan 94.35
d2ey4e152 Ribosome biogenesis protein Nop10 {Archaeon Pyroco 94.29
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 93.79
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 90.54
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 89.89
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 87.75
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 87.0
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 86.46
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 86.36
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 85.88
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 85.26
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 84.6
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 82.93
d2dkta174 RING finger and CHY zinc finger domain-containing 82.49
d1neea237 Zinc-binding domain of translation initiation fact 80.62
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: NOB1 zinc finger-like
family: NOB1 zinc finger-like
domain: RNA-binding protein NOB1 (Nin one binding)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.94  E-value=1.2e-28  Score=170.92  Aligned_cols=63  Identities=38%  Similarity=0.936  Sum_probs=58.5

Q ss_pred             ceeeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEEeccC--cc-cccccceee
Q 030778           63 IRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRR--PR-ITLRGTKFS  126 (171)
Q Consensus        63 I~~~k~wvlrC~~C~k~~~~~~k~fCp~CG~~~TL~Rvsvsv~~~G~~~~~~~--~~-~n~RG~~yS  126 (171)
                      |+++++|+|||||||+++++|++.|||+|||+ ||+||+||||+||++++|++  ++ ||+||++||
T Consensus         1 Ir~vr~~~LrC~aCf~~t~~~~k~FCpkCGn~-TL~rvsvsvd~~G~~~~h~~~~~k~~n~RG~~yS   66 (66)
T d2cona1           1 VREARSYILRCHGCFKTTSDMNRVFCGHCGNK-TLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYS   66 (66)
T ss_dssp             CCCCCCEEEECSSSCCEESCSSCCSCSSSCCS-CCEEEECBCCSSCCCBCCCCCCCCCCCCCCCCCC
T ss_pred             ChhhheeeeEeeecCcCcCCcccccCcccCCC-ceeEEEEEECCCCcEEEEecCCCceecCCccCCc
Confidence            78999999999999999999999999999998 99999999999999887754  35 899999997
>d2gnra1 b.40.4.15 (A:8-144) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure