Citrus Sinensis ID: 031109

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----

MACVSSSSFLLLKQPTFSPRSKTSHHFSTRRRVVVVRAEAMSTTTIEKLGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKFG

ccccccccccccccccccccccccccccccccEEEHHHHcccccccccEEEEEEEcccccccccccccccccccccccccEEEccEEEcccccEEEEEEEccccEEEEEEccEEEEEEEEcEEEEEEcccccEEEEccccEEEEccccEEEEEEcEEEEEEEEcc

ccHHHHHHHHHcccccccccccccccccccccEEEEccccccccHHcHcEEEEEccccHHHHHHccccccccccccccccEEEEEEEEcccccEEEEEEEcccccccEEEcccEEEEEEEEEEEEEccccccEEEEccccEEEEccccEEEEEEEcccEEEEEcc

macvssssflllkqptfsprsktshhfstrRRVVVVRAEAMSTTTIEKLGVkiernppeskltelgvrqwpkhchtggqprvlpskkTHLEAIWRILrwgcppskfpwtysdketcYLLEgkvkvypdgsnegveigagdlvvfpkgmsctwdvsvgvdkhykfg

macvssssflllkqptfsprsktshhfstrrrvvvvraeamstttieklgvkiernppesKLTELGVRQWPKHchtggqprvlpskKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMsctwdvsvgvdkhykfg

MACVSSSSFLLLKQPTFSPRSKTSHHFSTrrrvvvvrAEAMSTTTIEKLGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKFG

******************************RRVVVVRAEAMSTTTIEKLGVK************LGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHY***

**********************************************************E**LTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKFG

********FLLLKQPT*************RRRVVVVRAEAMSTTTIEKLGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKFG

************KQPTFSPR**********RRVVVVRAEAMSTTTIEKLGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKFG

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MACVSSSSFLLLKQPTFSPRSKTSHHFSTRRRVVVVRAEAMSTTTIEKLGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKFG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		165
351723041		142	uncharacterized protein LOC100527470 [Gl	0.660	0.767	0.688	2e-44
351722508		142	uncharacterized protein LOC100499968 [Gl	0.654	0.760	0.686	1e-43
449447523		138	PREDICTED: uncharacterized protein LOC10	0.769	0.920	0.591	1e-42
118487088		162	unknown [Populus trichocarpa]	0.836	0.851	0.529	7e-42
388499950		147	unknown [Lotus japonicus] gi\|388513579\|g	0.654	0.734	0.659	1e-41
21553516		136	unknown [Arabidopsis thaliana]	0.690	0.838	0.589	1e-40
225459910		163	PREDICTED: uncharacterized protein LOC10	0.709	0.717	0.589	5e-40
255557833		106	conserved hypothetical protein [Ricinus	0.606	0.943	0.682	9e-40
357504111		132	hypothetical protein MTR_7g034750 [Medic	0.775	0.969	0.582	2e-39
297809241		136	hypothetical protein ARALYDRAFT_489873 [	0.696	0.845	0.587	2e-39

>gi\|351723041\|ref\|NP_001236497.1\| uncharacterized protein LOC100527470 [Glycine max] gi\|255632424\|gb\|ACU16562.1\| unknown [Glycine max]	Back alignment and taxonomy information

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 99/138 (71%), Gaps = 29/138 (21%)

Query: 29  TRRRV--VVVRAEAMSTTTIEKLGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSK 86
           TRRRV     RAE+M TT IEKLG+KIERNPPESKLT+LGVRQWPK              
Sbjct: 31  TRRRVHLATTRAESM-TTVIEKLGIKIERNPPESKLTQLGVRQWPK-------------- 75

Query: 87  KTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPK 146
                       WGCPPSKFPWTY  KETCYLLEGKVKV+P GSNE VEI AGDLVVFPK
Sbjct: 76  ------------WGCPPSKFPWTYEAKETCYLLEGKVKVFPSGSNESVEIAAGDLVVFPK 123

Query: 147 GMSCTWDVSVGVDKHYKF 164
           GMSCTWDVSVGVDKHY F
Sbjct: 124 GMSCTWDVSVGVDKHYNF 141

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|351722508\|ref\|NP_001234944.1\| uncharacterized protein LOC100499968 [Glycine max] gi\|255628091\|gb\|ACU14390.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|449447523\|ref\|XP_004141517.1\| PREDICTED: uncharacterized protein LOC101218376 [Cucumis sativus] gi\|449510701\|ref\|XP_004163737.1\| PREDICTED: uncharacterized protein LOC101228048 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|118487088\|gb\|ABK95374.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|388499950\|gb\|AFK38041.1\| unknown [Lotus japonicus] gi\|388513579\|gb\|AFK44851.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|21553516\|gb\|AAM62609.1\| unknown [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|225459910\|ref\|XP_002263772.1\| PREDICTED: uncharacterized protein LOC100244771 [Vitis vinifera] gi\|297734730\|emb\|CBI16964.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255557833\|ref\|XP_002519946.1\| conserved hypothetical protein [Ricinus communis] gi\|223540992\|gb\|EEF42550.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|357504111\|ref\|XP_003622344.1\| hypothetical protein MTR_7g034750 [Medicago truncatula] gi\|355497359\|gb\|AES78562.1\| hypothetical protein MTR_7g034750 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297809241\|ref\|XP_002872504.1\| hypothetical protein ARALYDRAFT_489873 [Arabidopsis lyrata subsp. lyrata] gi\|297318341\|gb\|EFH48763.1\| hypothetical protein ARALYDRAFT_489873 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		165
TAIR\|locus:2122734		134	AT4G10300 "AT4G10300" [Arabido	0.472	0.582	0.777	6.9e-31
TAIR\|locus:2103095		96	AT3G04300 "AT3G04300" [Arabido	0.406	0.697	0.641	1.3e-22
UNIPROTKB\|Q60B25		91	MCA0659 "Putative uncharacteri	0.4	0.725	0.656	1e-20
TAIR\|locus:505006531		107	AT4G28703 "AT4G28703" [Arabido	0.406	0.626	0.552	2.2e-18
TAIR\|locus:2122809		140	AT4G10280 "AT4G10280" [Arabido	0.393	0.464	0.5	1.3e-13
TAIR\|locus:2045532		139	PTAC18 "AT2G32180" [Arabidopsi	0.309	0.366	0.358	2.3e-10
TAIR\|locus:2046412		139	AT2G32650 "AT2G32650" [Arabido	0.309	0.366	0.358	2.3e-10
TAIR\|locus:2122819		120	AT4G10290 "AT4G10290" [Arabido	0.406	0.558	0.458	5.2e-10
UNIPROTKB\|Q88BC6		121	PSPTO_0091 "Uncharacterized pr	0.381	0.520	0.312	0.00039
UNIPROTKB\|Q5LN86		113	SPO3326 "Uncharacterized prote	0.381	0.557	0.312	0.00052

TAIR\|locus:2122734 AT4G10300 "AT4G10300" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 340 (124.7 bits), Expect = 6.9e-31, P = 6.9e-31
 Identities = 63/81 (77%), Positives = 68/81 (83%)

Query:    85 SKKTHLEA-IWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVV 143
             SK T L    W   +WGCPPSKFPWTYS KETCYLL+GKVKVYP+GS+EGVEI AGD VV
Sbjct:    55 SKLTQLGVRSWP--KWGCPPSKFPWTYSAKETCYLLQGKVKVYPNGSDEGVEIEAGDFVV 112

Query:   144 FPKGMSCTWDVSVGVDKHYKF 164
             FPKGMSCTWDVSV VDKHY+F
Sbjct:   113 FPKGMSCTWDVSVAVDKHYQF 133

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0009507 "chloroplast" evidence=IDA

GO:0000023 "maltose metabolic process" evidence=RCA

GO:0019252 "starch biosynthetic process" evidence=RCA

GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA

TAIR\|locus:2103095 AT3G04300 "AT3G04300" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q60B25 MCA0659 "Putative uncharacterized protein" [Methylococcus capsulatus str. Bath (taxid:243233)]	Back alignment and assigned GO terms

TAIR\|locus:505006531 AT4G28703 "AT4G28703" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122809 AT4G10280 "AT4G10280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2045532 PTAC18 "AT2G32180" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2046412 AT2G32650 "AT2G32650" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122819 AT4G10290 "AT4G10290" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q88BC6 PSPTO_0091 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5LN86 SPO3326 "Uncharacterized protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00031959001	SubName- Full=Chromosome chr18 scaffold_61, whole genome shotgun sequence; (163 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		165
pfam05899		74	pfam05899, Cupin_3, Protein of unknown function (D	9e-27
COG3450		116	COG3450, COG3450, Predicted enzyme of the cupin su	2e-19
COG4766		176	COG4766, EutQ, Ethanolamine utilization protein [A	2e-05
pfam06249		152	pfam06249, EutQ, Ethanolamine utilisation protein	0.002
pfam07883		70	pfam07883, Cupin_2, Cupin domain	0.004

>gnl\|CDD\|147835 pfam05899, Cupin_3, Protein of unknown function (DUF861)	Back alignment and domain information

 Score = 95.8 bits (239), Expect = 9e-27
 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 99  WGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGV 158
           W C P KF WTY + E CY+L G+V V P+G    VE+ AGDLVVFP G + TW+V   V
Sbjct: 12  WECTPGKFRWTYEEDEFCYILSGEVTVTPEGGET-VELRAGDLVVFPAGFTGTWEVLETV 70

Query: 159 DKHY 162
            KHY
Sbjct: 71  RKHY 74

This family consists of several proteins which seem to be specific to plants and bacteria. The function of this family is unknown. Length = 74

>gnl\|CDD\|225981 COG3450, COG3450, Predicted enzyme of the cupin superfamily [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|227107 COG4766, EutQ, Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|114941 pfam06249, EutQ, Ethanolamine utilisation protein EutQ	Back alignment and domain information

>gnl\|CDD\|219618 pfam07883, Cupin_2, Cupin domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		165
COG3450		116	Predicted enzyme of the cupin superfamily [General	99.97
PF05899		74	Cupin_3: Protein of unknown function (DUF861); Int	99.93
PF06249		152	EutQ: Ethanolamine utilisation protein EutQ; Inter	99.48
COG4766		176	EutQ Ethanolamine utilization protein [Amino acid	99.4
PRK15457		233	ethanolamine utilization protein EutQ; Provisional	99.3
PF07883		71	Cupin_2: Cupin domain; InterPro: IPR013096 This fa	98.6
COG3837		161	Uncharacterized conserved protein, contains double	98.41
PRK13290		125	ectC L-ectoine synthase; Reviewed	98.34
COG0662		127	{ManC} Mannose-6-phosphate isomerase [Carbohydrate	98.32
TIGR03037		159	anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase	98.3
PRK13264		177	3-hydroxyanthranilate 3,4-dioxygenase; Provisional	98.24
COG1917		131	Uncharacterized conserved protein, contains double	98.13
PRK09943		185	DNA-binding transcriptional repressor PuuR; Provis	97.94
PF00190		144	Cupin_1: Cupin; InterPro: IPR006045 This family re	97.92
smart00835		146	Cupin_1 Cupin. This family represents the conserve	97.89
PF02311		136	AraC_binding: AraC-like ligand binding domain; Int	97.86
PRK11171		266	hypothetical protein; Provisional	97.76
TIGR03404		367	bicupin_oxalic bicupin, oxalate decarboxylase fami	97.75
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	97.69
TIGR03214		260	ura-cupin putative allantoin catabolism protein. T	97.59
PRK10579		94	hypothetical protein; Provisional	97.57
PF06865		94	DUF1255: Protein of unknown function (DUF1255); In	97.56
TIGR03404		367	bicupin_oxalic bicupin, oxalate decarboxylase fami	97.42
PRK11171		266	hypothetical protein; Provisional	97.4
PRK04190		191	glucose-6-phosphate isomerase; Provisional	97.38
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	97.35
COG4297		163	Uncharacterized protein containing double-stranded	97.24
PF04209		424	HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR	97.22
PF12973		91	Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_	97.2
PF01050		151	MannoseP_isomer: Mannose-6-phosphate isomerase; In	97.04
PF06052		151	3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte	96.88
PRK10371		302	DNA-binding transcriptional regulator MelR; Provis	96.88
PRK10296		278	DNA-binding transcriptional regulator ChbR; Provis	96.88
TIGR03214		260	ura-cupin putative allantoin catabolism protein. T	96.86
PF12852		186	Cupin_6: Cupin	96.85
PF03079		157	ARD: ARD/ARD' family; InterPro: IPR004313 The two	96.71
PRK13500		312	transcriptional activator RhaR; Provisional	96.63
PRK05341		438	homogentisate 1,2-dioxygenase; Provisional	96.62
PRK13502		282	transcriptional activator RhaR; Provisional	96.52
PLN02658		435	homogentisate 1,2-dioxygenase	96.49
PF11699		85	CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B.	96.48
TIGR02297		287	HpaA 4-hydroxyphenylacetate catabolism regulatory	96.42
TIGR01015		429	hmgA homogentisate 1,2-dioxygenase. Missing in hum	96.29
PRK13501		290	transcriptional activator RhaR; Provisional	96.19
PRK13503		278	transcriptional activator RhaS; Provisional	96.12
COG2140		209	Thermophilic glucose-6-phosphate isomerase and rel	96.01
COG3123		94	Uncharacterized protein conserved in bacteria [Fun	95.94
PLN00212		493	glutelin; Provisional	95.66
COG3257		264	GlxB Uncharacterized protein, possibly involved in	95.36
TIGR02272		335	gentisate_1_2 gentisate 1,2-dioxygenase. This fami	95.24
TIGR02451		215	anti_sig_ChrR anti-sigma factor, putative, ChrR fa	94.98
PLN00212		493	glutelin; Provisional	94.75
TIGR00218		302	manA mannose-6-phosphate isomerase, class I. The n	94.73
PLN02288		394	mannose-6-phosphate isomerase	94.72
KOG2107		179	consensus Uncharacterized conserved protein, conta	94.62
COG4101		142	Predicted mannose-6-phosphate isomerase [Carbohydr	94.59
PRK10572		290	DNA-binding transcriptional regulator AraC; Provis	94.2
COG3508		427	HmgA Homogentisate 1,2-dioxygenase [Secondary meta	93.76
PRK15131		389	mannose-6-phosphate isomerase; Provisional	93.74
PF06560		182	GPI: Glucose-6-phosphate isomerase (GPI); InterPro	93.71
PF06339		126	Ectoine_synth: Ectoine synthase; InterPro: IPR0104	93.36
PRK09685		302	DNA-binding transcriptional activator FeaR; Provis	93.13
PF11142		63	DUF2917: Protein of unknown function (DUF2917); In	92.35
COG1791		181	Uncharacterized conserved protein, contains double	91.97
KOG2757		411	consensus Mannose-6-phosphate isomerase [Carbohydr	90.26
PF14525		172	AraC_binding_2: AraC-binding-like domain	90.22
PF04622		216	ERG2_Sigma1R: ERG2 and Sigma1 receptor like protei	89.89
TIGR02272		335	gentisate_1_2 gentisate 1,2-dioxygenase. This fami	89.26
PF05523		131	FdtA: WxcM-like, C-terminal ; InterPro: IPR008894	89.23
PRK15186		291	AraC family transcriptional regulator; Provisional	88.65
PF02678		107	Pirin: Pirin; InterPro: IPR003829 This entry repre	86.6
COG1482		312	ManA Phosphomannose isomerase [Carbohydrate transp	86.23
PF05726		104	Pirin_C: Pirin C-terminal cupin domain; InterPro:	85.13
PF06719		155	AraC_N: AraC-type transcriptional regulator N-term	83.8
PF02041		167	Auxin_BP: Auxin binding protein; InterPro: IPR0005	83.11
PF13621		251	Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU	81.5
PF14499		251	DUF4437: Domain of unknown function (DUF4437); PDB	80.29

>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]	Back alignment and domain information

Probab=99.97  E-value=2.7e-31  Score=202.59  Aligned_cols=89  Identities=40%  Similarity=0.661  Sum_probs=86.5

Q ss_pred             ccCCCCeeecccccccccc-eeeEEEecCCceeeeeCCCceEEEEEEcEEEEEeCCCceeEEEcCCcEEEEcCCCEEEEE
Q 031109           75 HTGGQPRVLPSKKTHLEAI-WRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWD  153 (165)
Q Consensus        75 ~~~G~P~~~~~~~~~~~~~-~~~GiWe~~pg~f~w~y~~dE~~yVLEG~vtVt~dgG~e~v~i~AGDlv~fPkG~~~tW~  153 (165)
                      .++|+|+...++++..+|+ ..+|+|+|+||+|++.|+.+|+||||+|+++||+|+| ++++++|||+++||+|++|+|+
T Consensus        25 ~i~G~p~~~t~~~~~~~dg~~~~GiWe~TpG~~r~~y~~~E~chil~G~v~~T~d~G-e~v~~~aGD~~~~~~G~~g~W~  103 (116)
T COG3450          25 LILGDPSAATWNLYGAPDGQVETGIWECTPGKFRVTYDEDEFCHILEGRVEVTPDGG-EPVEVRAGDSFVFPAGFKGTWE  103 (116)
T ss_pred             cccCCccceehheeeCCCCCeeEeEEEecCccceEEcccceEEEEEeeEEEEECCCC-eEEEEcCCCEEEECCCCeEEEE
Confidence            4999999999999999987 8999999999999999999999999999999999999 7999999999999999999999


Q ss_pred             EceeeEEEEEe
Q 031109          154 VSVGVDKHYKF  164 (165)
Q Consensus       154 V~e~vrK~Y~~  164 (165)
                      |.+++||||+|
T Consensus       104 V~EtvrK~Yv~  114 (116)
T COG3450         104 VLETVRKHYVI  114 (116)
T ss_pred             EeeeeEEEEEE
Confidence            99999999987

>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown	Back alignment and domain information

>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine	Back alignment and domain information

>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>PRK15457 ethanolamine utilization protein EutQ; Provisional	Back alignment and domain information

>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel)	Back alignment and domain information

>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>PRK13290 ectC L-ectoine synthase; Reviewed	Back alignment and domain information

>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase	Back alignment and domain information

>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional	Back alignment and domain information

>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional	Back alignment and domain information

>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel)	Back alignment and domain information

>smart00835 Cupin_1 Cupin	Back alignment and domain information

>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC	Back alignment and domain information

>PRK11171 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family	Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>TIGR03214 ura-cupin putative allantoin catabolism protein	Back alignment and domain information

>PRK10579 hypothetical protein; Provisional	Back alignment and domain information

>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length	Back alignment and domain information

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family	Back alignment and domain information

>PRK11171 hypothetical protein; Provisional	Back alignment and domain information

>PRK04190 glucose-6-phosphate isomerase; Provisional	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown]	Back alignment and domain information

>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism	Back alignment and domain information

>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A	Back alignment and domain information

>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5	Back alignment and domain information

>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1	Back alignment and domain information

>PRK10371 DNA-binding transcriptional regulator MelR; Provisional	Back alignment and domain information

>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional	Back alignment and domain information

>TIGR03214 ura-cupin putative allantoin catabolism protein	Back alignment and domain information

>PF12852 Cupin_6: Cupin	Back alignment and domain information

>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ []	Back alignment and domain information

>PRK13500 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PRK05341 homogentisate 1,2-dioxygenase; Provisional	Back alignment and domain information

>PRK13502 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PLN02658 homogentisate 1,2-dioxygenase	Back alignment and domain information

>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B	Back alignment and domain information

>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA	Back alignment and domain information

>TIGR01015 hmgA homogentisate 1,2-dioxygenase	Back alignment and domain information

>PRK13501 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PRK13503 transcriptional activator RhaS; Provisional	Back alignment and domain information

>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]	Back alignment and domain information

>COG3123 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PLN00212 glutelin; Provisional	Back alignment and domain information

>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only]	Back alignment and domain information

>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase	Back alignment and domain information

>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family	Back alignment and domain information

>PLN00212 glutelin; Provisional	Back alignment and domain information

>TIGR00218 manA mannose-6-phosphate isomerase, class I	Back alignment and domain information

>PLN02288 mannose-6-phosphate isomerase	Back alignment and domain information

>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10572 DNA-binding transcriptional regulator AraC; Provisional	Back alignment and domain information

>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK15131 mannose-6-phosphate isomerase; Provisional	Back alignment and domain information

>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5	Back alignment and domain information

>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins	Back alignment and domain information

>PRK09685 DNA-binding transcriptional activator FeaR; Provisional	Back alignment and domain information

>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria	Back alignment and domain information

>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF14525 AraC_binding_2: AraC-binding-like domain	Back alignment and domain information

>PF04622 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protein; InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor	Back alignment and domain information

>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase	Back alignment and domain information

>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase []	Back alignment and domain information

>PRK15186 AraC family transcriptional regulator; Provisional	Back alignment and domain information

>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>PF06719 AraC_N: AraC-type transcriptional regulator N-terminus; InterPro: IPR009594 This entry represents the N terminus of bacterial ARAC-type transcriptional regulators	Back alignment and domain information

>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER)	Back alignment and domain information

>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A	Back alignment and domain information

>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		165
1lkn_A		89	Solution Nmr Structure Of Protein Tm_1112 From Ther		3e-12
1o5u_A		101	Crystal Structure Of A Duf861 Family Protein (Tm111		3e-12

>pdb|1LKN|A Chain A, Solution Nmr Structure Of Protein Tm_1112 From Thermotoga Maritima. Ontario Centre For Structural Proteomics Target Tm1112_1_89; Northeast Structural Genomics Consortium Target Vt74. Length = 89

Back alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 45/116 (38%), Positives = 54/116 (46%), Gaps = 28/116 (24%) Query: 49 LGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPW 108 + VKIE+ PE KL EL V +WP W S+F W Sbjct: 1 MEVKIEKPTPE-KLKELSVEKWP--------------------------IWEKEVSEFDW 33 Query: 109 TYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKF 164 Y ETCY+LEGKV+V + + V I GDLV FPKG+ C W V V KHY Sbjct: 34 YYDTNETCYILEGKVEVTTEDGKKYV-IEKGDLVTFPKGLRCRWKVLEPVRKHYNL 88

PyMOL of 1lkn

>pdb|1O5U|A Chain A, Crystal Structure Of A Duf861 Family Protein (Tm1112) From Thermotoga Maritima At 1.83 A Resolution Length = 101

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		165
1o5u_A		101	Novel thermotoga maritima enzyme TM1112; cupin, st	6e-29
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	9e-22
3bcw_A		123	Uncharacterized protein; structural genomics, join	1e-21
2pyt_A		133	Ethanolamine utilization protein EUTQ; structural	2e-15
4axo_A		151	EUTQ, ethanolamine utilization protein; structural	1e-14
3lwc_A		119	Uncharacterized protein; structural genomics, unkn	2e-11
3es4_A		116	Uncharacterized protein DUF861 with A RMLC-like C;	2e-04

>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Length = 101	Back alignment and structure

 Score =  101 bits (253), Expect = 6e-29
 Identities = 43/116 (37%), Positives = 52/116 (44%), Gaps = 28/116 (24%)

Query: 49  LGVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPW 108
           + VKIE+ P   KL EL V +WP                           W    S+F W
Sbjct: 13  MEVKIEK-PTPEKLKELSVEKWPI--------------------------WEKEVSEFDW 45

Query: 109 TYSDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKF 164
            Y   ETCY+LEGKV+V  +   +   I  GDLV FPKG+ C W V   V KHY  
Sbjct: 46  YYDTNETCYILEGKVEVTTEDGKK-YVIEKGDLVTFPKGLRCRWKVLEPVRKHYNL 100

PyMOL of 1o5u

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Length = 238	Back alignment and structure

>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Length = 123	Back alignment and structure

>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Length = 133	Back alignment and structure

>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Length = 151	Back alignment and structure

>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Length = 119	Back alignment and structure

>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Length = 116	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		165
3es4_A		116	Uncharacterized protein DUF861 with A RMLC-like C;	99.95
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	99.94
3bcw_A		123	Uncharacterized protein; structural genomics, join	99.89
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	99.73
2pyt_A		133	Ethanolamine utilization protein EUTQ; structural	99.72
1o5u_A		101	Novel thermotoga maritima enzyme TM1112; cupin, st	99.69
4axo_A		151	EUTQ, ethanolamine utilization protein; structural	99.64
3lwc_A		119	Uncharacterized protein; structural genomics, unkn	99.39
3h8u_A		125	Uncharacterized conserved protein with double-STR	98.58
2i45_A		107	Hypothetical protein; neisseria meningitidis cupin	98.57
1yhf_A		115	Hypothetical protein SPY1581; structural genomics,	98.57
3fjs_A		114	Uncharacterized protein with RMLC-like cupin fold;	98.57
2pfw_A		116	Cupin 2, conserved barrel domain protein; cupin do	98.54
1v70_A		105	Probable antibiotics synthesis protein; structural	98.52
2ozj_A		114	Cupin 2, conserved barrel; cupin superfamily prote	98.48
2q30_A		110	Uncharacterized protein; double-stranded beta-heli	98.47
2fqp_A		97	Hypothetical protein BP2299; double-stranded beta-	98.45
3d82_A		102	Cupin 2, conserved barrel domain protein; structur	98.44
4e2g_A		126	Cupin 2 conserved barrel domain protein; MCSG, PSI	98.43
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	98.42
2opk_A		112	Hypothetical protein; putative mannose-6-phosphate	98.39
3l2h_A		162	Putative sugar phosphate isomerase; AFE_0303, stru	98.38
2b8m_A		117	Hypothetical protein MJ0764; structural genomics,	98.38
2oyz_A		94	UPF0345 protein VPA0057; unknown function, structu	98.35
3i7d_A		163	Sugar phosphate isomerase; YP_168127.1, structural	98.34
2gu9_A		113	Tetracenomycin polyketide synthesis protein; X-RAY	98.33
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	98.33
3ht1_A		145	REMF protein; cupin fold, Zn-binding, antibiotic b	98.3
1vj2_A		126	Novel manganese-containing cupin TM1459; structura	98.29
4b29_A		217	Dimethylsulfoniopropionate lyase; hydrolase, dimet	98.29
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	98.28
2vpv_A		166	Protein MIF2, MIF2P; nucleus, mitosis, centromere,	98.27
1vr3_A		191	Acireductone dioxygenase; 13543033, structural gen	98.27
3ibm_A		167	Cupin 2, conserved barrel domain protein; cupin 2	98.26
2o8q_A		134	Hypothetical protein; cpuin-like fold, structural	98.24
3es1_A		172	Cupin 2, conserved barrel domain protein; YP_00116	98.23
2bnm_A		198	Epoxidase; oxidoreductase, cupin, HTH, cation-depe	98.19
1o4t_A		133	Putative oxalate decarboxylase; double-stranded be	98.17
2oa2_A		148	BH2720 protein; 10175341, structural genomics, joi	98.16
3kgz_A		156	Cupin 2 conserved barrel domain protein; metallopr	98.14
1yfu_A		174	3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid	98.11
3cew_A		125	Uncharacterized cupin protein; all beta-protein, j	98.1
3jzv_A		166	Uncharacterized protein RRU_A2000; structural geno	98.1
1dgw_A		178	Canavalin; duplicated swiss-roll beta barrels, loo	98.07
1sfn_A		246	Conserved hypothetical protein; structural genomic	98.06
4i4a_A		128	Similar to unknown protein; structural genomics, P	98.05
1lr5_A		163	Auxin binding protein 1; beta jellyroll, double st	98.05
2f4p_A		147	Hypothetical protein TM1010; double-stranded beta-	98.04
1y9q_A		192	Transcriptional regulator, HTH_3 family; transcrip	98.04
2arc_A		164	ARAC, arabinose operon regulatory protein; transcr	98.03
1rc6_A		261	Hypothetical protein YLBA; structural genomics, NY	98.03
1fi2_A		201	Oxalate oxidase, germin; beta-jellyroll, oxidoredu	98.01
4h7l_A		157	Uncharacterized protein; structural genomics, PSI-	98.0
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	97.96
1sq4_A		278	GLXB, glyoxylate-induced protein; structural genom	97.94
4e2q_A		266	Ureidoglycine aminohydrolase; BI-cupin, manganese	97.93
1zvf_A		176	3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b	97.93
3d0j_A		140	Uncharacterized protein CA_C3497; beta-barrel, str	97.92
1x82_A		190	Glucose-6-phosphate isomerase; cupin superfamily,	97.91
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	97.89
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	97.88
1sef_A		274	Conserved hypothetical protein; structural genomic	97.86
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	97.85
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	97.82
1rc6_A		261	Hypothetical protein YLBA; structural genomics, NY	97.81
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	97.78
2xlg_A		239	SLL1785 protein, CUCA; metal binding protein, cupi	97.78
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	97.77
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	97.75
1sef_A		274	Conserved hypothetical protein; structural genomic	97.75
3eo6_A		106	Protein of unknown function (DUF1255); AFE_2634, s	97.75
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	97.72
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	97.71
2ozi_A		98	Hypothetical protein RPA4178; APC6210, putative pr	97.7
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	97.66
2qnk_A		286	3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol	97.62
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	97.61
3lag_A		98	Uncharacterized protein RPA4178; functionally unkn	97.58
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	97.55
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	97.54
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	97.51
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	97.5
1sfn_A		246	Conserved hypothetical protein; structural genomic	97.47
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	97.42
3hqx_A		111	UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC	97.38
1zrr_A		179	E-2/E-2' protein; nickel, cupin, beta helix, methi	97.34
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	97.34
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	97.26
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	97.24
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	97.2
1eyb_A		471	Homogentisate 1,2-dioxygenase; jelly roll, beta sa	97.17
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	97.17
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	97.16
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	97.09
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	96.98
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	96.98
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	96.98
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	96.97
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	96.96
2o1q_A		145	Putative acetyl/propionyl-COA carboxylase, alpha;	96.91
1sq4_A		278	GLXB, glyoxylate-induced protein; structural genom	96.86
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	96.8
2qnk_A		286	3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol	96.79
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	96.73
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	96.73
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	96.67
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	96.66
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	96.62
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	96.55
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	96.48
4e2q_A		266	Ureidoglycine aminohydrolase; BI-cupin, manganese	96.44
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	96.17
3cjx_A		165	Protein of unknown function with A cupin-like FOL;	96.16
3gbg_A		276	TCP pilus virulence regulatory protein; cupin, hel	96.04
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	96.03
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	95.98
2y0o_A		175	Probable D-lyxose ketol-isomerase; carbohydrate me	95.92
3ebr_A		159	Uncharacterized RMLC-like cupin; structural genomi	95.89
2q1z_B		195	Anti-sigma factor CHRR, transcriptional activator;	95.7
3o14_A		223	Anti-ecfsigma factor, CHRR; cupin, structural geno	95.47
3bal_A		153	Acetylacetone-cleaving enzyme; jelly roll, tetrame	94.87
2wfp_A		394	Mannose-6-phosphate isomerase; APO-structure, meta	94.85
3st7_A		369	Capsular polysaccharide synthesis enzyme CAP5F; ro	94.61
1pmi_A		440	PMI, phosphomannose isomerase; aldose-ketose isome	93.53
2gm6_A		208	Cysteine dioxygenase type I; structural genomics,	93.41
1zx5_A		300	Mannosephosphate isomerase, putative; STRU genomic	93.39
1qwr_A		319	Mannose-6-phosphate isomerase; structural genomics	93.36
3eqe_A		171	Putative cystein deoxygenase; YUBC, SR112, NESG, s	91.65
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	90.74
3bpz_A		202	Potassium/sodium hyperpolarization-activated cycli	89.92
2vec_A		256	YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe	89.36
2qjv_A		270	Uncharacterized IOLB-like protein; structural geno	88.9
2vec_A		256	YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe	88.46
2d93_A		134	RAP guanine nucleotide exchange factor 6; CNMP_bin	86.98
3ocp_A		139	PRKG1 protein; serine/threonine kinase, TF2I and I	86.8
1tq5_A		242	Protein YHHW; bicupin, pirin, montreal-kingston ba	85.85
2ptm_A		198	Hyperpolarization-activated (IH) channel; ION chan	85.25
3pna_A		154	CAMP-dependent protein kinase type I-alpha regula	85.1
3of1_A		246	CAMP-dependent protein kinase regulatory subunit;	83.29
4f8a_A		160	Potassium voltage-gated channel subfamily H membe;	82.87
2pa7_A		141	DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug	82.76
1tq5_A		242	Protein YHHW; bicupin, pirin, montreal-kingston ba	82.36
2qdr_A		303	Uncharacterized protein; double-stranded beta-heli	81.34
4gjz_A		235	Lysine-specific demethylase 8; JMJC, beta barrel,	81.31
3uss_A		211	Putative uncharacterized protein; cupin, three his	80.95
3o14_A		223	Anti-ecfsigma factor, CHRR; cupin, structural geno	80.59
3ukn_A		212	Novel protein similar to vertebrate potassium VOL	80.09

>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str}	Back alignment and structure

Probab=99.95  E-value=1.8e-27  Score=180.15  Aligned_cols=88  Identities=20%  Similarity=0.280  Sum_probs=78.8

Q ss_pred             cccCCCCeeecccccccccc-eeeEEEecCCceeeeeCCCc-eEEEEEEcEEEEEeCCCceeEEEcCCcEEEEcCCCEEE
Q 031109           74 CHTGGQPRVLPSKKTHLEAI-WRILRWGCPPSKFPWTYSDK-ETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCT  151 (165)
Q Consensus        74 ~~~~G~P~~~~~~~~~~~~~-~~~GiWe~~pg~f~w~y~~d-E~~yVLEG~vtVt~dgG~e~v~i~AGDlv~fPkG~~~t  151 (165)
                      ...+|+|....++.  ++++ ..+|+|+|+||+|+|+|+.+ |+||||||+++|+++|| ++++|+|||+|+||+|++|+
T Consensus        23 ~r~~~~~~~~~~~~--~~~g~~~~GvWe~tPG~~~~~~~~~~E~~~iLeG~~~lt~ddG-~~~~l~aGD~~~~P~G~~gt   99 (116)
T 3es4_A           23 GRDGGSYRRQIWQD--DVENGTIVAVWMAEPGIYNYAGRDLEETFVVVEGEALYSQADA-DPVKIGPGSIVSIAKGVPSR   99 (116)
T ss_dssp             TCSSCEEEEEEEEC--SSSSCCEEEEEEECSEEEEECCCSEEEEEEEEECCEEEEETTC-CCEEECTTEEEEECTTCCEE
T ss_pred             eeecCcceEEEEee--CCCCCEEEEEEecCCceeECeeCCCcEEEEEEEeEEEEEeCCC-eEEEECCCCEEEECCCCeEE
Confidence            55677776665553  5666 89999999999999999877 99999999999999999 69999999999999999999


Q ss_pred             EEEceeeEEEEEe
Q 031109          152 WDVSVGVDKHYKF  164 (165)
Q Consensus       152 W~V~e~vrK~Y~~  164 (165)
                      |+|.++|||+|++
T Consensus       100 Wev~e~vrK~~~~  112 (116)
T 3es4_A          100 LEILSSFRKLATV  112 (116)
T ss_dssp             EEECSCEEEEEEE
T ss_pred             EEEeEEEeEEEEE
Confidence            9999999999986

PyMOL of 3es4

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV}	Back alignment and structure

>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50}	Back alignment and structure

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV}	Back alignment and structure

>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24	Back alignment and structure

>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A	Back alignment and structure

>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile}	Back alignment and structure

>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum}	Back alignment and structure

>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis}	Back alignment and structure

>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9	Back alignment and structure

>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134}	Back alignment and structure

>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina}	Back alignment and structure

>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A	Back alignment and structure

>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense}	Back alignment and structure

>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I}	Back alignment and structure

>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400}	Back alignment and structure

>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus}	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis}	Back alignment and structure

>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha}	Back alignment and structure

>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans}	Back alignment and structure

>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18	Back alignment and structure

>2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22	Back alignment and structure

>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis}	Back alignment and structure

>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A	Back alignment and structure

>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10	Back alignment and structure

>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism}	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A*	Back alignment and structure

>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae}	Back alignment and structure

>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6	Back alignment and structure

>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1}	Back alignment and structure

>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans}	Back alignment and structure

>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A	Back alignment and structure

>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9	Back alignment and structure

>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans}	Back alignment and structure

>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris}	Back alignment and structure

>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A*	Back alignment and structure

>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis}	Back alignment and structure

>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A	Back alignment and structure

>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11	Back alignment and structure

>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp}	Back alignment and structure

>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A*	Back alignment and structure

>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9	Back alignment and structure

>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15	Back alignment and structure

>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A	Back alignment and structure

>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11	Back alignment and structure

>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A	Back alignment and structure

>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus}	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP}	Back alignment and structure

>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11	Back alignment and structure

>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A	Back alignment and structure

>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20	Back alignment and structure

>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824}	Back alignment and structure

>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A*	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A*	Back alignment and structure

>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B	Back alignment and structure

>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A*	Back alignment and structure

>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A*	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*	Back alignment and structure

>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11	Back alignment and structure

>3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270}	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP}	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A*	Back alignment and structure

>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A	Back alignment and structure

>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris}	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}	Back alignment and structure

>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23	Back alignment and structure

>3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0	Back alignment and structure

>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A	Back alignment and structure

>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A	Back alignment and structure

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus}	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum}	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus}	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A*	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A*	Back alignment and structure

>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21	Back alignment and structure

>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A*	Back alignment and structure

>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus}	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23	Back alignment and structure

>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum}	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}	Back alignment and structure

>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A	Back alignment and structure

>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha}	Back alignment and structure

>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae}	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A	Back alignment and structure

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus}	Back alignment and structure

>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp}	Back alignment and structure

>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134}	Back alignment and structure

>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei}	Back alignment and structure

>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii}	Back alignment and structure

>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A*	Back alignment and structure

>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A	Back alignment and structure

>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3	Back alignment and structure

>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19	Back alignment and structure

>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3	Back alignment and structure

>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3	Back alignment and structure

>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis}	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A	Back alignment and structure

>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A*	Back alignment and structure

>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli}	Back alignment and structure

>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2}	Back alignment and structure

>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli}	Back alignment and structure

>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens}	Back alignment and structure

>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A*	Back alignment and structure

>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12	Back alignment and structure

>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus}	Back alignment and structure

>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B*	Back alignment and structure

>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae}	Back alignment and structure

>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus}	Back alignment and structure

>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A*	Back alignment and structure

>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12	Back alignment and structure

>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme}	Back alignment and structure

>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A*	Back alignment and structure

>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19	Back alignment and structure

>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei}	Back alignment and structure

>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		165
d1o5ua_		88	b.82.1.8 (A:) Hypothetical protein TM1112 {Thermot	7e-30
d2pyta1		128	b.82.1.24 (A:100-227) Ethanolamine utilization pro	5e-11

>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Length = 88	Back information, alignment and structure


class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Hypothetical protein TM1112
domain: Hypothetical protein TM1112
species: Thermotoga maritima [TaxId: 2336]

 Score =  102 bits (256), Expect = 7e-30
 Identities = 44/114 (38%), Positives = 52/114 (45%), Gaps = 28/114 (24%)

Query: 51  VKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTY 110
           VKIE+  PE KL EL V +WP                           W    S+F W Y
Sbjct: 2   VKIEKPTPE-KLKELSVEKWPI--------------------------WEKEVSEFDWYY 34

Query: 111 SDKETCYLLEGKVKVYPDGSNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKF 164
              ETCY+LEGKV+V  +   +   I  GDLV FPKG+ C W V   V KHY  
Sbjct: 35  DTNETCYILEGKVEVTTEDGKK-YVIEKGDLVTFPKGLRCRWKVLEPVRKHYNL 87

PyMOL of d1o5ua_

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		165
d1o5ua_		88	Hypothetical protein TM1112 {Thermotoga maritima [	100.0
d2pyta1		128	Ethanolamine utilization protein EutQ {Salmonella	99.67
d1yhfa1		112	Hypothetical protein SPy1581 {Streptococcus pyogen	98.71
d2b8ma1		108	Hypothetical protein MJ0764 {Archaeon Methanococcu	98.63
d1v70a_		105	Hypothetical protein TTHA0104 {Thermus thermophilu	98.57
d1vj2a_		114	Hypothetical protein TM1459 {Thermotoga maritima [	98.5
d1y9qa2		99	Probable transcriptional regulator VC1968, C-termi	98.37
d1o4ta_		115	Hypothetical protein TM1287 {Thermotoga maritima [	98.17
d1dgwa_		178	Seed storage 7S protein {Jack bean (Canavalia ensi	98.16
d1uika1		203	Seed storage 7S protein {Soybean (Glycine max), be	98.15
d1juha_		348	Quercetin 2,3-dioxygenase {Aspergillus japonicus [	98.12
d1y3ta1		330	Hypothetical protein YxaG {Bacillus subtilis [TaxI	98.1
d1uija1		170	Seed storage 7S protein {Soybean (Glycine max), be	98.02
d2bnma2		122	Hydroxypropylphosphonic acid epoxidase Fom4, C-ter	98.02
d1lr5a_		160	Auxin binding protein {Maize (Zea mays) [TaxId: 45	98.0
d1y3ta1		330	Hypothetical protein YxaG {Bacillus subtilis [TaxI	97.97
d1rc6a_		253	Hypothetical protein YlbA {Escherichia coli [TaxId	97.96
d1od5a2		173	Seed storage 7S protein {Soybean (Glycine max), gl	97.93
d2f4pa1		134	Hypothetical protein TM1010 {Thermotoga maritima [	97.93
d1juha_		348	Quercetin 2,3-dioxygenase {Aspergillus japonicus [	97.92
d1fxza2		174	Seed storage 7S protein {Soybean (Glycine max), pr	97.9
g1dgw.1		168	Seed storage 7S protein {Jack bean (Canavalia ensi	97.89
d1sfna_		245	Hypothetical protein DR1152 {Deinococcus radiodura	97.87
d2oyza1		93	Uncharacterized protein VPA0057 {Vibrio parahaemol	97.79
d1uika2		185	Seed storage 7S protein {Soybean (Glycine max), be	97.75
d1sefa_		250	Hypothetical protein EF2996 {Enterococcus faecalis	97.7
d1rc6a_		253	Hypothetical protein YlbA {Escherichia coli [TaxId	97.66
d1sefa_		250	Hypothetical protein EF2996 {Enterococcus faecalis	97.66
d1j58a_		372	Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil	97.64
d1sfna_		245	Hypothetical protein DR1152 {Deinococcus radiodura	97.62
d2et1a1		201	Germin {Barley (Hordeum vulgare) [TaxId: 4513]}	97.59
d2phla2		162	Seed storage 7S protein {French bean (Phaseolus vu	97.55
d2phla1		200	Seed storage 7S protein {French bean (Phaseolus vu	97.53
d2d40a1		308	Gentisate 1,2-dioxygenase {Escherichia coli [TaxId	97.52
d1x82a_		190	Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc	97.52
d1sq4a_		273	Glyoxylate-induced protein PA1140 {Pseudomonas aer	97.48
d2arca_		161	Regulatory protein AraC {Escherichia coli [TaxId:	97.29
d1sq4a_		273	Glyoxylate-induced protein PA1140 {Pseudomonas aer	97.24
d1j58a_		372	Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil	97.16
d2d40a1		308	Gentisate 1,2-dioxygenase {Escherichia coli [TaxId	96.98
d2phda1		351	Gentisate 1,2-dioxygenase {Pseudaminobacter salicy	96.97
d1zrra1		179	Acireductone dioxygenase {Klebsiella pneumoniae [T	96.86
d1vr3a1		179	Acireductone dioxygenase {Mouse (Mus musculus) [Ta	96.86
d1eyba_		439	Homogentisate dioxygenase {Human (Homo sapiens) [T	96.81
d3bu7a1		355	Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [	96.51
d2phda1		351	Gentisate 1,2-dioxygenase {Pseudaminobacter salicy	96.4
d3bu7a1		355	Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [	96.06
d1yfua1		174	3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m	95.78
d1zvfa1		175	3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea	95.72
d2o1qa1		144	Putative acetyl/propionyl-CoA carboxylase subunit	95.38
d1fxza1		239	Seed storage 7S protein {Soybean (Glycine max), pr	95.29
d1qwra_		315	Mannose-6-phosphate isomerase ManA {Bacillus subti	94.87
d1od5a1		245	Seed storage 7S protein {Soybean (Glycine max), gl	93.84
d1pmia_		440	Phosphomannose isomerase {Yeast (Candida albicans)	93.54
d1zx5a1		299	Putative mannosephosphate isomerase AF0035 {Archae	92.84
d1vrba1		319	Putative asparaginyl hydroxylase YxbC {Bacillus su	88.42
d2pa7a1		135	dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane	87.67
d1q3ea_		193	HCN pacemaker channel {Mouse (Mus musculus) [TaxId	86.15
d1ne6a1		136	Regulatory subunit of Protein kinase A {Cow (Bos t	84.09
d1o7fa3		124	Regulatory domain of Epac2, domains 1 and 3 {Mouse	80.64
d1vp6a_		133	Putative ion channel CnbD {Mesorhizobium loti [Tax	80.09

>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Hypothetical protein TM1112
domain: Hypothetical protein TM1112
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=3.6e-33  Score=200.31  Aligned_cols=87  Identities=49%  Similarity=0.959  Sum_probs=83.7

Q ss_pred             eeEEecCCCcchhhhcccccCCCCcccCCCCeeecccccccccceeeEEEecCCceeeeeCCCceEEEEEEcEEEEEeCC
Q 031109           50 GVKIERNPPESKLTELGVRQWPKHCHTGGQPRVLPSKKTHLEAIWRILRWGCPPSKFPWTYSDKETCYLLEGKVKVYPDG  129 (165)
Q Consensus        50 ~i~ie~~ps~~~l~~lGv~~Wp~~~~~~G~P~~~~~~~~~~~~~~~~GiWe~~pg~f~w~y~~dE~~yVLEG~vtVt~dg  129 (165)
                      .|+|++ |+++||++||+.+|+.                          |+|+|++|+|+|+.+|+||||||+++|++++
T Consensus         1 ~i~i~~-~~~~~l~~lGv~~~gv--------------------------W~~~pg~f~~~y~~~E~~~ileG~v~i~~~~   53 (88)
T d1o5ua_           1 EVKIEK-PTPEKLKELSVEKWPI--------------------------WEKEVSEFDWYYDTNETCYILEGKVEVTTED   53 (88)
T ss_dssp             CCEEEC-CCHHHHHHHTGGGSCE--------------------------EEECSEEEEEECSSCEEEEEEEEEEEEEETT
T ss_pred             CcEEec-CCHHHHHhcCCcccce--------------------------EeecCcEEEEEcCccEEEEEEEeEEEEEcCC
Confidence            488997 8999999999999988                          9999999999999999999999999999999


Q ss_pred             CceeEEEcCCcEEEEcCCCEEEEEEceeeEEEEEe
Q 031109          130 SNEGVEIGAGDLVVFPKGMSCTWDVSVGVDKHYKF  164 (165)
Q Consensus       130 G~e~v~i~AGDlv~fPkG~~~tW~V~e~vrK~Y~~  164 (165)
                      | ++++++|||+|+||+|++|+|+|++++||+|+|
T Consensus        54 G-~~~~~~aGD~~~~p~G~~~~W~v~e~v~K~yvi   87 (88)
T d1o5ua_          54 G-KKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNL   87 (88)
T ss_dssp             C-CEEEEETTCEEEECTTCEEEEEEEEEEEEEEEE
T ss_pred             C-CEEEEeCCCEEEECCCCEEEEEECceEEEEEEe
Confidence            9 689999999999999999999999999999987

PyMOL of d1o5ua_

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}	Back information, alignment and structure

>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}	Back information, alignment and structure

>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}	Back information, alignment and structure

>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}	Back information, alignment and structure

>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}	Back information, alignment and structure

>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}	Back information, alignment and structure

>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}	Back information, alignment and structure

>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}	Back information, alignment and structure

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]}	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]}	Back information, alignment and structure

>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}	Back information, alignment and structure

>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]}	Back information, alignment and structure

>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}	Back information, alignment and structure

>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}	Back information, alignment and structure

>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}	Back information, alignment and structure

>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure