Citrus Sinensis ID: 031176
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| 388506222 | 167 | unknown [Lotus japonicus] gi|388509168|g | 1.0 | 0.982 | 0.784 | 2e-71 | |
| 358249000 | 167 | uncharacterized protein LOC100785425 [Gl | 1.0 | 0.982 | 0.766 | 2e-70 | |
| 357509485 | 167 | Mitochondrial fission 1 protein [Medicag | 1.0 | 0.982 | 0.754 | 6e-69 | |
| 326514756 | 164 | predicted protein [Hordeum vulgare subsp | 1.0 | 1.0 | 0.743 | 1e-68 | |
| 388517985 | 167 | unknown [Medicago truncatula] | 1.0 | 0.982 | 0.748 | 2e-68 | |
| 351722657 | 181 | uncharacterized protein LOC100306722 [Gl | 0.993 | 0.900 | 0.705 | 2e-67 | |
| 224139750 | 167 | predicted protein [Populus trichocarpa] | 1.0 | 0.982 | 0.808 | 2e-67 | |
| 449449795 | 167 | PREDICTED: mitochondria fission 1 protei | 1.0 | 0.982 | 0.778 | 3e-66 | |
| 297817028 | 170 | binding protein [Arabidopsis lyrata subs | 1.0 | 0.964 | 0.723 | 4e-66 | |
| 359482219 | 167 | PREDICTED: mitochondria fission 1 protei | 1.0 | 0.982 | 0.808 | 4e-66 |
| >gi|388506222|gb|AFK41177.1| unknown [Lotus japonicus] gi|388509168|gb|AFK42650.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Score = 273 bits (697), Expect = 2e-71, Method: Compositional matrix adjust.
Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 3/167 (1%)
Query: 1 MDVKISKFFDSIGSFFTGGDQIPWCDRDIIAGCEREVAEAND---DKQKSESIMRLSWAL 57
MD KI F+SIG+FF+GGDQIPWCDRD+IAGCEREVAEA++ +++K ESIMRLSWAL
Sbjct: 1 MDAKIGSLFESIGNFFSGGDQIPWCDRDVIAGCEREVAEASNGESEERKHESIMRLSWAL 60
Query: 58 VHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYLLAVGYYRTGEYAKSRQILEQCLEIA 117
VHSR+ EDVQRGIAMLE SL N PLQQREKLYLLAVGYYR+ +Y +SR++LEQCLEIA
Sbjct: 61 VHSREKEDVQRGIAMLETSLGNDKSPLQQREKLYLLAVGYYRSNDYGRSRELLEQCLEIA 120
Query: 118 PDWRQALGLKKTVEDRIAKDGVIGIGITATAVGLIAGGIAAALARKK 164
PDWRQA LKK VEDRIAKDGVIGIGITATAVGLI GGIAAALARK
Sbjct: 121 PDWRQARSLKKAVEDRIAKDGVIGIGITATAVGLIVGGIAAALARKN 167
|
Source: Lotus japonicus Species: Lotus japonicus Genus: Lotus Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|358249000|ref|NP_001239720.1| uncharacterized protein LOC100785425 [Glycine max] gi|255631918|gb|ACU16326.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357509485|ref|XP_003625031.1| Mitochondrial fission 1 protein [Medicago truncatula] gi|124359978|gb|ABN07994.1| Protein kinase [Medicago truncatula] gi|355500046|gb|AES81249.1| Mitochondrial fission 1 protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|326514756|dbj|BAJ99739.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326519168|dbj|BAJ96583.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|388517985|gb|AFK47054.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351722657|ref|NP_001235460.1| uncharacterized protein LOC100306722 [Glycine max] gi|255629375|gb|ACU15032.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224139750|ref|XP_002323259.1| predicted protein [Populus trichocarpa] gi|222867889|gb|EEF05020.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449449795|ref|XP_004142650.1| PREDICTED: mitochondria fission 1 protein-like [Cucumis sativus] gi|449506674|ref|XP_004162815.1| PREDICTED: mitochondria fission 1 protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297817028|ref|XP_002876397.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297322235|gb|EFH52656.1| binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359482219|ref|XP_003632733.1| PREDICTED: mitochondria fission 1 protein-like [Vitis vinifera] gi|297739910|emb|CBI30092.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| TAIR|locus:2080665 | 170 | BIGYIN [Arabidopsis thaliana ( | 0.835 | 0.805 | 0.692 | 5.1e-51 | |
| TAIR|locus:505006607 | 167 | FIS1B "AT5G12390" [Arabidopsis | 0.835 | 0.820 | 0.563 | 5.3e-40 | |
| MGI|MGI:1913687 | 152 | Fis1 "fission 1 (mitochondrial | 0.506 | 0.546 | 0.369 | 6.6e-10 | |
| UNIPROTKB|E2QTL3 | 152 | FIS1 "Uncharacterized protein" | 0.506 | 0.546 | 0.357 | 1.1e-09 | |
| RGD|1306668 | 152 | Fis1 "fission 1 (mitochondrial | 0.506 | 0.546 | 0.357 | 1.4e-09 | |
| UNIPROTKB|Q3T0I5 | 152 | FIS1 "Mitochondrial fission 1 | 0.506 | 0.546 | 0.345 | 1.8e-09 | |
| UNIPROTKB|A5HUN3 | 152 | FIS1 "Fis1 protein" [Cricetulu | 0.506 | 0.546 | 0.357 | 1.8e-09 | |
| UNIPROTKB|G4N571 | 154 | MGG_06075 "Mitochondria fissio | 0.713 | 0.759 | 0.312 | 1.8e-09 | |
| UNIPROTKB|Q9Y3D6 | 152 | FIS1 "Mitochondrial fission 1 | 0.506 | 0.546 | 0.345 | 2.9e-09 | |
| CGD|CAL0002844 | 154 | orf19.7111 [Candida albicans ( | 0.615 | 0.655 | 0.271 | 5.9e-09 |
| TAIR|locus:2080665 BIGYIN [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 530 (191.6 bits), Expect = 5.1e-51, P = 5.1e-51
Identities = 97/140 (69%), Positives = 119/140 (85%)
Query: 1 MDVKISKFFDSIGSFFTGGDQIPWCDRDIIAGCEREVAEAND---DKQKSESIMRLSWAL 57
MD KI +FFDS+G+FF+G D+IPWCD D+IAGCEREV EA D + K E +MRLSWAL
Sbjct: 1 MDAKIGQFFDSVGTFFSGSDKIPWCDGDVIAGCEREVREATDSGTEDLKKECLMRLSWAL 60
Query: 58 VHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYLLAVGYYRTGEYAKSRQILEQCLEIA 117
VHSRQ EDVQRGIAMLEASL +S+PPL+ REKLYLLAVGYYR+G Y++SRQ++++C+E+
Sbjct: 61 VHSRQTEDVQRGIAMLEASLESSAPPLEDREKLYLLAVGYYRSGNYSRSRQLVDRCIEMQ 120
Query: 118 PDWRQALGLKKTVEDRIAKD 137
DWRQAL LKKT+ED+I KD
Sbjct: 121 ADWRQALVLKKTIEDKITKD 140
|
|
| TAIR|locus:505006607 FIS1B "AT5G12390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913687 Fis1 "fission 1 (mitochondrial outer membrane) homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QTL3 FIS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1306668 Fis1 "fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0I5 FIS1 "Mitochondrial fission 1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5HUN3 FIS1 "Fis1 protein" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N571 MGG_06075 "Mitochondria fission 1 protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y3D6 FIS1 "Mitochondrial fission 1 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002844 orf19.7111 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| BRADI2G26780.1 | annotation not avaliable (164 aa) | |||||||
(Brachypodium distachyon) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| cd12212 | 113 | cd12212, Fis1, Mitochondria Fission Protein Fis1, | 3e-19 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 0.004 |
| >gnl|CDD|213405 cd12212, Fis1, Mitochondria Fission Protein Fis1, cytosolic domain | Back alignment and domain information |
|---|
Score = 77.5 bits (192), Expect = 3e-19
Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 2/84 (2%)
Query: 55 WALVHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYLLAVGYYRTGEYAKSRQILEQCL 114
W L+ S ED Q G+ +L S P ++RE LY LA+G Y+ G Y+++R+ + L
Sbjct: 31 WGLIKSNSREDQQEGVRLLTEIYRES--PERRRECLYYLALGNYKLGNYSEARRYNDLLL 88
Query: 115 EIAPDWRQALGLKKTVEDRIAKDG 138
E PD QA LK+ ++D++AK+G
Sbjct: 89 EKEPDNLQAQSLKQLIDDKVAKEG 112
|
Fis1, along with Dnm1 and Mdv1, is an essential protein in mediating mitochondrial fission. Dnm1 and Fis1 are highly conserved, with a common mechanism in disparate species. In mutants of these proteins, mitochondrial fission is impaired, resulting in networks of undivided mitochondria. The Fis1 N-terminus is cytosolic and tethered to the mitochondrial outer membrane via a C-terminal transmembrane domain. Fis1 appears to act via the recruitment of division complexes to the mitochondrial outer membrane, via interactions with Mdv1 or Caf4. Fis1 has tandem TPR helix-turn-helix motifs which are known to mediate protein-protein interactions. Length = 113 |
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 100.0 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 99.89 | |
| PF14852 | 35 | Fis1_TPR_N: Fis1 N-terminal tetratricopeptide repe | 99.36 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.87 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.75 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.75 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.75 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.69 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.65 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.63 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.53 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.51 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.49 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.4 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.38 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.29 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.23 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.18 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.16 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.13 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.1 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.08 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.07 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.06 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.02 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.02 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.99 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.99 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.99 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.97 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.95 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.95 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.95 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.92 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.91 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.88 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.88 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.88 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.88 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.87 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.87 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.83 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.82 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.8 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.79 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 97.76 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.75 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.72 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.68 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.65 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.65 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.64 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.58 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 97.56 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 97.47 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.45 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.44 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.4 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.39 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.38 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.37 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.37 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.37 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.36 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 97.29 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.26 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.26 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.24 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.23 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.22 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 97.22 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.22 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.2 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.19 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.14 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.01 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 96.98 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.94 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.86 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 96.81 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.79 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 96.78 | |
| PLN02789 | 320 | farnesyltranstransferase | 96.75 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 96.71 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.66 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 96.64 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 96.63 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.61 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 96.52 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.46 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 96.44 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.43 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 96.42 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.39 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 96.34 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 96.3 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 96.28 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 96.22 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 96.22 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 96.21 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 96.2 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 96.19 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 96.18 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 96.14 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.13 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 96.12 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 96.09 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 96.05 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.01 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 95.93 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 95.8 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 95.79 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 95.75 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 95.7 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 95.7 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 95.69 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 95.68 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 95.66 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 95.62 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.6 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 95.57 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 95.45 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 95.41 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 95.37 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 95.24 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 95.17 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 95.16 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 95.07 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 94.99 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 94.96 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 94.89 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 94.83 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 94.57 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 94.5 | |
| PLN02789 | 320 | farnesyltranstransferase | 94.36 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 94.34 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 94.24 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 94.12 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 94.05 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 93.97 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 93.88 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 93.81 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 93.4 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 93.4 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 93.26 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 93.21 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 92.96 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 92.91 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 92.71 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 92.56 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 92.54 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 92.53 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 92.53 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 92.35 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 92.23 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 92.2 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 91.85 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 91.79 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 91.22 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 90.98 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 90.82 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 90.8 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 90.8 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 90.71 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 90.69 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 90.63 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 90.55 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 90.4 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 90.3 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 90.04 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 89.76 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 89.71 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 89.46 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 89.22 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 89.2 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 88.96 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 88.37 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 87.73 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 87.58 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 87.21 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 87.02 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 86.86 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 86.65 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 86.58 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 86.4 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 85.14 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 85.09 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 85.02 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 84.88 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 84.82 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 84.8 | |
| COG4575 | 104 | ElaB Uncharacterized conserved protein [Function u | 84.4 | |
| PF13830 | 324 | DUF4192: Domain of unknown function (DUF4192) | 84.32 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 83.84 | |
| PF14689 | 62 | SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do | 83.83 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 83.73 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 83.13 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 82.86 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 82.73 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 82.63 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 82.47 | |
| cd02678 | 75 | MIT_VPS4 MIT: domain contained within Microtubule | 81.72 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 81.34 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 81.32 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 81.15 | |
| PRK10132 | 108 | hypothetical protein; Provisional | 80.78 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 80.26 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 80.21 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 80.21 |
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-44 Score=274.84 Aligned_cols=140 Identities=44% Similarity=0.681 Sum_probs=125.6
Q ss_pred ccCCCCCCCCCHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhcCChhHHHHHHHHHHHHhhCCCCCCchHHHHHHHHH
Q 031176 16 FTGGDQIPWCDRDIIAGCEREVAEANDDKQKSESIMRLSWALVHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYLLAV 95 (164)
Q Consensus 16 ~~~~~~lp~~~~~~l~~~e~~y~~~~~~~~s~~~~F~yA~aLi~S~~~~d~~~gi~lLe~ll~~~~~~~~~rd~lY~LAl 95 (164)
|..-+..||+..+.+...|+...+.+.+.++.+++|+|||+||||++..|+++||.+||+++++ .+|.++|||+||||+
T Consensus 1 ~~~~~~~p~a~~d~~~~~e~~~rq~a~~~~s~~s~f~lAwaLV~S~~~~dv~~GI~iLe~l~~~-~~~~~rRe~lyYLAv 79 (149)
T KOG3364|consen 1 FSGSLKEPWAIEDLIAGQEEILRQAARSDVSKQSQFNLAWALVRSRDTEDVQEGIVILEDLLKS-AHPERRRECLYYLAV 79 (149)
T ss_pred CCccccchhhhhhhhHHHHHHHHHHHhccchHHHHHHHHHHHHcccchHHHHHhHHHHHHHhhh-cCcccchhhhhhhHH
Confidence 4566889999877777766665555667889999999999999999999999999999999983 789999999999999
Q ss_pred HHHhhcchHHHHHHHHHHHhhCCCcHHHHHHHHHHHhHhhhhhHHHHHHHHHHHHHHHHHH
Q 031176 96 GYYRTGEYAKSRQILEQCLEIAPDWRQALGLKKTVEDRIAKDGVIGIGITATAVGLIAGGI 156 (164)
Q Consensus 96 g~~kl~~Y~~A~~~~~~lL~~eP~n~Qa~~L~~~Ie~~~~~dGliG~~i~~~a~~~~~g~~ 156 (164)
||||+++|++|++|++.+|++||+|+||.+|++.|+++|+|||+|||+|+||++++++|.+
T Consensus 80 g~yRlkeY~~s~~yvd~ll~~e~~n~Qa~~Lk~~ied~itkegliGm~v~gGa~~~v~gl~ 140 (149)
T KOG3364|consen 80 GHYRLKEYSKSLRYVDALLETEPNNRQALELKETIEDKITKEGLIGMVVVGGAALAVGGLA 140 (149)
T ss_pred HHHHHhhHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHHhhcceeeeeehhhHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999988865554443
|
|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF14852 Fis1_TPR_N: Fis1 N-terminal tetratricopeptide repeat; PDB: 1IYG_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A 1PC2_A 1NZN_A | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG4575 ElaB Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13830 DUF4192: Domain of unknown function (DUF4192) | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PRK10132 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 164 | ||||
| 1iyg_A | 133 | Solution Structure Of Rsgi Ruh-001, A Fis1p-Like An | 4e-08 | ||
| 1pc2_A | 152 | Solution Structure Of Human Mitochondria Fission Pr | 5e-08 | ||
| 1nzn_A | 126 | Cytosolic Domain Of The Human Mitchondrial Fission | 6e-08 | ||
| 1y8m_A | 144 | Solution Structure Of Yeast Mitochondria Fission Pr | 9e-06 | ||
| 3o48_A | 134 | Crystal Structure Of Fission Protein Fis1 From Sacc | 9e-06 | ||
| 2pqn_A | 129 | Crystal Structure Of Yeast Fis1 Complexed With A Fr | 9e-06 |
| >pdb|1IYG|A Chain A, Solution Structure Of Rsgi Ruh-001, A Fis1p-Like And Cgi- 135 Homologous Domain From A Mouse Cdna Length = 133 | Back alignment and structure |
|
| >pdb|1PC2|A Chain A, Solution Structure Of Human Mitochondria Fission Protein Fis1 Length = 152 | Back alignment and structure |
| >pdb|1NZN|A Chain A, Cytosolic Domain Of The Human Mitchondrial Fission Protein Fis1 Adopts A Tpr Fold Length = 126 | Back alignment and structure |
| >pdb|1Y8M|A Chain A, Solution Structure Of Yeast Mitochondria Fission Protein Fis1 Length = 144 | Back alignment and structure |
| >pdb|3O48|A Chain A, Crystal Structure Of Fission Protein Fis1 From Saccharomyces Cerevisiae Length = 134 | Back alignment and structure |
| >pdb|2PQN|A Chain A, Crystal Structure Of Yeast Fis1 Complexed With A Fragment Of Yeast Mdv1 Length = 129 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 6e-47 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 6e-45 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 3e-40 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 3e-38 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 3e-06 |
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Length = 152 | Back alignment and structure |
|---|
Score = 149 bits (377), Expect = 6e-47
Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 2/131 (1%)
Query: 34 EREVAEANDDKQKSESIMRLSWALVHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYLL 93
++ +E + +W LV S+ +D+++GI +LE L S +QR+ ++ L
Sbjct: 19 KKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKE-EQRDYVFYL 77
Query: 94 AVGYYRTGEYAKSRQILEQCLEIAPDWRQALGLKKTVEDRIAKDGVIGIGITATAVGLIA 153
AVG YR EY K+ + + L+ P QA L++ ++ + KDG++G+ I L
Sbjct: 78 AVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMA-LGV 136
Query: 154 GGIAAALARKK 164
G+A + +
Sbjct: 137 AGLAGLIGLEH 147
|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 144 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Length = 126 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Length = 134 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 100.0 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 100.0 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 100.0 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 100.0 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.02 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 99.01 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.97 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.92 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.92 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.9 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.89 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.89 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.84 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.83 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.82 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.81 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.81 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.79 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.77 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.75 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.74 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.74 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.7 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.7 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.69 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.69 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.68 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.67 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.66 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.66 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.65 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.65 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.65 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.64 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.61 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.6 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.6 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.6 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.59 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.57 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.57 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.55 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.55 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.55 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.54 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.53 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.53 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.52 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.51 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.5 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.5 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.5 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.49 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.49 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.48 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.48 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.47 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.47 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.42 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.41 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.41 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.4 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 98.39 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.39 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.37 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.36 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.35 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.34 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.34 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.34 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.34 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.33 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.33 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.32 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.31 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.29 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.28 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.28 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.28 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.27 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.27 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.27 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.27 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.26 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.21 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.21 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.2 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.2 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.2 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.19 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.19 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.19 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.18 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.18 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.18 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.17 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.17 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.16 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.15 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.15 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.15 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.14 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.13 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.1 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.1 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.1 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 98.09 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.09 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.09 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.08 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.08 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 98.07 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.05 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.03 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.02 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.02 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.02 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.0 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.0 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.98 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.97 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.95 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.93 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.9 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.9 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.87 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.86 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.86 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 97.82 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.81 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.8 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.79 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.76 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.71 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.67 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.67 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.65 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.62 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.55 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.51 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.5 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.49 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.48 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.48 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.42 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.37 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 97.36 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.33 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.3 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.29 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.27 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.24 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.24 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.23 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.19 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.14 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.13 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.08 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.07 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.05 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 97.01 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.97 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.97 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.94 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.94 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.93 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.92 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.91 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 96.84 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.83 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 96.8 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.76 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.74 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.72 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.72 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.69 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 96.66 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.65 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.64 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 96.64 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 96.52 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.51 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 96.51 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.5 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.5 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.48 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 96.28 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 96.24 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.23 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.21 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 96.01 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.87 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 95.63 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.58 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.52 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 95.38 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 95.36 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 94.98 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 94.68 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 94.66 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 94.45 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 94.42 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 94.36 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 94.0 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 93.98 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 93.75 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 93.62 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 93.6 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 93.47 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 92.55 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 91.58 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 91.32 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 91.23 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 90.14 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 89.73 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 88.92 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 88.71 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 88.33 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 87.2 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 87.15 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 86.19 | |
| 3mv2_A | 325 | Coatomer subunit alpha; vesicular membrane coat CO | 84.6 | |
| 2lbg_A | 27 | Major prion protein; conserved hydrophobic region, | 83.01 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 82.85 | |
| 3mkr_B | 320 | Coatomer subunit alpha; tetratricopeptide repeats | 82.44 | |
| 2cfu_A | 658 | SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 | 81.81 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 81.58 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 80.87 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 80.43 |
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-44 Score=279.13 Aligned_cols=128 Identities=23% Similarity=0.394 Sum_probs=119.5
Q ss_pred CCCCCCC-------CCHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhcCChhHHHHHHHHHHHHhhCCCCCCchHHHH
Q 031176 18 GGDQIPW-------CDRDIIAGCEREVAEANDDKQKSESIMRLSWALVHSRQAEDVQRGIAMLEASLANSSPPLQQREKL 90 (164)
Q Consensus 18 ~~~~lp~-------~~~~~l~~~e~~y~~~~~~~~s~~~~F~yA~aLi~S~~~~d~~~gi~lLe~ll~~~~~~~~~rd~l 90 (164)
+.|.+|+ .+|++|+.+|++|+++..+.++++++|+|||+||||+++.|+++||.||+++++. +|.++|||+
T Consensus 3 ~~~~~~~~~~~~~~l~~eeL~~lr~qY~~E~~~~vs~~t~F~YAw~Lv~S~~~~di~~GI~LLe~l~~~--~~~~~RdcL 80 (144)
T 1y8m_A 3 KVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKE--AESRRRECL 80 (144)
T ss_dssp TTCSSCCSGGGGCCCCHHHHHHHHHHHHHTTSTTSCHHHHHHHHHHHHHSSSHHHHHHHHHHHHHHHHH--CCSTHHHHH
T ss_pred CCCcchhHHHhcCCCCHHHHHHHHHHHHHhccCCCcHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhc--CccchhHHH
Confidence 3456665 7999999999999998446889999999999999999999999999999999985 678999999
Q ss_pred HHHHHHHHhhcchHHHHHHHHHHHhhCCCcHHHHHHHHHHHhHhhhhhHHHHHHHHH
Q 031176 91 YLLAVGYYRTGEYAKSRQILEQCLEIAPDWRQALGLKKTVEDRIAKDGVIGIGITAT 147 (164)
Q Consensus 91 Y~LAlg~~kl~~Y~~A~~~~~~lL~~eP~n~Qa~~L~~~Ie~~~~~dGliG~~i~~~ 147 (164)
||||+||||+|||++|++||+.+|+++|+|+||++|+++|+++|+|||+|||||+||
T Consensus 81 YyLAvg~ykl~~Y~~Ar~y~d~lL~~eP~n~QA~~Lk~~Ie~~i~kdGliG~ai~gg 137 (144)
T 1y8m_A 81 YYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGG 137 (144)
T ss_dssp HHHHHHHHTTTCHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHHTTTTTCCCCCS
T ss_pred HHHHHHHHHhhhHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHHhchhhhhhhhc
Confidence 999999999999999999999999999999999999999999999999999999864
|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A | Back alignment and structure |
|---|
| >2lbg_A Major prion protein; conserved hydrophobic region, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 164 | ||||
| d2pqrb1 | 124 | a.118.8.1 (B:5-128) Mitochondria fission protein F | 3e-34 | |
| d1nzna_ | 122 | a.118.8.1 (A:) Mitochondria fission protein Fis1 { | 8e-16 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.004 |
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Mitochondria fission protein Fis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 114 bits (287), Expect = 3e-34
Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 2/105 (1%)
Query: 33 CEREVAEANDDKQKSESIMRLSWALVHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYL 92
++V +S +W L+ S D + G+ +L + ++RE LY
Sbjct: 21 LRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEA--ESRRRECLYY 78
Query: 93 LAVGYYRTGEYAKSRQILEQCLEIAPDWRQALGLKKTVEDRIAKD 137
L +G Y+ GEY+ +++ ++ E + +Q LK VED+I K+
Sbjct: 79 LTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKE 123
|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 100.0 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.92 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.15 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.88 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.88 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.8 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.78 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.72 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.7 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.59 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.57 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.54 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.53 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.47 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.47 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.45 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.33 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.33 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.2 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.19 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.18 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.17 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.92 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.87 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.86 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.67 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.63 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.6 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 97.59 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.58 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.54 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.52 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.51 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 97.4 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.37 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.29 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.08 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.03 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 96.96 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.57 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.49 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 96.44 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.44 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 96.42 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 96.19 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 95.89 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 95.73 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 95.71 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 95.71 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 95.61 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 95.39 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 95.35 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 93.51 | |
| d1wr0a1 | 77 | Vacuolar sorting protein 4b (VPS4B, SKD1 protein) | 91.46 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 91.44 | |
| d2cfua2 | 505 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 85.98 |
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Mitochondria fission protein Fis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=3.6e-36 Score=225.23 Aligned_cols=111 Identities=24% Similarity=0.430 Sum_probs=106.7
Q ss_pred CCHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhcCChhHHHHHHHHHHHHhhCCCCCCchHHHHHHHHHHHHhhcchH
Q 031176 25 CDRDIIAGCEREVAEANDDKQKSESIMRLSWALVHSRQAEDVQRGIAMLEASLANSSPPLQQREKLYLLAVGYYRTGEYA 104 (164)
Q Consensus 25 ~~~~~l~~~e~~y~~~~~~~~s~~~~F~yA~aLi~S~~~~d~~~gi~lLe~ll~~~~~~~~~rd~lY~LAlg~~kl~~Y~ 104 (164)
.++++|..++++|.++.++.++.+++|+|||+|+||+++.|+++||.+|+++++. +|.++||||||||+||||+|+|+
T Consensus 13 l~~~el~~~~~q~~~e~~~~~s~qt~F~YAw~Lv~S~~~~d~~~gI~lLe~~~~~--~p~~~rd~lY~Lav~yyklgdy~ 90 (124)
T d2pqrb1 13 LYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKE--AESRRRECLYYLTIGCYKLGEYS 90 (124)
T ss_dssp CCHHHHHHHHHHHHHTTGGGSCHHHHHHHHHHHHHSSCHHHHHHHHHHHHHHHHH--CGGGHHHHHHHHHHHHHHHTCHH
T ss_pred CCHHHHHHHHHHHHHHhCCCCCcchHHHHHHHHHcCCcHHHHHHHHHHHHHHHhc--CchhHHHHHHHHHHHHHHHhhHH
Confidence 7899999999999998668889999999999999999999999999999999985 67889999999999999999999
Q ss_pred HHHHHHHHHHhhCCCcHHHHHHHHHHHhHhhhh
Q 031176 105 KSRQILEQCLEIAPDWRQALGLKKTVEDRIAKD 137 (164)
Q Consensus 105 ~A~~~~~~lL~~eP~n~Qa~~L~~~Ie~~~~~d 137 (164)
+|++|++++|+++|+|+||+.|++.|+++|+||
T Consensus 91 ~A~~~~~~~L~ieP~n~qA~~L~~~Ie~~~~kd 123 (124)
T d2pqrb1 91 MAKRYVDTLFEHERNNKQVGALKSMVEDKIQKE 123 (124)
T ss_dssp HHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHccCCCcHHHHHHHHHHHHHHhcc
Confidence 999999999999999999999999999999997
|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|