Citrus Sinensis ID: 030876


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MAISTSTVSSSNLLSFSSTLGSSRIHRSSLMSFHNHQQTSNGRLVVNCCSSSDMGSAQNPTNGRQPQMSSMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILID
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccHHHHHHHHccc
ccEEcccccccccccccccccccccccccccHHccccccccccEEEEEcccccccccccccccccccccccccccEEEcccccccccccEEEEEEEEcHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHcHHHHHHccccccHHHHHHHHHEEEcc
maiststvsssnllsfsstlgssrihrsslmsfhnhqqtsngrlvvnccsssdmgsaqnptngrqpqmssmspfgvtlndngmskpsyKWQRVLLKVSgealagdhtqnidpKITMAIAREVASVTRLGIEVAIVVGGgnifrgasaagnsgldrssadYIGYFLLILID
maiststvsssnllSFSSTLGSSRIHRSSLMSFHNHQQTSNGRLVVNCCSSSDMGSAQNPTNGRQPQMSSMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEAlagdhtqnidpkITMAIAREVASVTRLGIEVAIVVGGGNIFRGASaagnsgldrssadYIGYFLLILID
MAIststvsssnllsfsstlgssRIHRSSLMSFHNHQQTSNGRLVVNCCSSSDMGSAQNPTNGRQPQMSSMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILID
********************************************VVNC***************************************YKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILI*
******************************************************************************************QRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILID
**************SFSSTLGSSRIHRSSLMSFHNHQQTSNGRLVVNCCSS******************SMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILID
*********SSNLLSFSSTLGSSRIHRSSLMSFHNHQQTSNGRLVVNCCSS***************QMSSMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILID
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISTSTVSSSNLLSFSSTLGSSRIHRSSLMSFHNHQQTSNGRLVVNCCSSSDMGSAQNPTNGRQPQMSSMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLILID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query170 2.2.26 [Sep-21-2011]
Q2JS42 254 Uridylate kinase OS=Synec yes no 0.470 0.314 0.537 2e-19
Q2JJE2 253 Uridylate kinase OS=Synec yes no 0.470 0.316 0.537 6e-19
Q2IMM2 251 Uridylate kinase OS=Anaer yes no 0.494 0.334 0.529 8e-19
Q0A7I2 242 Uridylate kinase OS=Alkal yes no 0.488 0.342 0.523 1e-18
Q7NI44 235 Uridylate kinase OS=Gloeo yes no 0.464 0.336 0.525 4e-18
Q10Y48 244 Uridylate kinase OS=Trich yes no 0.458 0.319 0.556 4e-18
Q313G6 238 Uridylate kinase OS=Desul yes no 0.464 0.331 0.525 5e-18
P74457 260 Uridylate kinase OS=Synec N/A no 0.488 0.319 0.516 8e-18
Q3MFI4 242 Uridylate kinase OS=Anaba yes no 0.458 0.322 0.531 8e-18
Q8YXK5 242 Uridylate kinase OS=Nosto yes no 0.458 0.322 0.531 8e-18
>sp|Q2JS42|PYRH_SYNJA Uridylate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pyrH PE=3 SV=1 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 60/80 (75%)

Query: 89  KWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAA 148
           K++R+LLK+SGEAL G+    IDP++  +IA EVASV R G++VAIVVGGGNI+RG   A
Sbjct: 2   KYRRILLKLSGEALMGERPYGIDPEVLQSIASEVASVVRAGVQVAIVVGGGNIWRGRKEA 61

Query: 149 GNSGLDRSSADYIGYFLLIL 168
              G+D++SADY+G    ++
Sbjct: 62  AAQGMDQASADYVGMLATVI 81




Catalyzes the reversible phosphorylation of UMP to UDP.
Synechococcus sp. (strain JA-3-3Ab) (taxid: 321327)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 2EC: 2
>sp|Q2JJE2|PYRH_SYNJB Uridylate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q2IMM2|PYRH_ANADE Uridylate kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q0A7I2|PYRH_ALHEH Uridylate kinase OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q7NI44|PYRH_GLOVI Uridylate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q10Y48|PYRH_TRIEI Uridylate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q313G6|PYRH_DESDG Uridylate kinase OS=Desulfovibrio desulfuricans (strain G20) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|P74457|PYRH_SYNY3 Uridylate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q3MFI4|PYRH_ANAVT Uridylate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pyrH PE=3 SV=1 Back     alignment and function description
>sp|Q8YXK5|PYRH_NOSS1 Uridylate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
255552374 328 Uridylate kinase, putative [Ricinus comm 0.947 0.490 0.631 1e-50
225431539 332 PREDICTED: uridylate kinase-like [Vitis 0.776 0.397 0.761 8e-50
356512819 331 PREDICTED: uridylate kinase-like [Glycin 0.805 0.413 0.590 3e-41
255637835 325 unknown [Glycine max] 0.676 0.353 0.700 3e-40
356525588 325 PREDICTED: uridylate kinase-like [Glycin 0.676 0.353 0.700 3e-40
449461831 341 PREDICTED: uridylate kinase-like [Cucumi 0.811 0.404 0.605 3e-39
218189798 363 hypothetical protein OsI_05332 [Oryza sa 0.6 0.280 0.764 3e-38
115442427 351 Os01g0965400 [Oryza sativa Japonica Grou 0.6 0.290 0.764 4e-38
296088581255 unnamed protein product [Vitis vinifera] 0.535 0.356 0.857 8e-38
357131781 335 PREDICTED: uridylate kinase-like [Brachy 0.588 0.298 0.782 4e-37
>gi|255552374|ref|XP_002517231.1| Uridylate kinase, putative [Ricinus communis] gi|223543602|gb|EEF45131.1| Uridylate kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 128/171 (74%), Gaps = 10/171 (5%)

Query: 1   MAISTSTVSSSNLLSFSST---LGSSRIHRSSLMSFHNHQQTSNGRLVVNCCSSSDMGSA 57
           MAISTS    + L   S +   LG  +IH    M  H+   T NGRL+++CCS  DMG+ 
Sbjct: 1   MAISTSFAPINTLNPVSPSYYSLGPFKIHHPRFMRAHS---TPNGRLLIHCCS--DMGAT 55

Query: 58  QNPTNGRQPQMSSMSPFGVTLNDNGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMA 117
             P + RQ QM+SM+ FG  +N+  +S+PSYKWQRVLLKVSGEALAGD TQNIDPKITMA
Sbjct: 56  SEPMSIRQAQMTSMAAFG--MNETSLSRPSYKWQRVLLKVSGEALAGDRTQNIDPKITMA 113

Query: 118 IAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLIL 168
           IAREVASVTRLG+EVAIVVGGGNIFRG+S AG+SGLDRSSADYIG    ++
Sbjct: 114 IAREVASVTRLGVEVAIVVGGGNIFRGSSWAGSSGLDRSSADYIGMLATVM 164




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225431539|ref|XP_002281894.1| PREDICTED: uridylate kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512819|ref|XP_003525113.1| PREDICTED: uridylate kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|255637835|gb|ACU19237.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356525588|ref|XP_003531406.1| PREDICTED: uridylate kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|449461831|ref|XP_004148645.1| PREDICTED: uridylate kinase-like [Cucumis sativus] gi|449507502|ref|XP_004163050.1| PREDICTED: uridylate kinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|218189798|gb|EEC72225.1| hypothetical protein OsI_05332 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115442427|ref|NP_001045493.1| Os01g0965400 [Oryza sativa Japonica Group] gi|57900163|dbj|BAD88248.1| putative UMP-kinase [Oryza sativa Japonica Group] gi|113535024|dbj|BAF07407.1| Os01g0965400 [Oryza sativa Japonica Group] gi|215697542|dbj|BAG91536.1| unnamed protein product [Oryza sativa Japonica Group] gi|215740796|dbj|BAG96952.1| unnamed protein product [Oryza sativa Japonica Group] gi|222619931|gb|EEE56063.1| hypothetical protein OsJ_04876 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|296088581|emb|CBI37572.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357131781|ref|XP_003567512.1| PREDICTED: uridylate kinase-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
TAIR|locus:2093949 339 AT3G18680 [Arabidopsis thalian 0.8 0.401 0.587 6.5e-35
TIGR_CMR|CHY_1785 242 CHY_1785 "uridylate kinase" [C 0.482 0.338 0.488 4.1e-17
TIGR_CMR|GSU_1919 239 GSU_1919 "uridylate kinase" [G 0.452 0.322 0.562 4.1e-17
TAIR|locus:2100108 542 AT3G10030 [Arabidopsis thalian 0.676 0.212 0.446 1.5e-16
TIGR_CMR|BA_3963 240 BA_3963 "uridylate kinase" [Ba 0.488 0.345 0.465 4.7e-16
TIGR_CMR|SPO_1662 251 SPO_1662 "uridylate kinase" [R 0.494 0.334 0.441 2e-15
TIGR_CMR|DET_0375 241 DET_0375 "uridylate kinase" [D 0.464 0.327 0.512 3.3e-15
TIGR_CMR|CPS_1555 247 CPS_1555 "uridylate kinase" [C 0.476 0.327 0.440 6.9e-15
TIGR_CMR|SO_1631 242 SO_1631 "uridylate kinase" [Sh 0.476 0.334 0.440 1.1e-14
TIGR_CMR|VC_2258 243 VC_2258 "uridylate kinase" [Vi 0.476 0.333 0.440 1.4e-14
TAIR|locus:2093949 AT3G18680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 378 (138.1 bits), Expect = 6.5e-35, P = 6.5e-35
 Identities = 84/143 (58%), Positives = 104/143 (72%)

Query:    32 SFHNHQQTSNGRLVVNCCSS--SDMGSAQNPTNGRQ----PQMSSMSPFGVTLNDNGMSK 85
             +F ++Q  S  R++++C SS  SD GS+ +  NG        ++  S F    + +G SK
Sbjct:    33 TFFSNQNYSR-RVLISCSSSLSSDNGSSPDSMNGNGNGNGSSLNGQSSFPRLPSFDGTSK 91

Query:    86 PSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGA 145
             P  KW+RVLLKVSGEALAGD  QNIDPK+TMAIAREVA+VTRLGIEVAIVVGGGNIFRG+
Sbjct:    92 PPLKWRRVLLKVSGEALAGDEEQNIDPKVTMAIAREVAAVTRLGIEVAIVVGGGNIFRGS 151

Query:   146 SAAGNSGLDRSSADYIGYFLLIL 168
             + AG SGLDRSSADYIG    ++
Sbjct:   152 TWAGCSGLDRSSADYIGMLATVM 174




GO:0006221 "pyrimidine nucleotide biosynthetic process" evidence=IEA;ISS
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
GO:0009041 "uridylate kinase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0033862 "UMP kinase activity" evidence=IEA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009073 "aromatic amino acid family biosynthetic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016226 "iron-sulfur cluster assembly" evidence=RCA
GO:0045036 "protein targeting to chloroplast" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TIGR_CMR|CHY_1785 CHY_1785 "uridylate kinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1919 GSU_1919 "uridylate kinase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2100108 AT3G10030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3963 BA_3963 "uridylate kinase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1662 SPO_1662 "uridylate kinase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0375 DET_0375 "uridylate kinase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1555 CPS_1555 "uridylate kinase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1631 SO_1631 "uridylate kinase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2258 VC_2258 "uridylate kinase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
LOC_Os01g73450.1
amino acid kinase, putative, expressed (351 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
4345504
elongation factor Ts, putative, expressed; Associates with the EF-Tu.GDP complex and induces th [...] (366 aa)
     0.959
4343662
ribosome recycling factor, putative, expressed; Responsible for the release of ribosomes from m [...] (266 aa)
     0.954
4338981
phosphoribosyl transferase, putative, expressed (301 aa)
     0.901
4324755
dehydrodolichyl diphosphate synthase, putative, expressed (308 aa)
      0.883
4336241
ribosome recycling factor, putative, expressed (260 aa)
     0.884
4330474
class I glutamine amidotransferase, putative, expressed (473 aa)
     0.876
4326153
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor, putative, expressed; Ca [...] (473 aa)
     0.869
4332674
guanylate kinase, putative, expressed (285 aa)
     0.821
4342497
polynucleotide phosphorylase, putative, expressed (902 aa)
    0.812
4345281
class I glutamine amidotransferase, putative, expressed (544 aa)
      0.789

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
cd04254 231 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, t 5e-34
PRK00358 231 PRK00358, pyrH, uridylate kinase; Provisional 6e-31
cd04239 229 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase 2e-26
COG0528 238 COG0528, PyrH, Uridylate kinase [Nucleotide transp 8e-26
TIGR02075 232 TIGR02075, pyrH_bact, uridylate kinase 1e-25
PRK14557 247 PRK14557, pyrH, uridylate kinase; Provisional 2e-16
PRK14558 231 PRK14558, pyrH, uridylate kinase; Provisional 6e-14
PRK14556 249 PRK14556, pyrH, uridylate kinase; Provisional 2e-12
pfam00696 230 pfam00696, AA_kinase, Amino acid kinase family 8e-04
>gnl|CDD|239787 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
 Score =  119 bits (300), Expect = 5e-34
 Identities = 47/72 (65%), Positives = 59/72 (81%), Gaps = 1/72 (1%)

Query: 91  QRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGN 150
           +RVLLK+SGEALAG++   IDP++   IARE+  V  LG+EVAIVVGGGNIFRGASAA  
Sbjct: 1   KRVLLKLSGEALAGENGFGIDPEVLNRIAREIKEVVDLGVEVAIVVGGGNIFRGASAAEA 60

Query: 151 SGLDRSSADYIG 162
            G+DR++ADY+G
Sbjct: 61  -GMDRATADYMG 71


The UMP kinase of E. coli (Ec) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial and chloroplast UMPKs (this CD) have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK). Length = 231

>gnl|CDD|234735 PRK00358, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239772 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|223602 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|213681 TIGR02075, pyrH_bact, uridylate kinase Back     alignment and domain information
>gnl|CDD|173022 PRK14557, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173021 PRK14556, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 170
COG0528 238 PyrH Uridylate kinase [Nucleotide transport and me 99.96
PRK14556 249 pyrH uridylate kinase; Provisional 99.95
PRK14557 247 pyrH uridylate kinase; Provisional 99.79
PRK14558 231 pyrH uridylate kinase; Provisional 99.53
cd04235 308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot 99.49
TIGR02075 233 pyrH_bact uridylate kinase. This protein, also cal 99.41
cd04240 203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin 99.38
PRK00358 231 pyrH uridylate kinase; Provisional 99.36
cd04254 231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi 99.35
cd04253 221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP 99.26
cd04239 229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik 99.21
TIGR02076 221 pyrH_arch uridylate kinase, putative. This family 99.15
PRK12454 313 carbamate kinase-like carbamoyl phosphate syntheta 99.08
TIGR00746 310 arcC carbamate kinase. The seed alignment for this 99.07
PRK12353 314 putative amino acid kinase; Reviewed 99.07
cd04255 262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th 99.02
PRK13402 368 gamma-glutamyl kinase; Provisional 98.61
PTZ00489 264 glutamate 5-kinase; Provisional 98.61
cd04241 252 AAK_FomA-like AAK_FomA-like: This CD includes a fo 98.59
TIGR01027 363 proB glutamate 5-kinase. Bacterial ProB proteins h 98.41
PRK05429 372 gamma-glutamyl kinase; Provisional 98.21
PF00696 242 AA_kinase: Amino acid kinase family Match to Gluta 98.12
cd04256 284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase 98.11
cd04242 251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K 98.1
TIGR00656 401 asp_kin_monofn aspartate kinase, monofunctional cl 97.94
cd02115 248 AAK Amino Acid Kinases (AAK) superfamily, catalyti 97.93
cd04246 239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina 97.88
cd04261 239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina 97.88
PRK06635 404 aspartate kinase; Reviewed 97.8
PRK12314 266 gamma-glutamyl kinase; Provisional 97.73
TIGR01092 715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 97.61
PRK07431 587 aspartate kinase; Provisional 97.58
cd04234 227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) 97.35
PRK04531 398 acetylglutamate kinase; Provisional 97.33
cd04237 280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) 97.22
COG0263 369 ProB Glutamate 5-kinase [Amino acid transport and 97.2
PLN02512 309 acetylglutamate kinase 97.11
PRK05279 441 N-acetylglutamate synthase; Validated 97.09
cd04260 244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase 97.08
PRK00942 283 acetylglutamate kinase; Provisional 97.05
PRK08210 403 aspartate kinase I; Reviewed 97.04
PRK12352 316 putative carbamate kinase; Reviewed 96.99
TIGR01890 429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 96.91
PLN02418 718 delta-1-pyrroline-5-carboxylate synthase 96.88
PRK08841 392 aspartate kinase; Validated 96.82
TIGR00761 231 argB acetylglutamate kinase. This model describes 96.71
cd04250 279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase 96.68
cd04238 256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate 96.67
CHL00202 284 argB acetylglutamate kinase; Provisional 96.63
KOG1154 285 consensus Gamma-glutamyl kinase [Amino acid transp 96.62
PRK12354 307 carbamate kinase; Reviewed 96.57
cd04252 248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam 96.42
cd04236 271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA 96.31
PRK12686 312 carbamate kinase; Reviewed 96.21
PLN02825 515 amino-acid N-acetyltransferase 96.17
PRK14058 268 acetylglutamate/acetylaminoadipate kinase; Provisi 95.92
COG0548 265 ArgB Acetylglutamate kinase [Amino acid transport 95.8
cd04249 252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina 95.69
cd04251 257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina 94.5
TIGR00657 441 asp_kinases aspartate kinase. The Lys-sensitive en 94.11
COG1608 252 Predicted archaeal kinase [General function predic 94.01
TIGR02078 327 AspKin_pair Pyrococcus aspartate kinase subunit, p 93.7
cd04244 298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina 93.38
PRK06291 465 aspartate kinase; Provisional 92.76
COG0527 447 LysC Aspartokinases [Amino acid transport and meta 92.29
COG0549 312 ArcC Carbamate kinase [Amino acid transport and me 89.55
cd04259 295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super 88.07
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 85.81
PRK09411 297 carbamate kinase; Reviewed 85.4
COG2054 212 Uncharacterized archaeal kinase related to asparto 84.96
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 84.32
cd04257 294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa 83.39
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 81.49
cd04243 293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina 80.48
PRK09084 448 aspartate kinase III; Validated 80.4
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
Probab=99.96  E-value=8.4e-30  Score=216.82  Aligned_cols=79  Identities=51%  Similarity=0.862  Sum_probs=76.1

Q ss_pred             cceEEEEEeecceecCCCCCCCCHHHHHHHHHHHHHHHhCCcEEEEEEcCChhhhhhhhhhcCCCCchhhhhhhheeeee
Q 030876           89 KWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFLLIL  168 (170)
Q Consensus        89 kykRVLLKLSGEaLagd~~~giD~~~l~~iA~eIkel~~~GvqIAIVVGGGNI~RG~~~Ar~lGidrataDyIGMLATvi  168 (170)
                      +|||||||||||+|+|++++|||++.++++|++|+++.+.|+||+|||||||+||||+.+. .|++|+++|||||+||||
T Consensus         4 ~~~rillkLsGe~l~g~~~~gid~~~i~~~a~~i~~~~~~g~eV~iVvGGGni~Rg~~~~~-~g~~r~~~D~mGmlaTvm   82 (238)
T COG0528           4 KYMRILLKLSGEALAGEQGFGIDPEVLDRIANEIKELVDLGVEVAVVVGGGNIARGYIGAA-AGMDRVTADYMGMLATVM   82 (238)
T ss_pred             ceEEEEEEeecceecCCCCCCCCHHHHHHHHHHHHHHHhcCcEEEEEECCCHHHHhHHHHH-cCCchhhhhHHHHHHHHH
Confidence            7999999999999999999999999999999999999999999999999999999999665 599999999999999997



>PRK14556 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK14557 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK14558 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>TIGR00746 arcC carbamate kinase Back     alignment and domain information
>PRK12353 putative amino acid kinase; Reviewed Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PTZ00489 glutamate 5-kinase; Provisional Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02512 acetylglutamate kinase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
3ek5_A 243 Unique Gtp-Binding Pocket And Allostery Of Ump Kina 3e-16
1z9d_A 252 Crystal Structure Of A Putative Uridylate Kinase (U 5e-15
2a1f_A 247 Crystal Structure Of Uridylate Kinase Length = 247 2e-14
2bne_A 241 The Structure Of E. Coli Ump Kinase In Complex With 3e-13
2bnd_A 241 The Structure Of E.Coli Ump Kinase In Complex With 3e-13
3nwy_A 281 Structure And Allosteric Regulation Of The Uridine 3e-12
2bnf_A 241 The Structure Of E. Coli Ump Kinase In Complex With 4e-12
2jjx_A 255 The Crystal Structure Of Ump Kinase From Bacillus A 1e-11
4a7w_A 240 Crystal Structure Of Uridylate Kinase From Helicoba 1e-05
1ybd_A 239 Crystal Structure Analysis Of Uridylate Kinase From 2e-05
2va1_A 256 Crystal Structure Of Ump Kinase From Ureaplasma Par 2e-05
>pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram- Negative Phytopathogen Bacterium Length = 243 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 43/88 (48%), Positives = 59/88 (67%), Gaps = 3/88 (3%) Query: 81 NGMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGN 140 N MS+ SY+ R+LLK+SGEAL GD IDPK+ +A EV + G +VA+V+GGGN Sbjct: 2 NAMSELSYR--RILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGN 59 Query: 141 IFRGASAAGNSGLDRSSADYIGYFLLIL 168 IFRGA A SG+DR + D++G ++ Sbjct: 60 IFRGAGLAA-SGMDRVTGDHMGMLATVI 86
>pdb|1Z9D|A Chain A, Crystal Structure Of A Putative Uridylate Kinase (Ump-Kinase) From Streptococcus Pyogenes Length = 252 Back     alignment and structure
>pdb|2A1F|A Chain A, Crystal Structure Of Uridylate Kinase Length = 247 Back     alignment and structure
>pdb|2BNE|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Ump Length = 241 Back     alignment and structure
>pdb|2BND|A Chain A, The Structure Of E.Coli Ump Kinase In Complex With Udp Length = 241 Back     alignment and structure
>pdb|3NWY|A Chain A, Structure And Allosteric Regulation Of The Uridine Monophosphate Kinase From Mycobacterium Tuberculosis Length = 281 Back     alignment and structure
>pdb|2BNF|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Utp Length = 241 Back     alignment and structure
>pdb|2JJX|A Chain A, The Crystal Structure Of Ump Kinase From Bacillus Anthracis (Ba1797) Length = 255 Back     alignment and structure
>pdb|4A7W|A Chain A, Crystal Structure Of Uridylate Kinase From Helicobacter Pylori Length = 240 Back     alignment and structure
>pdb|1YBD|A Chain A, Crystal Structure Analysis Of Uridylate Kinase From Neisseria Meningitidis Length = 239 Back     alignment and structure
>pdb|2VA1|A Chain A, Crystal Structure Of Ump Kinase From Ureaplasma Parvum Length = 256 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
4a7w_A 240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 2e-34
2a1f_A 247 Uridylate kinase; PYRH, structural genomics, PSI, 4e-33
3ek6_A 243 Uridylate kinase; UMPK unique GTP B site, alloster 4e-33
2jjx_A 255 Uridylate kinase, UMP kinase; structural genomics, 2e-32
1ybd_A 239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 3e-32
1z9d_A 252 Uridylate kinase, UK, UMP kinase; structural genom 1e-31
3nwy_A 281 Uridylate kinase; allosterically activated form, A 4e-30
2va1_A 256 Uridylate kinase; UMPK, transferase, pyrimidine bi 4e-30
2brx_A 244 Uridylate kinase; UMP kinase, amino acid kinase, p 2e-24
2j4j_A 226 Uridylate kinase; transferase, nucleoside monophos 2e-24
2ij9_A 219 Uridylate kinase; structural genomics, protein str 4e-21
2ogx_B 270 Molybdenum storage protein subunit beta; open alph 4e-20
2ogx_A 276 Molybdenum storage protein subunit alpha; open alp 1e-11
3k4o_A 266 Isopentenyl phosphate kinase; small molecule kinas 1e-08
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Length = 240 Back     alignment and structure
 Score =  120 bits (302), Expect = 2e-34
 Identities = 40/80 (50%), Positives = 51/80 (63%), Gaps = 2/80 (2%)

Query: 83  MSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIF 142
            +K   K  RVL+K SGEALAGD+   ID  +   IA+E+ S+    IEV IV+GGGNI 
Sbjct: 2   QAKIKNK--RVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNII 59

Query: 143 RGASAAGNSGLDRSSADYIG 162
           RG SAA    + R+S DY+G
Sbjct: 60  RGVSAAQGGIIRRTSGDYMG 79


>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Length = 219 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
3ek6_A 243 Uridylate kinase; UMPK unique GTP B site, alloster 99.82
3nwy_A 281 Uridylate kinase; allosterically activated form, A 99.75
4a7w_A 240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 99.73
1z9d_A 252 Uridylate kinase, UK, UMP kinase; structural genom 99.5
2a1f_A 247 Uridylate kinase; PYRH, structural genomics, PSI, 99.49
1ybd_A 239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 99.48
2va1_A 256 Uridylate kinase; UMPK, transferase, pyrimidine bi 99.46
2jjx_A 255 Uridylate kinase, UMP kinase; structural genomics, 99.44
2brx_A 244 Uridylate kinase; UMP kinase, amino acid kinase, p 99.37
2j4j_A 226 Uridylate kinase; transferase, nucleoside monophos 99.23
3k4o_A 266 Isopentenyl phosphate kinase; small molecule kinas 99.17
3ll5_A 249 Gamma-glutamyl kinase related protein; alternate m 99.16
2ij9_A 219 Uridylate kinase; structural genomics, protein str 99.15
3kzf_A 317 Carbamate kinase; arginine dihydrolase pathway, gi 99.04
3ll9_A 269 Isopentenyl phosphate kinase; mevalonate biosynthe 98.94
2v5h_A 321 Acetylglutamate kinase; amino-acid biosynthesis, t 98.73
2rd5_A 298 Acetylglutamate kinase-like protein; protein-prote 98.72
2ogx_A 276 Molybdenum storage protein subunit alpha; open alp 98.72
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma gl 98.68
2ogx_B 270 Molybdenum storage protein subunit beta; open alph 98.68
2bty_A 282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 98.64
2we5_A 310 Carbamate kinase 1; arginine catabolism, arginine 98.61
1e19_A 314 Carbamate kinase-like carbamoylphosphate synthetas 98.6
3d40_A 286 FOMA protein; fosfomycin, antibiotic resistance, k 98.59
2buf_A 300 Acetylglutamate kinase; acetyglutamate kinase, ADP 98.59
2ako_A 251 Glutamate 5-kinase; structural genomics, PSI, prot 98.57
2ap9_A 299 NAG kinase, acetylglutamate kinase, AGK; structura 98.5
2e9y_A 316 Carbamate kinase; transferase, structural genomics 98.45
1gs5_A 258 Acetylglutamate kinase; carbamate kinase, amino ac 98.4
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase tran 98.25
2egx_A 269 Putative acetylglutamate kinase; struc genomics, N 98.1
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu 98.04
3l86_A 279 Acetylglutamate kinase; ARGB, amino-acid biosynthe 97.67
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibit 97.57
4axs_A 332 Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm 97.45
3zzh_A 307 Acetylglutamate kinase; transferase, arginine bios 97.35
4ab7_A 464 Protein Arg5,6, mitochondrial; transferase, argini 97.24
3s6g_A 460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 97.17
3s6k_A 467 Acetylglutamate kinase; synthase, transferase; 2.8 96.62
3c1m_A 473 Probable aspartokinase; allosteric inhibition, thr 87.81
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 82.34
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A Back     alignment and structure
Probab=99.82  E-value=9.5e-21  Score=155.29  Aligned_cols=84  Identities=48%  Similarity=0.801  Sum_probs=76.4

Q ss_pred             CCCCCCCcceEEEEEeecceecCCCCCCCCHHHHHHHHHHHHHHHhCCcEEEEEEcCChhhhhhhhhhcCCCCchhhhhh
Q 030876           82 GMSKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYI  161 (170)
Q Consensus        82 ~m~~~~~kykRVLLKLSGEaLagd~~~giD~~~l~~iA~eIkel~~~GvqIAIVVGGGNI~RG~~~Ar~lGidrataDyI  161 (170)
                      .|.+|  +||||||||+|++|.+++++++|++.++++|++|+++.+.|+||+||+|||++||++..+ ++|+++..+|+|
T Consensus         3 ~~~~~--~~~riViKlGGs~l~~~~~~~~~~~~i~~la~~i~~l~~~G~~vviV~gGG~~~~~~~~~-~~g~~~~~~d~~   79 (243)
T 3ek6_A            3 AMSEL--SYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGAGLA-ASGMDRVTGDHM   79 (243)
T ss_dssp             CGGGC--SCSEEEEEECGGGGTTTSSSSCCHHHHHHHHHHHHHHHHTTCEEEEEECSTTTSCSTTTS-CSSSCHHHHHHH
T ss_pred             ccccC--cCcEEEEEEchhhccCCCCCCCCHHHHHHHHHHHHHHHHCCCeEEEEECCCHHHHHHHHH-HcCCCCCCHHHH
Confidence            35554  799999999999999877778999999999999999999999999999999999998764 589999999999


Q ss_pred             hheeeee
Q 030876          162 GYFLLIL  168 (170)
Q Consensus       162 GMLATvi  168 (170)
                      ||++|++
T Consensus        80 g~l~t~~   86 (243)
T 3ek6_A           80 GMLATVI   86 (243)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9999865



>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} Back     alignment and structure
>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 170
d2a1fa1 236 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi 5e-14
d1ybda1 236 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri 1e-12
d1z9da1 238 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc 5e-12
d2ij9a1 219 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog 9e-09
d2brxa1 225 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc 1e-07
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Uridylate kinase PyrH
species: Haemophilus influenzae [TaxId: 727]
 Score = 65.4 bits (158), Expect = 5e-14
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 84  SKPSYKWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFR 143
           S+P YK  R+LLK+SGEAL G+    IDP I   +A E+  +  +G+EV++V+GGGN+FR
Sbjct: 1   SQPIYK--RILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFR 58

Query: 144 GASA 147
           GA  
Sbjct: 59  GAKL 62


>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
d1z9da1 238 Uridylate kinase PyrH {Streptococcus pyogenes [Tax 99.51
d1ybda1 236 Uridylate kinase PyrH {Neisseria meningitidis [Tax 99.49
d2ij9a1 219 Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax 99.45
d2a1fa1 236 Uridylate kinase PyrH {Haemophilus influenzae [Tax 99.43
d2brxa1 225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 99.37
d2akoa1 250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 98.76
d1e19a_ 313 Carbamate kinase {Archaeon Pyrococcus furiosus [Ta 98.17
d1b7ba_ 307 Carbamate kinase {Enterococcus faecium [TaxId: 135 98.17
d2btya1 282 N-acetyl-l-glutamate kinase {Thermotoga maritima [ 97.92
d2ap9a1 291 N-acetyl-l-glutamate kinase {Mycobacterium tubercu 97.86
d1gs5a_ 258 N-acetyl-l-glutamate kinase {Escherichia coli [Tax 97.84
d2bufa1 300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginos 97.66
d2hmfa1 302 Aspartokinase {Methanococcus jannaschii [TaxId: 21 90.43
d2cdqa1 304 Aspartokinase {Thale cress (Arabidopsis thaliana) 88.42
d2j0wa1 292 Aspartokinase {Escherichia coli [TaxId: 562]} 85.88
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Uridylate kinase PyrH
species: Streptococcus pyogenes [TaxId: 1314]
Probab=99.51  E-value=1e-14  Score=109.93  Aligned_cols=76  Identities=50%  Similarity=0.853  Sum_probs=66.7

Q ss_pred             cceEEEEEeecceecCCCCCCCCHHHHHHHHHHHHHHHhCCcEEEEEEcCChhhhhhhhhhcCCCCchhhhhhhhee
Q 030876           89 KWQRVLLKVSGEALAGDHTQNIDPKITMAIAREVASVTRLGIEVAIVVGGGNIFRGASAAGNSGLDRSSADYIGYFL  165 (170)
Q Consensus        89 kykRVLLKLSGEaLagd~~~giD~~~l~~iA~eIkel~~~GvqIAIVVGGGNI~RG~~~Ar~lGidrataDyIGMLA  165 (170)
                      |||||||||+|++|..+++.++|.++|+++|++|+++++.|++|++|.|||..+|.+..+ ..+......++..+.+
T Consensus         3 k~krIViKiGgs~lt~~~~~~l~~~~l~~ia~~I~~l~~~g~~Vv~v~~g~~~~~~~~~~-~~~~~~~~~~~~~~~~   78 (238)
T d1z9da1           3 KYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGEPAA-DAGMDRVQADYTGMLG   78 (238)
T ss_dssp             SCSEEEEEECGGGGTCSSSSSCCHHHHHHHHHHHHHHHTTTCEEEEEECCTTTCCHHHHH-HHTCCHHHHHHHHHHH
T ss_pred             CCCEEEEEECcceecCCCCCCcCHHHHHHHHHHHHHHHHCCCEEEEEecccccccceecc-ccCCcchhHHHHHHHH
Confidence            899999999999999877778999999999999999999999999999999999998753 3567777777766554



>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure