Citrus Sinensis ID: 030985

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MEACISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGLLETGSNF
cccccccccccHHHHHHHHccccccccccccccccccccccccccccccccEEEEEcccccEEccccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccHHHHHHHcccEEEEEEcc
cccEEEEcccHHHHHHHHccccccccccccccccccccccccccccHHHHHHEEEHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHcccccHHHHHHHHHHcccccEcHHHHcHHHHHHHHHcccEEEEEccc
meaciskcchgnsllkalkmkplrfnisnrlrcssmplhsgvgksVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKyglnvdsaDIKKGFRkafaapwpeklryegdgrpfWRLVVSEatgctnddyfeEVYEVSFYETYVLTFLIPKLSLQVKECSglletgsnf
meaciskcchgnsllkalkMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGfrkafaapwpeklryegdgrpFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGLLETGSNF
MEACISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSEATGCTNDDyfeevyevsfyetyvLTFLIPKLSLQVKECSGLLETGSNF
***CISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGL*******
********CHGNSLLKAL*******************************YDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPE**RYEGDGRPFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGLLETGSNF
MEACISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGLLETGSNF
**ACISKCCHGNSLLKALKMKP********************GKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGLLETGSNF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEACISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSEATGCTNDDYFEEVYEVSFYETYVLTFLIPKLSLQVKECSGLLETGSNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
Q9BSH5 251 Haloacid dehalogenase-lik yes no 0.255 0.171 0.441 0.0008
>sp|Q9BSH5|HDHD3_HUMAN Haloacid dehalogenase-like hydrolase domain-containing protein 3 OS=Homo sapiens GN=HDHD3 PE=1 SV=1 Back     alignment and function desciption
 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (69%)

Query: 56 DAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAA 98
          D   TLL+L  P+ E YA+ AR +GL V+ + +++GFR+A+ A
Sbjct: 13 DVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRA 55

Homo sapiens (taxid: 9606)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
449520403138 PREDICTED: haloacid dehalogenase-like hy 0.821 1.0 0.625 2e-44
224111272254 predicted protein [Populus trichocarpa] 0.761 0.503 0.711 3e-44
351725443233 uncharacterized protein LOC100306694 [Gl 0.714 0.515 0.656 3e-41
225425718258 PREDICTED: haloacid dehalogenase-like hy 0.773 0.503 0.617 4e-41
297844334254 hypothetical protein ARALYDRAFT_312429 [ 0.755 0.5 0.585 3e-38
255562824226 catalytic, putative [Ricinus communis] g 0.595 0.442 0.74 4e-38
30683719254 haloacid dehalogenase-like hydrolase dom 0.755 0.5 0.555 3e-37
357486883 278 Haloacid dehalogenase-like hydrolase dom 0.767 0.464 0.537 3e-36
28393346250 unknown protein [Arabidopsis thaliana] 0.726 0.488 0.550 1e-35
50897254238 At1g14310 [Arabidopsis thaliana] 0.559 0.394 0.691 3e-35
>gi|449520403|ref|XP_004167223.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/139 (62%), Positives = 105/139 (75%), Gaps = 1/139 (0%)

Query: 1   MEACISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGT 60
           ME  I +C HG SL +  K  PL    S   +   MP+ +  G S  +AYDA+LLDAGGT
Sbjct: 1   MELNILRCSHGRSLFRVFKPFPLSLKPSIS-KPHHMPIQNVGGGSFNRAYDALLLDAGGT 59

Query: 61  LLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSE 120
           LLQLA+PVEETYASI  KYGLN   A+IK+GFR+AF+ PWP+KLRY+GDGRPFW+LVVSE
Sbjct: 60  LLQLAKPVEETYASIGSKYGLNSTPAEIKQGFRRAFSGPWPQKLRYKGDGRPFWKLVVSE 119

Query: 121 ATGCTNDDYFEEVYEVSFY 139
           ATGC++D YFEEVY+V FY
Sbjct: 120 ATGCSDDSYFEEVYQVMFY 138

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224111272|ref|XP_002315800.1| predicted protein [Populus trichocarpa] gi|222864840|gb|EEF01971.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351725443|ref|NP_001235045.1| uncharacterized protein LOC100306694 [Glycine max] gi|255629299|gb|ACU14994.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225425718|ref|XP_002274402.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3 [Vitis vinifera] gi|296086384|emb|CBI31973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297844334|ref|XP_002890048.1| hypothetical protein ARALYDRAFT_312429 [Arabidopsis lyrata subsp. lyrata] gi|297335890|gb|EFH66307.1| hypothetical protein ARALYDRAFT_312429 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255562824|ref|XP_002522417.1| catalytic, putative [Ricinus communis] gi|223538302|gb|EEF39909.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|30683719|ref|NP_172883.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|7262672|gb|AAF43930.1|AC012188_7 Contains similarity to a hypothetical protein from Arabidopsis thaliana gb|AC005662.2 and contains a haloacid dehalogenase-like hydrolase PF|00702 domain. EST gb|F15167 comes from this gene [Arabidopsis thaliana] gi|332191021|gb|AEE29142.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357486883|ref|XP_003613729.1| Haloacid dehalogenase-like hydrolase domain-containing protein [Medicago truncatula] gi|355515064|gb|AES96687.1| Haloacid dehalogenase-like hydrolase domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|28393346|gb|AAO42097.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|50897254|gb|AAT85766.1| At1g14310 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
TAIR|locus:2012617254 AT1G14310 [Arabidopsis thalian 0.714 0.472 0.601 2.7e-36
TAIR|locus:2040272290 AT2G41250 [Arabidopsis thalian 0.458 0.265 0.423 1.1e-13
TAIR|locus:2012617 AT1G14310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 2.7e-36, P = 2.7e-36
 Identities = 77/128 (60%), Positives = 101/128 (78%)

Query:     1 MEACISKCCHGNSLLKALKMKPLRFNISNRLRCSSMPLHSGVGKSVKKAYDAVLLDAGGT 60
             MEAC+ +C  G+ L++A  M+PL    S+ LR SS    S  GK +K+AYD +LLDAGGT
Sbjct:     1 MEACL-RCSRGSYLIEA--MRPL----SSSLRPSSSVSFS-TGKPIKRAYDGLLLDAGGT 52

Query:    61 LLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGDGRPFWRLVVSE 120
             LLQL++PV ETYAS+ +KYGL    A+IK+GF++ F+APWPEKLRY+GDGRPFW+LVVSE
Sbjct:    53 LLQLSKPVHETYASLGQKYGLKTTPAEIKEGFKRVFSAPWPEKLRYQGDGRPFWKLVVSE 112

Query:   121 ATGCTNDD 128
             ATGC+++D
Sbjct:   113 ATGCSDND 120
GO:0003824 "catalytic activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0008152 "metabolic process" evidence=IEA
GO:0008967 "phosphoglycolate phosphatase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
TAIR|locus:2040272 AT2G41250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.6095.1
hypothetical protein (252 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
TIGR02252203 TIGR02252, DREG-2, REG-2-like, HAD superfamily (su 1e-18
>gnl|CDD|200170 TIGR02252, DREG-2, REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information 
 Score = 78.5 bits (194), Expect = 1e-18
 Identities = 32/95 (33%), Positives = 47/95 (49%), Gaps = 11/95 (11%)

Query: 52  AVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPE--KLRYEGD 109
            +  DA GTLL L EPV E Y  IARKYG+ V   ++++ FR+AF A         +   
Sbjct: 2   LITFDAVGTLLALKEPVGEVYCEIARKYGVEVSPDELEQAFRRAFKAMSEAFPNFGFSSG 61

Query: 110 GRP--FWRLVVSEATG-------CTNDDYFEEVYE 135
             P  +W+ +V +  G        + +  FEE+Y 
Sbjct: 62  LTPQQWWQKLVRDTFGRAGVPDPESFEKIFEELYS 96

This family of proteins includes uncharacterized sequences from eukaryotes, cyanobacteria and Leptospira as well as the DREG-2 protein from Drosophila melanogaster which has been identified as a rhythmically (diurnally) regulated gene. This family is a member of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The superfamily is defined by the presence of three short catalytic motifs. The subfamilies are defined based on the location and the observed or predicted fold of a so-called 'capping domain', or the absence of such a domain. This family is a member of subfamily 1A in which the cap domain consists of a predicted alpha helical bundle found in between the first and second catalytic motifs. A distinctive feature of this family is a conserved tandem pair of tryptophan residues in the cap domain. The most divergent sequences included within the scope of this model are from plants and have "FW" at this position instead. Most likely, these sequences, like the vast majority of HAD sequences, represent phosphatase enzymes. Length = 203

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.78
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.24
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 97.95
TIGR03351 220 PhnX-like phosphonatase-like hydrolase. This clade 97.78
PRK10826 222 2-deoxyglucose-6-phosphatase; Provisional 97.58
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 97.58
COG1011 229 Predicted hydrolase (HAD superfamily) [General fun 97.46
TIGR02254 224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 97.43
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 97.38
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.33
PRK10563221 6-phosphogluconate phosphatase; Provisional 97.33
PRK09449 224 dUMP phosphatase; Provisional 97.32
PRK10748238 flavin mononucleotide phosphatase; Provisional 97.23
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.21
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 97.19
PLN02940 382 riboflavin kinase 97.17
PRK13222 226 phosphoglycolate phosphatase; Provisional 97.08
COG0637 221 Predicted phosphatase/phosphohexomutase [General f 97.06
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.99
PLN03243 260 haloacid dehalogenase-like hydrolase; Provisional 96.92
PLN02770 248 haloacid dehalogenase-like hydrolase family protei 96.86
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 96.84
PRK13226229 phosphoglycolate phosphatase; Provisional 96.75
TIGR01422 253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 96.71
COG0546220 Gph Predicted phosphatases [General function predi 96.64
PRK13478 267 phosphonoacetaldehyde hydrolase; Provisional 96.57
PRK13223 272 phosphoglycolate phosphatase; Provisional 96.4
PRK13288214 pyrophosphatase PpaX; Provisional 96.26
PLN02575 381 haloacid dehalogenase-like hydrolase 96.05
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 96.04
PRK11587218 putative phosphatase; Provisional 95.88
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 95.83
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 95.76
PHA02597197 30.2 hypothetical protein; Provisional 95.67
PRK13225273 phosphoglycolate phosphatase; Provisional 95.48
PLN02779 286 haloacid dehalogenase-like hydrolase family protei 95.43
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 95.09
PRK14988224 GMP/IMP nucleotidase; Provisional 94.92
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 94.79
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 94.65
PLN02954224 phosphoserine phosphatase 94.56
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 94.43
PRK11133322 serB phosphoserine phosphatase; Provisional 93.68
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 93.07
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 92.98
PRK13582205 thrH phosphoserine phosphatase; Provisional 92.31
PRK01158 230 phosphoglycolate phosphatase; Provisional 92.18
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 91.95
PRK11590211 hypothetical protein; Provisional 90.93
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 90.06
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 89.85
COG0561 264 Cof Predicted hydrolases of the HAD superfamily [G 89.02
PTZ00174 247 phosphomannomutase; Provisional 88.94
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 88.85
PRK10513 270 sugar phosphate phosphatase; Provisional 88.53
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 87.17
PRK10976 266 putative hydrolase; Provisional 86.86
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 86.23
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 86.12
PLN02887 580 hydrolase family protein 85.86
TIGR01684301 viral_ppase viral phosphatase. These proteins also 85.38
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 83.61
PHA03398303 viral phosphatase superfamily protein; Provisional 82.99
PLN02423 245 phosphomannomutase 82.13
TIGR01482 225 SPP-subfamily Sucrose-phosphate phosphatase subfam 82.06
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 82.04
TIGR01457 249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 81.62
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 81.43
TIGR02463 221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 81.29
KOG3109 244 consensus Haloacid dehalogenase-like hydrolase [Ge 80.97
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 80.3
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 80.26
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information 
Probab=99.78  E-value=8e-19  Score=147.84  Aligned_cols=121  Identities=31%  Similarity=0.365  Sum_probs=98.5

Q ss_pred             cCCccEEEEecCCccccccCCHHHHHHHHHHHcCCCCCHHHHHHHHHHHhhccCCCCCCC---CC--CchhHHHHHHHHH
Q 030985           47 KKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRY---EG--DGRPFWRLVVSEA  121 (168)
Q Consensus        47 ~~~~rlVtFDA~GTLi~~r~pV~e~Ya~va~~~Gi~v~~e~l~~~F~~afk~~~p~~p~y---~g--~~~~WW~~vV~~t  121 (168)
                      .+++|+||||++|||+.++++++++|+++++++|++++++.++..|+++|+++++.+|+|   .|  ++++||..||.++
T Consensus         4 ~~~iravtfD~~~tLl~~~~~~~~~y~~i~~~~gl~~~~~~~~~~~~~~~~~~~~~~p~~~~~~g~l~~~~ww~~lv~~~   83 (237)
T KOG3085|consen    4 LMRIRAVTFDAGGTLLATLPPVMEVYCEIAEAYGLEYDDSLIETIFRKDFKKMSEKGPFFGLYSGELTLSQWWPKLVEST   83 (237)
T ss_pred             ccceEEEEEeCCCceeecCCccHHHHHHHHHHhCCCCCHHHHhHhhhHHHHhhcccCCcccccCCcccHHHHHHHHHHHH
Confidence            578999999999999999999999999999999999999999999999999987776666   56  8999999999999


Q ss_pred             hCCCchHHHHHHH--------HhhCCCCceee-ccHHHHHhhhhhcCCccccCCCC
Q 030985          122 TGCTNDDYFEEVY--------EVSFYETYVLT-FLIPKLSLQVKECSGLLETGSNF  168 (168)
Q Consensus       122 fg~~~~~l~~eLy--------~~F~se~w~ly-DViP~L~~~~k~~~g~~~~~~~~  168 (168)
                      |+..+.+..++++        +.|++.+|.+. ..+++|+++.++. =.|-+-|||
T Consensus        84 f~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~lq~lR~~g-~~l~iisN~  138 (237)
T KOG3085|consen   84 FGKAGIDYEEELLENFSFRLFSTFAPSAWKYLDGMQELLQKLRKKG-TILGIISNF  138 (237)
T ss_pred             hccccchhHHHHHhhhhhheeccccccCceeccHHHHHHHHHHhCC-eEEEEecCC
Confidence            9866544444444        44444699988 6669999876654 233444444

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3k1z_A 263 Crystal Structure Of Human Haloacid Dehalogenase-li 8e-05
>pdb|3K1Z|A Chain A, Crystal Structure Of Human Haloacid Dehalogenase-like Hydrolase Domain Containing 3 (hdhd3) Length = 263 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (69%)
Query: 56 DAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAA 98
          D   TLL+L  P+ E YA+ AR +GL V+ + +++GFR+A+ A
Sbjct: 7  DVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRA 49

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3k1z_A 263 Haloacid dehalogenase-like hydrolase domain-conta 7e-17
2zg6_A 220 Putative uncharacterized protein ST2620, probable 6e-13
2om6_A 235 Probable phosphoserine phosphatase; rossmann fold, 2e-07
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 Back     alignment and structure
 Score = 74.4 bits (183), Expect = 7e-17
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 8/98 (8%)

Query: 52  AVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAA---PWPEK-LRYE 107
            +  D   TLL+L  P+ E YA+ AR +GL V+ + +++GFR+A+ A    +P   L + 
Sbjct: 3   LLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHG 62

Query: 108 GDGRPFWRLVVSEA---TGCTNDDYFEEVYEVSFYETY 142
              R +W  VV +     G  +      + E   Y+ +
Sbjct: 63  LTSRQWWLDVVLQTFHLAGVQDAQAVAPIAE-QLYKDF 99
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
3k1z_A 263 Haloacid dehalogenase-like hydrolase domain-conta 99.17
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.46
3qxg_A 243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.33
3smv_A 240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.32
3qnm_A 240 Haloacid dehalogenase-like hydrolase; structural g 98.3
3umc_A 254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.15
3ed5_A 238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.13
3dv9_A 247 Beta-phosphoglucomutase; structural genomics, APC6 98.09
3kbb_A 216 Phosphorylated carbohydrates phosphatase TM_1254; 97.98
3umg_A 254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 97.97
4eek_A 259 Beta-phosphoglucomutase-related protein; hydrolase 97.92
3l5k_A 250 Protein GS1, haloacid dehalogenase-like hydrolase 97.9
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.88
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 97.78
3s6j_A 233 Hydrolase, haloacid dehalogenase-like family; stru 97.72
2gfh_A 260 Haloacid dehalogenase-like hydrolase domain conta; 97.7
2fdr_A 229 Conserved hypothetical protein; SAD, structural ge 97.67
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 97.53
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 97.49
2hsz_A 243 Novel predicted phosphatase; structural genomics, 97.47
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 97.41
3ddh_A 234 Putative haloacid dehalogenase-like family hydrol; 97.4
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.4
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.37
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 97.36
3nas_A 233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 97.28
2nyv_A 222 Pgpase, PGP, phosphoglycolate phosphatase; structu 97.18
4g9b_A 243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 97.18
2hoq_A 241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.18
3sd7_A240 Putative phosphatase; structural genomics, haloaci 97.17
3um9_A 230 Haloacid dehalogenase, type II; haloacid dehalogen 97.14
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 97.08
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 97.06
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 97.02
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 97.01
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 96.75
2hi0_A 240 Putative phosphoglycolate phosphatase; YP_619066.1 96.72
4gib_A 250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 96.7
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 96.63
3umb_A 233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 96.62
2pke_A 251 Haloacid delahogenase-like family hydrolase; NP_63 96.62
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 96.58
3fvv_A 232 Uncharacterized protein; unknown function, structu 96.29
1te2_A226 Putative phosphatase; structural genomics, phospha 96.25
2om6_A 235 Probable phosphoserine phosphatase; rossmann fold, 96.21
3mc1_A 226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 96.17
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 96.15
2qlt_A 275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 96.15
3skx_A 280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 96.14
2hcf_A 234 Hydrolase, haloacid dehalogenase-like family; NP_6 96.06
3nuq_A 282 Protein SSM1, putative nucleotide phosphatase; sup 95.85
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 95.72
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 95.72
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 95.65
2p11_A 231 Hypothetical protein; putative haloacid dehalogena 95.62
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 95.57
3u26_A 234 PF00702 domain protein; structural genomics, PSI-b 95.55
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.51
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 95.44
1qq5_A 253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 95.19
2no4_A 240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 94.89
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 94.74
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 94.7
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 94.69
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 94.5
1zrn_A 232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 94.21
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 94.18
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 94.12
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 94.05
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 93.89
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 93.81
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 93.72
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 93.54
3a1c_A 287 Probable copper-exporting P-type ATPase A; ATP-bin 93.42
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 93.32
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 93.2
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 93.17
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 93.05
2fue_A 262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 93.0
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 92.67
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 92.55
1wr8_A 231 Phosphoglycolate phosphatase; alpha / beta core do 92.54
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 92.47
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 92.39
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 92.33
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 92.29
3dao_A 283 Putative phosphatse; structural genomics, joint ce 92.01
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 91.88
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 91.83
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 91.59
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 91.52
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 91.5
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 91.49
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 91.35
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 91.06
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 90.71
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 90.44
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 89.93
3f9r_A 246 Phosphomannomutase; trypanosome glycobiology struc 89.23
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 89.2
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 89.18
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 88.32
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 88.17
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 87.72
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 87.23
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 87.11
3mmz_A176 Putative HAD family hydrolase; structural genomics 86.67
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 86.26
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 86.23
1yns_A 261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 86.15
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 85.93
3n28_A 335 Phosphoserine phosphatase; HAD family hydrolase, s 85.42
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 84.92
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 84.61
3mn1_A189 Probable YRBI family phosphatase; structural genom 84.49
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 84.24
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 84.22
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 84.11
3ib6_A189 Uncharacterized protein; structural genomics, unkn 84.01
2zos_A 249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 83.15
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 82.73
1u02_A 239 Trehalose-6-phosphate phosphatase related protein; 81.79
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 80.6
1zjj_A 263 Hypothetical protein PH1952; alpha/beta hydrolase 80.58
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 80.51
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
Probab=99.17  E-value=6.7e-11  Score=94.86  Aligned_cols=107  Identities=27%  Similarity=0.363  Sum_probs=90.6

Q ss_pred             ccEEEEecCCccccccCCHHHHHHHHHHHcCCCCCHHHHHHHHHHHhhccCCCCCCC---CC-CchhHHHHHHHHHhC--
Q 030985           50 YDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRY---EG-DGRPFWRLVVSEATG--  123 (168)
Q Consensus        50 ~rlVtFDA~GTLi~~r~pV~e~Ya~va~~~Gi~v~~e~l~~~F~~afk~~~p~~p~y---~g-~~~~WW~~vV~~tfg--  123 (168)
                      +|+|+||++|||+....++.+.+.++++++|+.++++.+...|..+++.....++++   .| ..++||.+++.+.+.  
T Consensus         1 ik~iiFDlDGTL~d~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~   80 (263)
T 3k1z_A            1 MRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLA   80 (263)
T ss_dssp             CCEEEECCBTTTEEESSCHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHSTGGGGGGTCCHHHHHHHHHHHHHHHT
T ss_pred             CcEEEEcCCCceeCCCCCHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhccccccccCCCHHHHHHHHHHHHHHHc
Confidence            589999999999999999999999999999999999999999999999877667766   34 688999999988874  


Q ss_pred             -CCc----hHHHHHHHHhhCC-CCceee-ccHHHHHhhhh
Q 030985          124 -CTN----DDYFEEVYEVSFY-ETYVLT-FLIPKLSLQVK  156 (168)
Q Consensus       124 -~~~----~~l~~eLy~~F~s-e~w~ly-DViP~L~~~~k  156 (168)
                       ..+    .+.++++|..|.. ..+.++ ++.++|+.+.+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~  120 (263)
T 3k1z_A           81 GVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRT  120 (263)
T ss_dssp             TCCCHHHHHHHHHHHHHHTTSGGGEEECTTHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHhcCcccceECcCHHHHHHHHHh
Confidence             323    2567888888877 678999 99999998543
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d2hdoa1207 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { 9e-04
d2fdra1 222 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { 0.001
d2hsza1 224 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G 0.001
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphoglycolate phosphatase
species: Lactobacillus plantarum [TaxId: 1590]

 Score = 36.0 bits (81), Expect = 9e-04
 Identities = 14/66 (21%), Positives = 19/66 (28%)

Query: 50  YDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVDSADIKKGFRKAFAAPWPEKLRYEGD 109
           Y A++ D  GTL             +   YG     A  +K F  A      E      +
Sbjct: 3   YQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTFPMAAEQAMTELGIAASE 62

Query: 110 GRPFWR 115
              F  
Sbjct: 63  FDHFQA 68
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d2gfha1 247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.21
d1x42a1 230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 97.86
d2hdoa1 207 Phosphoglycolate phosphatase {Lactobacillus planta 97.79
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 97.76
d2fdra1 222 Hypothetical protein Atu0790 {Agrobacterium tumefa 97.53
d1o08a_ 221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 97.45
d1te2a_ 218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 97.39
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.27
d1swva_ 257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 97.18
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.13
d2hsza1 224 Phosphoglycolate phosphatase Gph {Haemophilus somn 97.12
d1zrna_ 220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 96.81
d1qq5a_ 245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 96.7
d2hcfa1 228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.54
d1zs9a1 253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 96.05
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 95.8
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 95.63
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 95.55
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 95.45
d2amya1 243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 94.32
d1cr6a1 222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 94.15
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 94.08
d1wr8a_ 230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 94.03
d1yv9a1 253 Putative hydrolase EF1188 {Enterococcus faecalis [ 93.7
d1zd3a1 225 Epoxide hydrolase, N-terminal domain {Human (Homo 93.68
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 93.51
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 93.36
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 92.53
d1wzca1 243 Putative mannosyl-3-phosphoglycerate phosphatase M 91.88
d2g80a1 225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 91.56
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 91.48
d2rbka1 260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 91.42
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 90.07
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 89.72
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 89.72
d2fuea1 244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 89.09
d1l6ra_ 225 Phosphoglycolate phosphatase, PGPase {Archaeon The 87.87
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 86.34
d2feaa1 226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 85.12
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 85.05
d1u02a_ 229 Trehalose-6-phosphate phosphatase related protein 83.55
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: N-acylneuraminate-9-phosphatase NANP
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.21  E-value=3.8e-07  Score=69.64  Aligned_cols=113  Identities=16%  Similarity=0.148  Sum_probs=68.6

Q ss_pred             cCCccEEEEecCCccccccCCHHHHHHHHHHHcCCCCC----HHHHHHHHHHHhhccCCCCCCCC----CCchhHHHHHH
Q 030985           47 KKAYDAVLLDAGGTLLQLAEPVEETYASIARKYGLNVD----SADIKKGFRKAFAAPWPEKLRYE----GDGRPFWRLVV  118 (168)
Q Consensus        47 ~~~~rlVtFDA~GTLi~~r~pV~e~Ya~va~~~Gi~v~----~e~l~~~F~~afk~~~p~~p~y~----g~~~~WW~~vV  118 (168)
                      ..+||+|+||++|||+.......+.+.++.+.++-...    ...+...+......  .....+.    ......|.+.+
T Consensus         3 m~~IKaviFD~dGTL~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~   80 (247)
T d2gfha1           3 LSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSK--ECFHPYSTCITDVRTSHWEEAI   80 (247)
T ss_dssp             CCCCCEEEECCBTTTBCHHHHHHHHHHHHHHHHHHTTCCCTHHHHHHHHHHHHHHT--CCCC----CHHHHHHHHHHHHH
T ss_pred             CCCCcEEEEcCCCCcCcChHHHHHHHHHHHHHhccccCcHHHHHHHHHHHHHHHhh--hhhhhhhhhhhHHHHHHHHHHH
Confidence            46799999999999998776666666666655444322    22233333222222  1122332    13445666666


Q ss_pred             HHHhC-CCchHHHHHHHHhhCC---CCceee-ccHHHHHhhhhhcCCccc
Q 030985          119 SEATG-CTNDDYFEEVYEVSFY---ETYVLT-FLIPKLSLQVKECSGLLE  163 (168)
Q Consensus       119 ~~tfg-~~~~~l~~eLy~~F~s---e~w~ly-DViP~L~~~~k~~~g~~~  163 (168)
                      .+..+ ...+.+.++++..|..   ..+.++ ++.++|+.+ |+ ++.+-
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~~-~~~l~  128 (247)
T d2gfha1          81 QETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTEL-RK-EVRLL  128 (247)
T ss_dssp             HHHHCSSCCHHHHHHHHHHHHHHHHHTCCCCHHHHHHHHHH-HT-TSEEE
T ss_pred             HHhccccchHHHHHHHHHHHHHhhhccCccCccHHHHHHHh-hc-ccceE
Confidence            66665 3446788888877764   567888 999999985 44 45443
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure