Citrus Sinensis ID: 031202
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| 255575216 | 164 | conserved hypothetical protein [Ricinus | 0.963 | 0.963 | 0.829 | 4e-73 | |
| 224134747 | 161 | predicted protein [Populus trichocarpa] | 0.969 | 0.987 | 0.830 | 1e-72 | |
| 224077455 | 162 | predicted protein [Populus trichocarpa] | 0.969 | 0.981 | 0.837 | 4e-71 | |
| 225466259 | 164 | PREDICTED: universal stress protein A-li | 0.987 | 0.987 | 0.759 | 9e-69 | |
| 357491807 | 166 | Universal stress protein A-like protein | 0.963 | 0.951 | 0.772 | 1e-67 | |
| 297832970 | 159 | universal stress protein family protein | 0.969 | 1.0 | 0.817 | 2e-67 | |
| 30678807 | 159 | adenine nucleotide alpha hydrolases-like | 0.969 | 1.0 | 0.798 | 9e-67 | |
| 351726313 | 166 | uncharacterized protein LOC100500682 [Gl | 0.987 | 0.975 | 0.765 | 2e-66 | |
| 157849718 | 159 | universal stress protein family protein | 0.969 | 1.0 | 0.792 | 5e-66 | |
| 388511741 | 172 | unknown [Lotus japonicus] | 0.896 | 0.854 | 0.768 | 4e-62 |
| >gi|255575216|ref|XP_002528512.1| conserved hypothetical protein [Ricinus communis] gi|223532072|gb|EEF33881.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 279 bits (713), Expect = 4e-73, Method: Compositional matrix adjust.
Identities = 131/158 (82%), Positives = 146/158 (92%)
Query: 1 MSKARTVGVGMDNSPNSKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPL 60
M KA TVG+ MD SP SKAALRWAA+NLIDSGD+++LI VQPP ADHTRKQLFE TGSPL
Sbjct: 1 MEKACTVGIAMDYSPTSKAALRWAAENLIDSGDMVVLIQVQPPKADHTRKQLFEATGSPL 60
Query: 61 VPLEEFREINFSKQYGLTSNPEVLDILDTLSRTKGAKVVAKVYWGDPREKLCDAVEDLKL 120
VPLEEFREIN+SKQYGL+ +PEVLD LDT+SRTKGAKVVAKVYWGDPREKLCDAV+DLKL
Sbjct: 61 VPLEEFREINYSKQYGLSRDPEVLDFLDTVSRTKGAKVVAKVYWGDPREKLCDAVDDLKL 120
Query: 121 DTLVVGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVKG 158
D+LV+GSRGLG +KR LLGSVSN+VVTN+SCPVTVVKG
Sbjct: 121 DSLVIGSRGLGPIKRELLGSVSNYVVTNASCPVTVVKG 158
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224134747|ref|XP_002327479.1| predicted protein [Populus trichocarpa] gi|222836033|gb|EEE74454.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224077455|ref|XP_002305257.1| predicted protein [Populus trichocarpa] gi|222848221|gb|EEE85768.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225466259|ref|XP_002271154.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] gi|297738156|emb|CBI27357.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357491807|ref|XP_003616191.1| Universal stress protein A-like protein [Medicago truncatula] gi|355517526|gb|AES99149.1| Universal stress protein A-like protein [Medicago truncatula] gi|388504360|gb|AFK40246.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297832970|ref|XP_002884367.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297330207|gb|EFH60626.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30678807|ref|NP_850506.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|6714413|gb|AAF26101.1|AC012328_4 unknown protein [Arabidopsis thaliana] gi|332640399|gb|AEE73920.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|351726313|ref|NP_001237890.1| uncharacterized protein LOC100500682 [Glycine max] gi|255630925|gb|ACU15825.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|157849718|gb|ABV89642.1| universal stress protein family protein [Brassica rapa] | Back alignment and taxonomy information |
|---|
| >gi|388511741|gb|AFK43932.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| TAIR|locus:2097755 | 201 | AT3G03270 [Arabidopsis thalian | 0.823 | 0.671 | 0.792 | 2.3e-55 | |
| TAIR|locus:2084525 | 160 | AT3G53990 "AT3G53990" [Arabido | 0.969 | 0.993 | 0.540 | 3.2e-42 | |
| TAIR|locus:2086102 | 163 | AT3G17020 "AT3G17020" [Arabido | 0.963 | 0.969 | 0.503 | 4.3e-38 | |
| TAIR|locus:2024291 | 171 | AT1G09740 "AT1G09740" [Arabido | 0.908 | 0.871 | 0.363 | 2e-17 | |
| TAIR|locus:2200036 | 242 | AT1G11360 [Arabidopsis thalian | 0.932 | 0.632 | 0.339 | 2e-17 | |
| TAIR|locus:2199282 | 160 | AT1G68300 "AT1G68300" [Arabido | 0.914 | 0.937 | 0.369 | 3.7e-16 | |
| TAIR|locus:2076381 | 204 | AT3G58450 "AT3G58450" [Arabido | 0.908 | 0.730 | 0.347 | 1.3e-15 | |
| TAIR|locus:2096089 | 162 | AT3G62550 "AT3G62550" [Arabido | 0.908 | 0.919 | 0.325 | 1.3e-15 | |
| TAIR|locus:2147319 | 242 | PHOS32 "AT5G54430" [Arabidopsi | 0.890 | 0.603 | 0.343 | 1.1e-14 | |
| TAIR|locus:2131719 | 260 | PHOS34 "AT4G27320" [Arabidopsi | 0.926 | 0.584 | 0.329 | 6.2e-14 |
| TAIR|locus:2097755 AT3G03270 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 571 (206.1 bits), Expect = 2.3e-55, P = 2.3e-55
Identities = 107/135 (79%), Positives = 121/135 (89%)
Query: 1 MSKARTVGVGMDNSPNSKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPL 60
M KARTVGVGMD SP SK ALRWAA+NL++ GD +ILIHVQP NADHTRK LFE+TGSPL
Sbjct: 1 MGKARTVGVGMDYSPTSKLALRWAAENLLEDGDTVILIHVQPQNADHTRKILFEETGSPL 60
Query: 61 VPLEEFREINFSKQYGLTSNPEVLDILDTLSRTKGAKVVAKVYWGDPREKLCDAVEDLKL 120
+PLEEFRE+N SKQYGL +PEVLD+LDTLSR K KVVAKVYWGDPREKLCDAVE+LKL
Sbjct: 61 IPLEEFREVNLSKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKL 120
Query: 121 DTLVVGSRGLGALKR 135
D++V+GSRGLG+LKR
Sbjct: 121 DSIVLGSRGLGSLKR 135
|
|
| TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_440069 | hypothetical protein (161 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| pfam00582 | 139 | pfam00582, Usp, Universal stress protein family | 5e-30 | |
| cd00293 | 130 | cd00293, USP_Like, Usp: Universal stress protein f | 1e-29 | |
| COG0589 | 154 | COG0589, UspA, Universal stress protein UspA and r | 6e-18 | |
| cd01989 | 146 | cd01989, STK_N, The N-terminal domain of Eukaryoti | 2e-08 |
| >gnl|CDD|216006 pfam00582, Usp, Universal stress protein family | Back alignment and domain information |
|---|
Score = 106 bits (265), Expect = 5e-30
Identities = 45/153 (29%), Positives = 69/153 (45%), Gaps = 16/153 (10%)
Query: 5 RTVGVGMDNSPNSKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPLVPLE 64
+ + V +D S S+ AL WA + G +IL+HV P + E+ + E
Sbjct: 3 KRILVAVDGSEESERALEWALELAKRRGAELILLHVIDPEPSGAASEALEEEEEEELEEE 62
Query: 65 EFREINFSKQYGLTSNPEVLDILDTLSRTKGAKVVAKVYWGDPREKLCDAVEDLKLDTLV 124
E + L + G V V GDP E + + E+ D +V
Sbjct: 63 E----------------AEAEALAAAAEAGGVVVEVVVRGGDPAEAILEVAEEEDADLIV 106
Query: 125 VGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVK 157
+GSRG L+R+LLGSV+ V+ ++ CPV VV+
Sbjct: 107 MGSRGRSGLRRLLLGSVAEKVLRHAPCPVLVVR 139
|
The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity. Length = 139 |
| >gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family | Back alignment and domain information |
|---|
| >gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| PRK15005 | 144 | universal stress protein F; Provisional | 99.95 | |
| PRK15456 | 142 | universal stress protein UspG; Provisional | 99.95 | |
| PRK09982 | 142 | universal stress protein UspD; Provisional | 99.95 | |
| cd01989 | 146 | STK_N The N-terminal domain of Eukaryotic Serine T | 99.95 | |
| PRK15118 | 144 | universal stress global response regulator UspA; P | 99.94 | |
| PF00582 | 140 | Usp: Universal stress protein family; InterPro: IP | 99.94 | |
| PRK10116 | 142 | universal stress protein UspC; Provisional | 99.93 | |
| cd01988 | 132 | Na_H_Antiporter_C The C-terminal domain of a subfa | 99.93 | |
| PRK11175 | 305 | universal stress protein UspE; Provisional | 99.92 | |
| cd01987 | 124 | USP_OKCHK USP domain is located between the N-term | 99.91 | |
| PRK11175 | 305 | universal stress protein UspE; Provisional | 99.88 | |
| cd00293 | 130 | USP_Like Usp: Universal stress protein family. The | 99.87 | |
| COG0589 | 154 | UspA Universal stress protein UspA and related nuc | 99.86 | |
| PRK12652 | 357 | putative monovalent cation/H+ antiporter subunit E | 99.74 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 99.55 | |
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 99.51 | |
| cd01984 | 86 | AANH_like Adenine nucleotide alpha hydrolases supe | 98.81 | |
| PLN03159 | 832 | cation/H(+) antiporter 15; Provisional | 98.26 | |
| TIGR02432 | 189 | lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t | 97.81 | |
| PF01171 | 182 | ATP_bind_3: PP-loop family; InterPro: IPR011063 Th | 97.72 | |
| cd01992 | 185 | PP-ATPase N-terminal domain of predicted ATPase of | 97.49 | |
| PLN03159 | 832 | cation/H(+) antiporter 15; Provisional | 97.47 | |
| cd01993 | 185 | Alpha_ANH_like_II This is a subfamily of Adenine n | 97.03 | |
| PRK12342 | 254 | hypothetical protein; Provisional | 96.89 | |
| PRK03359 | 256 | putative electron transfer flavoprotein FixA; Revi | 96.7 | |
| COG0037 | 298 | MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle | 96.67 | |
| PF01012 | 164 | ETF: Electron transfer flavoprotein domain; InterP | 96.31 | |
| COG2086 | 260 | FixA Electron transfer flavoprotein, beta subunit | 96.14 | |
| PRK10696 | 258 | tRNA 2-thiocytidine biosynthesis protein TtcA; Pro | 96.08 | |
| PRK10660 | 436 | tilS tRNA(Ile)-lysidine synthetase; Provisional | 95.87 | |
| PRK05253 | 301 | sulfate adenylyltransferase subunit 2; Provisional | 95.65 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.14 | |
| PRK07313 | 182 | phosphopantothenoylcysteine decarboxylase; Validat | 95.07 | |
| TIGR00268 | 252 | conserved hypothetical protein TIGR00268. The N-te | 94.87 | |
| cd01995 | 169 | ExsB ExsB is a transcription regulator related pro | 94.83 | |
| TIGR00591 | 454 | phr2 photolyase PhrII. All proteins in this family | 94.82 | |
| PRK13820 | 394 | argininosuccinate synthase; Provisional | 94.77 | |
| cd01985 | 181 | ETF The electron transfer flavoprotein (ETF) serve | 94.35 | |
| PRK14665 | 360 | mnmA tRNA-specific 2-thiouridylase MnmA; Provision | 94.27 | |
| COG1927 | 277 | Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet | 94.19 | |
| cd01990 | 202 | Alpha_ANH_like_I This is a subfamily of Adenine nu | 93.96 | |
| TIGR02039 | 294 | CysD sulfate adenylyltransferase, small subunit. I | 93.95 | |
| COG0041 | 162 | PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m | 93.78 | |
| cd01713 | 173 | PAPS_reductase This domain is found in phosphoaden | 93.77 | |
| TIGR02113 | 177 | coaC_strep phosphopantothenoylcysteine decarboxyla | 93.44 | |
| TIGR02852 | 187 | spore_dpaB dipicolinic acid synthetase, B subunit. | 93.29 | |
| KOG1650 | 769 | consensus Predicted K+/H+-antiporter [Inorganic io | 93.27 | |
| TIGR01162 | 156 | purE phosphoribosylaminoimidazole carboxylase, Pur | 93.16 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 93.0 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 92.66 | |
| PF00875 | 165 | DNA_photolyase: DNA photolyase from Prosite.; Inte | 92.03 | |
| PRK00779 | 304 | ornithine carbamoyltransferase; Provisional | 92.0 | |
| COG0299 | 200 | PurN Folate-dependent phosphoribosylglycinamide fo | 92.0 | |
| PRK08305 | 196 | spoVFB dipicolinate synthase subunit B; Reviewed | 91.77 | |
| PRK12563 | 312 | sulfate adenylyltransferase subunit 2; Provisional | 91.76 | |
| PF02601 | 319 | Exonuc_VII_L: Exonuclease VII, large subunit; Inte | 91.34 | |
| PF00731 | 150 | AIRC: AIR carboxylase; InterPro: IPR000031 Phospho | 91.19 | |
| TIGR00342 | 371 | thiazole biosynthesis/tRNA modification protein Th | 91.13 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 91.09 | |
| PRK00994 | 277 | F420-dependent methylenetetrahydromethanopterin de | 90.71 | |
| PLN00200 | 404 | argininosuccinate synthase; Provisional | 90.66 | |
| PRK13982 | 475 | bifunctional SbtC-like/phosphopantothenoylcysteine | 90.51 | |
| cd01986 | 103 | Alpha_ANH_like Adenine nucleotide alpha hydrolases | 90.51 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 90.38 | |
| TIGR00032 | 394 | argG argininosuccinate synthase. argG in bacteria, | 90.14 | |
| TIGR03556 | 471 | photolyase_8HDF deoxyribodipyrimidine photo-lyase, | 89.82 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 89.81 | |
| TIGR00884 | 311 | guaA_Cterm GMP synthase (glutamine-hydrolyzing), C | 89.57 | |
| PRK00143 | 346 | mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed | 89.3 | |
| cd01712 | 177 | ThiI ThiI is required for thiazole synthesis in th | 89.19 | |
| cd01994 | 194 | Alpha_ANH_like_IV This is a subfamily of Adenine n | 89.07 | |
| PRK09590 | 104 | celB cellobiose phosphotransferase system IIB comp | 88.34 | |
| TIGR02765 | 429 | crypto_DASH cryptochrome, DASH family. Photolyases | 88.32 | |
| PRK06029 | 185 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov | 87.67 | |
| PF12683 | 275 | DUF3798: Protein of unknown function (DUF3798); In | 87.07 | |
| PRK00074 | 511 | guaA GMP synthase; Reviewed | 86.83 | |
| PRK08576 | 438 | hypothetical protein; Provisional | 86.51 | |
| TIGR02699 | 174 | archaeo_AfpA archaeoflavoprotein AfpA. The prototy | 86.29 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 85.92 | |
| TIGR00521 | 390 | coaBC_dfp phosphopantothenoylcysteine decarboxylas | 85.92 | |
| cd05565 | 99 | PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en | 85.39 | |
| TIGR00853 | 95 | pts-lac PTS system, lactose/cellobiose family IIB | 85.33 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 85.25 | |
| cd01997 | 295 | GMP_synthase_C The C-terminal domain of GMP synthe | 85.22 | |
| ), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844 | 100 | GARS_N: Phosphoribosylglycinamide synthetase, N do | 84.66 | |
| PRK00919 | 307 | GMP synthase subunit B; Validated | 84.64 | |
| cd01715 | 168 | ETF_alpha The electron transfer flavoprotein (ETF) | 84.59 | |
| PRK00109 | 138 | Holliday junction resolvase-like protein; Reviewed | 84.29 | |
| TIGR00420 | 352 | trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me | 83.91 | |
| PRK08349 | 198 | hypothetical protein; Validated | 83.61 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 83.23 | |
| TIGR00237 | 432 | xseA exodeoxyribonuclease VII, large subunit. This | 83.11 | |
| KOG1467 | 556 | consensus Translation initiation factor 2B, delta | 83.05 | |
| COG1606 | 269 | ATP-utilizing enzymes of the PP-loop superfamily [ | 82.56 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 82.54 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 82.45 | |
| PF03652 | 135 | UPF0081: Uncharacterised protein family (UPF0081); | 82.08 | |
| PRK11070 | 575 | ssDNA exonuclease RecJ; Provisional | 81.95 | |
| COG1597 | 301 | LCB5 Sphingosine kinase and enzymes related to euk | 81.46 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 81.2 | |
| TIGR00930 | 953 | 2a30 K-Cl cotransporter. | 81.14 | |
| COG1570 | 440 | XseA Exonuclease VII, large subunit [DNA replicati | 80.99 | |
| PRK11914 | 306 | diacylglycerol kinase; Reviewed | 80.6 | |
| PRK14664 | 362 | tRNA-specific 2-thiouridylase MnmA; Provisional | 80.57 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 80.41 | |
| cd05564 | 96 | PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic | 80.2 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 80.16 | |
| COG2876 | 286 | AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( | 80.08 |
| >PRK15005 universal stress protein F; Provisional | Back alignment and domain information |
|---|
Probab=99.95 E-value=2.1e-27 Score=155.80 Aligned_cols=141 Identities=18% Similarity=0.253 Sum_probs=103.6
Q ss_pred CcEEEEEecCChh--hHHHHHHHHHHhccCCCeEEEEEEeCCCCCcccccccccCCCCCCChhhHHHhhhhhhhcCCCCh
Q 031202 4 ARTVGVGMDNSPN--SKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPLVPLEEFREINFSKQYGLTSNP 81 (164)
Q Consensus 4 ~~~ILv~~d~s~~--s~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (164)
|++||+|+|+|+. +..|+++|..+|+..+++++++||.++...... .+...... ....+... +..+
T Consensus 2 ~~~ILv~~D~s~~~~~~~a~~~a~~la~~~~~~l~ll~v~~~~~~~~~------~~~~~~~~--~~~~~~~~----~~~~ 69 (144)
T PRK15005 2 NRTILVPIDISDSELTQRVISHVEAEAKIDDAEVHFLTVIPSLPYYAS------LGLAYSAE--LPAMDDLK----AEAK 69 (144)
T ss_pred CccEEEecCCCchhHHHHHHHHHHHHHhccCCeEEEEEEEccCccccc------cccccccc--chHHHHHH----HHHH
Confidence 7999999999997 579999999999999999999999976432110 00000000 00000001 1122
Q ss_pred hHHHHHHHHhhhcCceEEEEEeeCChhhHHHHHHHhcCCCEEEEeecCCccccceeeccchhHHhcCCCccEEEEe
Q 031202 82 EVLDILDTLSRTKGAKVVAKVYWGDPREKLCDAVEDLKLDTLVVGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVK 157 (164)
Q Consensus 82 ~~~~~~~~~~~~~~~~~~~~v~~g~~~~~I~~~a~~~~~dliv~g~~~~~~~~~~~~gs~~~~v~~~~~~pVliv~ 157 (164)
+.++.+.+.+...+++++.++..|++.+.|++++++.++||||||++ ++++.+.++||++++|+++++||||++|
T Consensus 70 ~~l~~~~~~~~~~~~~~~~~v~~G~p~~~I~~~a~~~~~DLIV~Gs~-~~~~~~~llGS~a~~vl~~a~cpVlvVr 144 (144)
T PRK15005 70 SQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPADMIIIASH-RPDITTYLLGSNAAAVVRHAECSVLVVR 144 (144)
T ss_pred HHHHHHHHHhCCCCCceEEEEeCCCHHHHHHHHHHHcCCCEEEEeCC-CCCchheeecchHHHHHHhCCCCEEEeC
Confidence 33333333444456778888999999999999999999999999988 4567888999999999999999999986
|
|
| >PRK15456 universal stress protein UspG; Provisional | Back alignment and domain information |
|---|
| >PRK09982 universal stress protein UspD; Provisional | Back alignment and domain information |
|---|
| >cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases | Back alignment and domain information |
|---|
| >PRK15118 universal stress global response regulator UspA; Provisional | Back alignment and domain information |
|---|
| >PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents | Back alignment and domain information |
|---|
| >PRK10116 universal stress protein UspC; Provisional | Back alignment and domain information |
|---|
| >cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea | Back alignment and domain information |
|---|
| >PRK11175 universal stress protein UspE; Provisional | Back alignment and domain information |
|---|
| >cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family | Back alignment and domain information |
|---|
| >PRK11175 universal stress protein UspE; Provisional | Back alignment and domain information |
|---|
| >cd00293 USP_Like Usp: Universal stress protein family | Back alignment and domain information |
|---|
| >COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) | Back alignment and domain information |
|---|
| >PLN03159 cation/H(+) antiporter 15; Provisional | Back alignment and domain information |
|---|
| >TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain | Back alignment and domain information |
|---|
| >PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] | Back alignment and domain information |
|---|
| >cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03159 cation/H(+) antiporter 15; Provisional | Back alignment and domain information |
|---|
| >cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >PRK12342 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03359 putative electron transfer flavoprotein FixA; Reviewed | Back alignment and domain information |
|---|
| >COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems | Back alignment and domain information |
|---|
| >COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional | Back alignment and domain information |
|---|
| >PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05253 sulfate adenylyltransferase subunit 2; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK07313 phosphopantothenoylcysteine decarboxylase; Validated | Back alignment and domain information |
|---|
| >TIGR00268 conserved hypothetical protein TIGR00268 | Back alignment and domain information |
|---|
| >cd01995 ExsB ExsB is a transcription regulator related protein | Back alignment and domain information |
|---|
| >TIGR00591 phr2 photolyase PhrII | Back alignment and domain information |
|---|
| >PRK13820 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases | Back alignment and domain information |
|---|
| >PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional | Back alignment and domain information |
|---|
| >COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >TIGR02039 CysD sulfate adenylyltransferase, small subunit | Back alignment and domain information |
|---|
| >COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase | Back alignment and domain information |
|---|
| >TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal | Back alignment and domain information |
|---|
| >TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit | Back alignment and domain information |
|---|
| >KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >PF00875 DNA_photolyase: DNA photolyase from Prosite | Back alignment and domain information |
|---|
| >PRK00779 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed | Back alignment and domain information |
|---|
| >PRK12563 sulfate adenylyltransferase subunit 2; Provisional | Back alignment and domain information |
|---|
| >PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 | Back alignment and domain information |
|---|
| >PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE | Back alignment and domain information |
|---|
| >TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00200 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional | Back alignment and domain information |
|---|
| >cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR00032 argG argininosuccinate synthase | Back alignment and domain information |
|---|
| >TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit | Back alignment and domain information |
|---|
| >PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed | Back alignment and domain information |
|---|
| >cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway | Back alignment and domain information |
|---|
| >cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02765 crypto_DASH cryptochrome, DASH family | Back alignment and domain information |
|---|
| >PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional | Back alignment and domain information |
|---|
| >PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria | Back alignment and domain information |
|---|
| >PRK00074 guaA GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK08576 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic | Back alignment and domain information |
|---|
| >cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria | Back alignment and domain information |
|---|
| >TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase | Back alignment and domain information |
|---|
| >PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >PRK00919 GMP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases | Back alignment and domain information |
|---|
| >PRK00109 Holliday junction resolvase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase | Back alignment and domain information |
|---|
| >PRK08349 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00237 xseA exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination | Back alignment and domain information |
|---|
| >PRK11070 ssDNA exonuclease RecJ; Provisional | Back alignment and domain information |
|---|
| >COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00930 2a30 K-Cl cotransporter | Back alignment and domain information |
|---|
| >COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11914 diacylglycerol kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 164 | ||||
| 2gm3_A | 175 | Crystal Structure Of An Universal Stress Protein Fa | 1e-13 | ||
| 1wjg_A | 137 | Crystal Structure Of A Probable Atp Binding Protein | 6e-08 | ||
| 1mjh_A | 162 | Structure-Based Assignment Of The Biochemical Funct | 1e-06 | ||
| 3tnj_A | 150 | Crystal Structure Of Universal Stress Protein From | 6e-05 | ||
| 2pfs_A | 150 | Crystal Structure Of Universal Stress Protein From | 6e-05 | ||
| 3loq_A | 294 | The Crystal Structure Of A Universal Stress Protein | 3e-04 | ||
| 3hgm_A | 147 | Universal Stress Protein Tead From The Trap Transpo | 7e-04 |
| >pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 | Back alignment and structure |
|
| >pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137 | Back alignment and structure |
| >pdb|1MJH|A Chain A, Structure-Based Assignment Of The Biochemical Function Of Hypothetical Protein Mj0577: A Test Case Of Structural Genomics Length = 162 | Back alignment and structure |
| >pdb|3TNJ|A Chain A, Crystal Structure Of Universal Stress Protein From Nitrosomonas Europaea With Amp Bound Length = 150 | Back alignment and structure |
| >pdb|2PFS|A Chain A, Crystal Structure Of Universal Stress Protein From Nitrosomonas Europaea Length = 150 | Back alignment and structure |
| >pdb|3LOQ|A Chain A, The Crystal Structure Of A Universal Stress Protein From Archaeoglobus Fulgidus Dsm 4304 Length = 294 | Back alignment and structure |
| >pdb|3HGM|A Chain A, Universal Stress Protein Tead From The Trap Transporter Teaabc Of Halomonas Elongata Length = 147 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| 2gm3_A | 175 | Unknown protein; AT3G01520, putative ethylene-resp | 8e-44 | |
| 3idf_A | 138 | USP-like protein; universal, stress, PSI, MCSG, st | 4e-30 | |
| 1tq8_A | 163 | Hypothetical protein RV1636; MTCY01B2.28, structur | 1e-27 | |
| 2z08_A | 137 | Universal stress protein family; uncharacterized c | 5e-26 | |
| 1mjh_A | 162 | Protein (ATP-binding domain of protein MJ0577); hy | 4e-25 | |
| 3s3t_A | 146 | Nucleotide-binding protein, universal stress PROT | 2e-23 | |
| 2dum_A | 170 | Hypothetical protein PH0823; conserved hypothetica | 4e-23 | |
| 3hgm_A | 147 | Universal stress protein TEAD; rossman fold, signa | 3e-22 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 3e-22 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 1e-20 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 1e-19 | |
| 3tnj_A | 150 | Universal stress protein (USP); structural genomic | 2e-20 | |
| 1jmv_A | 141 | USPA, universal stress protein A; chaperone; 1.85A | 5e-19 | |
| 3cis_A | 309 | Uncharacterized protein; alpha/beta hydrolase, ATP | 8e-19 | |
| 3cis_A | 309 | Uncharacterized protein; alpha/beta hydrolase, ATP | 5e-15 | |
| 3fg9_A | 156 | Protein of universal stress protein USPA family; A | 9e-18 | |
| 3fdx_A | 143 | Putative filament protein / universal stress PROT; | 2e-17 | |
| 3ab8_A | 268 | Putative uncharacterized protein TTHA0350; tandem- | 3e-16 | |
| 3ab8_A | 268 | Putative uncharacterized protein TTHA0350; tandem- | 2e-12 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 3e-13 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 3e-13 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 1e-12 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 1e-10 | |
| 1q77_A | 138 | Hypothetical protein AQ_178; structural genomics, | 2e-06 |
| >2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 | Back alignment and structure |
|---|
Score = 141 bits (358), Expect = 8e-44
Identities = 49/171 (28%), Positives = 80/171 (46%), Gaps = 20/171 (11%)
Query: 2 SKARTVGVGMDNS---------PNSKAALRWAADNLIDSGDL---IILIHVQPPNADHTR 49
S+ V V ++ S + K A W + ++ S I+L+HVQ + D
Sbjct: 3 SEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG-- 60
Query: 50 KQLFEDTGSPLVPLEEFREINFSKQYGLTSNPEVLDILDTLSRTKGAKVVAKVYWGDPRE 109
F+D S E+FR++ +Q +L+ G A + GDP++
Sbjct: 61 ---FDDVDSIYASPEDFRDM---RQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKD 114
Query: 110 KLCDAVEDLKLDTLVVGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVKGNP 160
+C V+ ++ D LVVGSRGLG ++V +G+VS V ++ CPV +K N
Sbjct: 115 VICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 165
|
| >3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 | Back alignment and structure |
|---|
| >1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 | Back alignment and structure |
|---|
| >2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 | Back alignment and structure |
|---|
| >1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 | Back alignment and structure |
|---|
| >3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 | Back alignment and structure |
|---|
| >2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 | Back alignment and structure |
|---|
| >3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 | Back alignment and structure |
|---|
| >3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 | Back alignment and structure |
|---|
| >1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 | Back alignment and structure |
|---|
| >3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 | Back alignment and structure |
|---|
| >3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 | Back alignment and structure |
|---|
| >3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 | Back alignment and structure |
|---|
| >3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 | Back alignment and structure |
|---|
| >3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 | Back alignment and structure |
|---|
| >3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 | Back alignment and structure |
|---|
| >1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| 3tnj_A | 150 | Universal stress protein (USP); structural genomic | 99.97 | |
| 3s3t_A | 146 | Nucleotide-binding protein, universal stress PROT | 99.97 | |
| 1mjh_A | 162 | Protein (ATP-binding domain of protein MJ0577); hy | 99.96 | |
| 2dum_A | 170 | Hypothetical protein PH0823; conserved hypothetica | 99.96 | |
| 3hgm_A | 147 | Universal stress protein TEAD; rossman fold, signa | 99.96 | |
| 3idf_A | 138 | USP-like protein; universal, stress, PSI, MCSG, st | 99.96 | |
| 3fg9_A | 156 | Protein of universal stress protein USPA family; A | 99.96 | |
| 1tq8_A | 163 | Hypothetical protein RV1636; MTCY01B2.28, structur | 99.96 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 99.96 | |
| 2z08_A | 137 | Universal stress protein family; uncharacterized c | 99.95 | |
| 2gm3_A | 175 | Unknown protein; AT3G01520, putative ethylene-resp | 99.94 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 99.94 | |
| 3fdx_A | 143 | Putative filament protein / universal stress PROT; | 99.94 | |
| 1jmv_A | 141 | USPA, universal stress protein A; chaperone; 1.85A | 99.94 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 99.93 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 99.92 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 99.91 | |
| 1q77_A | 138 | Hypothetical protein AQ_178; structural genomics, | 99.91 | |
| 3cis_A | 309 | Uncharacterized protein; alpha/beta hydrolase, ATP | 99.91 | |
| 3ab8_A | 268 | Putative uncharacterized protein TTHA0350; tandem- | 99.9 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 99.9 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 99.89 | |
| 3cis_A | 309 | Uncharacterized protein; alpha/beta hydrolase, ATP | 99.88 | |
| 3ab8_A | 268 | Putative uncharacterized protein TTHA0350; tandem- | 99.85 | |
| 2iel_A | 138 | Hypothetical protein TT0030; TT0030,thermus thermo | 97.56 | |
| 3a2k_A | 464 | TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, | 96.59 | |
| 1wy5_A | 317 | TILS, hypothetical UPF0072 protein AQ_1887; N-type | 96.54 | |
| 1zun_A | 325 | Sulfate adenylyltransferase subunit 2; beta barrel | 95.4 | |
| 3ih5_A | 217 | Electron transfer flavoprotein alpha-subunit; alph | 95.37 | |
| 3g40_A | 294 | Na-K-CL cotransporter; alpha/beta fold 10-stranded | 94.97 | |
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 94.95 | |
| 2xry_A | 482 | Deoxyribodipyrimidine photolyase; DNA damage, DNA | 94.85 | |
| 1o97_C | 264 | Electron transferring flavoprotein beta-subunit; F | 94.36 | |
| 1k92_A | 455 | Argininosuccinate synthase, argininosuccinate SY; | 94.16 | |
| 1efp_B | 252 | ETF, protein (electron transfer flavoprotein); ele | 94.11 | |
| 3k32_A | 203 | Uncharacterized protein MJ0690; predicted subunit | 94.11 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 94.09 | |
| 2nz2_A | 413 | Argininosuccinate synthase; amino-acid biosynthesi | 93.67 | |
| 4grd_A | 173 | N5-CAIR mutase, phosphoribosylaminoimidazole carbo | 93.67 | |
| 1ni5_A | 433 | Putative cell cycle protein MESJ; structural genom | 93.65 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 93.57 | |
| 1efv_B | 255 | Electron transfer flavoprotein; electron transport | 93.57 | |
| 3kcq_A | 215 | Phosphoribosylglycinamide formyltransferase; struc | 93.46 | |
| 1sur_A | 215 | PAPS reductase; assimilatory sulfate reduction, 3- | 93.43 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 93.32 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 93.03 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 92.94 | |
| 3g40_A | 294 | Na-K-CL cotransporter; alpha/beta fold 10-stranded | 92.77 | |
| 3bl5_A | 219 | Queuosine biosynthesis protein QUEC; PREQ1 biosynt | 92.61 | |
| 3umv_A | 506 | Deoxyribodipyrimidine photo-lyase; CPD cyclobutane | 92.36 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 92.36 | |
| 3zqu_A | 209 | Probable aromatic acid decarboxylase; lyase; HET: | 92.14 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 91.94 | |
| 2hma_A | 376 | Probable tRNA (5-methylaminomethyl-2-thiouridylat | 91.86 | |
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 91.75 | |
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 91.53 | |
| 2oq2_A | 261 | Phosphoadenosine phosphosulfate reductase; sulfate | 91.08 | |
| 3rjz_A | 237 | N-type ATP pyrophosphatase superfamily; structural | 91.0 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 90.47 | |
| 2wsi_A | 306 | FAD synthetase; transferase, nucleotidyltransferas | 90.45 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 90.37 | |
| 2wq7_A | 543 | RE11660P; lyase-DNA complex, DNA repair, DNA lesio | 90.3 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 89.98 | |
| 1iv0_A | 98 | Hypothetical protein; rnaseh-like, YQGF, structura | 89.86 | |
| 3p9x_A | 211 | Phosphoribosylglycinamide formyltransferase; struc | 89.39 | |
| 2dpl_A | 308 | GMP synthetase, GMP synthase [glutamine-hydrolyzin | 89.04 | |
| 2c5s_A | 413 | THII, probable thiamine biosynthesis protein THII; | 88.39 | |
| 2der_A | 380 | TRNA-specific 2-thiouridylase MNMA; protein-RNA co | 87.98 | |
| 3da8_A | 215 | Probable 5'-phosphoribosylglycinamide formyltransf | 87.42 | |
| 1np7_A | 489 | DNA photolyase; protein with FAD cofactor; HET: DN | 87.29 | |
| 1kor_A | 400 | Argininosuccinate synthetase; ligase, riken struct | 86.69 | |
| 1vbk_A | 307 | Hypothetical protein PH1313; structural genomics, | 86.01 | |
| 2o8v_A | 252 | Phosphoadenosine phosphosulfate reductase; disulfi | 86.01 | |
| 1g63_A | 181 | Epidermin modifying enzyme EPID; alpha, beta prote | 85.87 | |
| 2pg3_A | 232 | Queuosine biosynthesis protein QUEC; YP_049261.1, | 85.56 | |
| 3nbm_A | 108 | PTS system, lactose-specific IIBC components; PTS_ | 84.32 | |
| 2l69_A | 134 | Rossmann 2X3 fold protein; structural genomics, no | 84.25 | |
| 4ds3_A | 209 | Phosphoribosylglycinamide formyltransferase; struc | 84.2 | |
| 2ejb_A | 189 | Probable aromatic acid decarboxylase; phenylacryli | 84.08 | |
| 3fy4_A | 537 | 6-4 photolyase; DNA repair, clock cryptochrome; HE | 83.97 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 83.68 | |
| 1owl_A | 484 | Photolyase, deoxyribodipyrimidine photolyase; DNA | 83.32 | |
| 3tvs_A | 538 | Cryptochrome-1; circadian clock light entrainment, | 82.42 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 82.38 | |
| 3tqr_A | 215 | Phosphoribosylglycinamide formyltransferase; purin | 80.98 | |
| 2ywr_A | 216 | Phosphoribosylglycinamide formyltransferase; rossm | 80.88 | |
| 3r7f_A | 304 | Aspartate carbamoyltransferase; aspartate transcar | 80.71 |
| >3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=1.4e-29 Score=166.02 Aligned_cols=146 Identities=24% Similarity=0.289 Sum_probs=102.3
Q ss_pred CCCCcEEEEEecCChhhHHHHHHHHHHhccCCCeEEEEEEeCCCCCcccccccccCCCCCCChhhHHHhhhhhhhcCCCC
Q 031202 1 MSKARTVGVGMDNSPNSKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPLVPLEEFREINFSKQYGLTSN 80 (164)
Q Consensus 1 m~~~~~ILv~~d~s~~s~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (164)
||++++|||++|+|+.+..++++|+.+|+..+++|+++||.++....... ..+........... +..
T Consensus 3 m~~~~~ILv~vD~s~~s~~al~~a~~la~~~~a~l~ll~v~~~~~~~~~~----~~~~~~~~~~~~~~---------~~~ 69 (150)
T 3tnj_A 3 MSVYHHILLAVDFSSEDSQVVQKVRNLASQIGARLSLIHVLDNIPMPDTP----YGTAIPLDTETTYD---------AML 69 (150)
T ss_dssp -CCCSEEEEECCCSTTHHHHHHHHHHHHHHHTCEEEEEEEEC------------CTTCCCSSSCCCHH---------HHH
T ss_pred CCccceEEEEeCCCHHHHHHHHHHHHHHhhcCCEEEEEEEEcCccccccc----cccccCcCHHHHHH---------HHH
Confidence 88999999999999999999999999999999999999999875431100 00000000000100 112
Q ss_pred hhHHHHHHHHhhhcCce-EEEEEeeCChhhHHHHHHHhcCCCEEEEeecCCccccceeeccchhHHhcCCCccEEEEeCC
Q 031202 81 PEVLDILDTLSRTKGAK-VVAKVYWGDPREKLCDAVEDLKLDTLVVGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVKGN 159 (164)
Q Consensus 81 ~~~~~~~~~~~~~~~~~-~~~~v~~g~~~~~I~~~a~~~~~dliv~g~~~~~~~~~~~~gs~~~~v~~~~~~pVliv~~~ 159 (164)
++..+.+.+.+...|+. +++.+..|++.++|++++++.++|+||||+++++.+. +++||++++|+++++|||++||++
T Consensus 70 ~~~~~~l~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dliV~G~~~~~~~~-~~~Gs~~~~vl~~~~~pVlvv~~~ 148 (150)
T 3tnj_A 70 DVEKQKLSQIGNTLGIDPAHRWLVWGEPREEIIRIAEQENVDLIVVGSHGRHGLA-LLLGSTANSVLHYAKCDVLAVRLR 148 (150)
T ss_dssp HHHHHHHHHHHHHHTCCGGGEEEEESCHHHHHHHHHHHTTCSEEEEEEC---------CCCHHHHHHHHCSSEEEEEECC
T ss_pred HHHHHHHHHHHHHcCCCcceEEEecCCHHHHHHHHHHHcCCCEEEEecCCCCCcC-eEecchHHHHHHhCCCCEEEEeCC
Confidence 34455555556666776 4677889999999999999999999999999999888 999999999999999999999975
Q ss_pred C
Q 031202 160 P 160 (164)
Q Consensus 160 ~ 160 (164)
.
T Consensus 149 ~ 149 (150)
T 3tnj_A 149 D 149 (150)
T ss_dssp C
T ss_pred C
Confidence 3
|
| >3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* | Back alignment and structure |
|---|
| >2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A | Back alignment and structure |
|---|
| >2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} | Back alignment and structure |
|---|
| >3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* | Back alignment and structure |
|---|
| >1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* | Back alignment and structure |
|---|
| >3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} | Back alignment and structure |
|---|
| >3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* | Back alignment and structure |
|---|
| >3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* | Back alignment and structure |
|---|
| >2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* | Back alignment and structure |
|---|
| >1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 | Back alignment and structure |
|---|
| >3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* | Back alignment and structure |
|---|
| >1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* | Back alignment and structure |
|---|
| >1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* | Back alignment and structure |
|---|
| >1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 | Back alignment and structure |
|---|
| >3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* | Back alignment and structure |
|---|
| >2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* | Back alignment and structure |
|---|
| >3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 | Back alignment and structure |
|---|
| >3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A | Back alignment and structure |
|---|
| >2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* | Back alignment and structure |
|---|
| >2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* | Back alignment and structure |
|---|
| >2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A | Back alignment and structure |
|---|
| >2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 | Back alignment and structure |
|---|
| >2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* | Back alignment and structure |
|---|
| >3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* | Back alignment and structure |
|---|
| >1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 | Back alignment and structure |
|---|
| >1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* | Back alignment and structure |
|---|
| >1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1 | Back alignment and structure |
|---|
| >2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* | Back alignment and structure |
|---|
| >2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 | Back alignment and structure |
|---|
| >3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} | Back alignment and structure |
|---|
| >4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 164 | ||||
| d2gm3a1 | 171 | c.26.2.4 (A:5-175) Putative ethylene-responsive pr | 9e-28 | |
| d1mjha_ | 160 | c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa | 3e-22 | |
| d1tq8a_ | 147 | c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac | 3e-22 | |
| d2z3va1 | 135 | c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { | 4e-21 | |
| d1jmva_ | 140 | c.26.2.4 (A:) Universal stress protein A, UspA {Ha | 4e-16 | |
| d1q77a_ | 138 | c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex | 4e-12 |
| >d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Adenine nucleotide alpha hydrolases-like family: Universal stress protein-like domain: Putative ethylene-responsive protein AT3g01520/F4P13 7 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 99.6 bits (247), Expect = 9e-28
Identities = 48/168 (28%), Positives = 78/168 (46%), Gaps = 20/168 (11%)
Query: 5 RTVGVGMDNS---------PNSKAALRWAADNLIDSGD---LIILIHVQPPNADHTRKQL 52
V V ++ S + K A W + ++ S I+L+HVQ + D
Sbjct: 2 TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG----- 56
Query: 53 FEDTGSPLVPLEEFREINFSKQYGLTSNPEVLDILDTLSRTKGAKVVAKVYWGDPREKLC 112
F+D S E+FR++ +Q +L+ G A + GDP++ +C
Sbjct: 57 FDDVDSIYASPEDFRDM---RQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVIC 113
Query: 113 DAVEDLKLDTLVVGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVKGNP 160
V+ ++ D LVVGSRGLG ++V +G+VS V ++ CPV +K N
Sbjct: 114 QEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 161
|
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 | Back information, alignment and structure |
|---|
| >d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 | Back information, alignment and structure |
|---|
| >d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 | Back information, alignment and structure |
|---|
| >d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 | Back information, alignment and structure |
|---|
| >d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| d1mjha_ | 160 | "Hypothetical" protein MJ0577 {Archaeon Methanococ | 100.0 | |
| d1tq8a_ | 147 | Hypothetical protein Rv1636 {Mycobacterium tubercu | 99.96 | |
| d2z3va1 | 135 | Hypothetical protein TTHA0895 {Thermus thermophilu | 99.95 | |
| d2gm3a1 | 171 | Putative ethylene-responsive protein AT3g01520/F4P | 99.95 | |
| d1jmva_ | 140 | Universal stress protein A, UspA {Haemophilus infl | 99.94 | |
| d1q77a_ | 138 | Hypothetical protein Aq_178 {Aquifex aeolicus [Tax | 99.9 | |
| d1wy5a1 | 216 | TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId | 97.12 | |
| d3clsc1 | 262 | Small, beta subunit of electron transfer flavoprot | 96.64 | |
| d1efpb_ | 246 | Small, beta subunit of electron transfer flavoprot | 96.49 | |
| d1ni5a1 | 227 | tRNA-Ile-lysidine synthetase, TilS, N-terminal dom | 96.19 | |
| d1np7a2 | 204 | Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: | 95.43 | |
| d1efvb_ | 252 | Small, beta subunit of electron transfer flavoprot | 94.37 | |
| d1u11a_ | 159 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 94.36 | |
| d1xmpa_ | 155 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 94.13 | |
| d1o4va_ | 169 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 93.8 | |
| d1qcza_ | 163 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 93.44 | |
| d1p3y1_ | 183 | MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} | 93.21 | |
| d2j07a2 | 170 | DNA photolyase {Thermus thermophilus [TaxId: 274]} | 91.82 | |
| d1owla2 | 202 | DNA photolyase {Synechococcus elongatus [TaxId: 32 | 91.62 | |
| d1vbka1 | 132 | Hypothetical protein PH1313, C-terminal domain {Ar | 91.61 | |
| d2c5sa1 | 218 | Thiamine biosynthesis protein ThiI, C-terminal dom | 91.49 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 91.37 | |
| d1g5qa_ | 174 | Epidermin modifying enzyme (peptidyl-cysteine deca | 91.3 | |
| d3clsd1 | 192 | Large, alpha subunit of electron transfer flavopro | 90.46 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 88.92 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 88.62 | |
| d2pjua1 | 186 | Propionate catabolism operon regulatory protein Pr | 88.11 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 86.13 | |
| d1xkya1 | 292 | Dihydrodipicolinate synthase {Bacillus anthracis [ | 85.74 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 84.88 | |
| d2d13a1 | 226 | Hypothetical protein PH1257 {Archaeon Pyrococcus h | 84.62 | |
| d2at2a1 | 144 | Aspartate carbamoyltransferase catalytic subunit { | 84.61 | |
| d1ycga1 | 149 | Nitric oxide reductase C-terminal domain {Moorella | 84.05 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 83.58 | |
| d1qzua_ | 181 | 4'-phosphopantothenoylcysteine decarboxylase (PPC | 83.51 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 83.37 | |
| d1gsoa2 | 105 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 83.26 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 82.7 | |
| d1zuna1 | 211 | Sulfate adenylyltransferase subunit 2, CysD {Pseud | 82.56 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 81.13 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 81.02 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 80.9 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 80.57 | |
| d2bona1 | 295 | Lipid kinase YegS {Escherichia coli [TaxId: 562]} | 80.37 |
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Adenine nucleotide alpha hydrolases-like family: Universal stress protein-like domain: "Hypothetical" protein MJ0577 species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=100.00 E-value=5.6e-34 Score=187.62 Aligned_cols=157 Identities=25% Similarity=0.287 Sum_probs=121.6
Q ss_pred CCCcEEEEEecCChhhHHHHHHHHHHhccCCCeEEEEEEeCCCCCcccccccccCCCCCC--ChhhHHHhhhhhhhcCCC
Q 031202 2 SKARTVGVGMDNSPNSKAALRWAADNLIDSGDLIILIHVQPPNADHTRKQLFEDTGSPLV--PLEEFREINFSKQYGLTS 79 (164)
Q Consensus 2 ~~~~~ILv~~d~s~~s~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~ 79 (164)
+|||+||||+|+|+.++.++++|..+|+..+++|+++||.++.............+.... ....+.. ...+...+.
T Consensus 1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~ 78 (160)
T d1mjha_ 1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFEN--ELKNKLTEE 78 (160)
T ss_dssp CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHH--HHHHHHHHH
T ss_pred CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHH--HHHHHHHHH
Confidence 469999999999999999999999999999999999999877654332211111211111 1111111 222333344
Q ss_pred ChhHHHHHHHHhhhcCceEEEEEeeCChhhHHHHHHHhcCCCEEEEeecCCccccceeeccchhHHhcCCCccEEEEeCC
Q 031202 80 NPEVLDILDTLSRTKGAKVVAKVYWGDPREKLCDAVEDLKLDTLVVGSRGLGALKRVLLGSVSNHVVTNSSCPVTVVKGN 159 (164)
Q Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~v~~g~~~~~I~~~a~~~~~dliv~g~~~~~~~~~~~~gs~~~~v~~~~~~pVliv~~~ 159 (164)
.++.++.+.+.+...|+++++.+..|++.++|++++++.++|+||||+++++.+.++++||++++|+++++|||||||++
T Consensus 79 ~~~~l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~~ 158 (160)
T d1mjha_ 79 AKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRK 158 (160)
T ss_dssp HHHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECCC
T ss_pred HHHHHHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcCC
Confidence 56677777788888899999999999999999999999999999999999999999999999999999999999999987
Q ss_pred C
Q 031202 160 P 160 (164)
Q Consensus 160 ~ 160 (164)
.
T Consensus 159 ~ 159 (160)
T d1mjha_ 159 N 159 (160)
T ss_dssp C
T ss_pred C
Confidence 5
|
| >d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} | Back information, alignment and structure |
|---|
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} | Back information, alignment and structure |
|---|
| >d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]} | Back information, alignment and structure |
|---|
| >d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2at2a1 c.78.1.1 (A:1-144) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1qzua_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|