Citrus Sinensis ID: 031261

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MASVAGTIGANGSSGSSSSWTQLKNMKKKKMMMGRVKVICSASYSSSSSSVMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI
ccccccEEcccccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccc
cccEEEEEcccccccccccHHHHccccHcccccccEEEEEEEcccccccccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccHHcccccHHHHHccccccccccccccccccccHHHHHccccccccccccccccccc
masvagtigangssgsssswTQLKNMKKKKMMMGRVKVICSAsyssssssvmdpyktlriqrgasESEVKKAFRQLALQyhpdvcrgnncgvqFHLINEAYDMVMNNfreepnepeimyqpydggidepfrgmndpdwdlWEEWmgwegagirdysshvnpyi
masvagtigangssgsssswtQLKNMKKKKMMMGRVKVICSAsyssssssvmdpYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI
MASVAGTIGANgssgssssWTQLKNmkkkkmmmGRVKVICsasyssssssVMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI
*************************************VI*******************************KAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFR******EIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDY********
*************************************************SVMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREE**E*********************PDWDLWEEWMGWEGAGIRDYS**V*PYI
**********************LKNMKKKKMMMGRVKVICSA**********DPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI
**SVA**************W**LKNMK*****MGRVKVICSASYSSSSSSVMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEP*EPEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVAGTIGANGSSGSSSSWTQLKNMKKKKMMMGRVKVICSASYSSSSSSVMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query163 2.2.26 [Sep-21-2011]
Q9SAG8163 Chaperone protein dnaJ 8, yes no 0.938 0.938 0.589 4e-40
O66921 376 Chaperone protein DnaJ 2 yes no 0.368 0.159 0.433 3e-09
A7NS65 370 Chaperone protein DnaJ OS yes no 0.319 0.140 0.519 6e-09
A5UYW4 370 Chaperone protein DnaJ OS yes no 0.319 0.140 0.519 7e-09
Q9KJT8 368 Chaperone protein DnaJ OS N/A no 0.564 0.25 0.290 1e-08
B2TLZ8 373 Chaperone protein DnaJ OS yes no 0.319 0.139 0.509 3e-08
B2V2I6 373 Chaperone protein DnaJ OS yes no 0.319 0.139 0.509 3e-08
P30725 374 Chaperone protein DnaJ OS yes no 0.319 0.139 0.509 3e-08
Q65U54 376 Chaperone protein DnaJ OS yes no 0.337 0.146 0.428 4e-08
Q98DD2 376 Chaperone protein DnaJ OS yes no 0.331 0.143 0.490 4e-08
>sp|Q9SAG8|DNAJ8_ARATH Chaperone protein dnaJ 8, chloroplastic OS=Arabidopsis thaliana GN=ATJ8 PE=2 SV=1 Back     alignment and function desciption
 Score =  163 bits (413), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 99/168 (58%), Positives = 117/168 (69%), Gaps = 15/168 (8%)

Query: 3   SVAGTIGANGSSG-------SSSSWTQLKNMKKKKM-MMGRVKVICSASYSSSSSSVMDP 54
           ++A TIG NG SG       SSSS  +LKN ++K   M+ R     S    SSSSSVMDP
Sbjct: 2   TIALTIGGNGFSGLPGSSFSSSSSSFRLKNSRRKNTKMLNR-----SKVVCSSSSSVMDP 56

Query: 55  YKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNE 114
           YKTL+I+  +SE EVKKAFRQLA +YHPDVCRG+NCGVQF  INEAYD+V+   + +   
Sbjct: 57  YKTLKIRPDSSEYEVKKAFRQLAKKYHPDVCRGSNCGVQFQTINEAYDIVLKQIKNQMEG 116

Query: 115 PEIMYQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPY 162
            E  ++P+D   DE   GMNDPD D WEEWMGWEGAG RDYSSHVNPY
Sbjct: 117 TE-EFEPFD-VYDEGLNGMNDPDCDTWEEWMGWEGAGTRDYSSHVNPY 162
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 Back     alignment and function description
>sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9KJT8|DNAJ_PEWBP Chaperone protein DnaJ OS=Peanut witches'-broom phytoplasma GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 Back     alignment and function description
>sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 Back     alignment and function description
>sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
224075716172 predicted protein [Populus trichocarpa] 0.993 0.941 0.727 1e-61
255543349164 Chaperone protein dnaJ 8, chloroplast pr 0.950 0.945 0.711 2e-61
145688390159 putative DnaJ protein [Camellia sinensis 0.963 0.987 0.745 3e-61
118489744170 unknown [Populus trichocarpa x Populus d 0.987 0.947 0.709 2e-60
224115764162 predicted protein [Populus trichocarpa] 0.944 0.950 0.717 4e-59
388497078155 unknown [Lotus japonicus] 0.944 0.993 0.682 8e-58
356523203156 PREDICTED: chaperone protein dnaJ 8, chl 0.950 0.993 0.693 2e-56
255637318156 unknown [Glycine max] 0.950 0.993 0.687 3e-55
350539992161 heat shock protein binding protein [Sola 0.963 0.975 0.622 6e-52
359806152153 uncharacterized protein LOC100804784 [Gl 0.871 0.928 0.721 8e-52
>gi|224075716|ref|XP_002304733.1| predicted protein [Populus trichocarpa] gi|222842165|gb|EEE79712.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/169 (72%), Positives = 140/169 (82%), Gaps = 7/169 (4%)

Query: 2   ASVAGTIGANGSSGSSSSWTQLKNMKKKK----MMMGRVKVICSASYSSSSSSVMDPYKT 57
           A+  G +G NG + SSSSW Q+KN +KK     M   RV++ C++SYSSSSSSVMDPYKT
Sbjct: 4   AAAVGMMGGNGGAVSSSSWFQIKNRRKKNNKDNMGRDRVRIFCASSYSSSSSSVMDPYKT 63

Query: 58  LRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEI 117
           L+IQ GASESEVKKAFRQLALQYHPDVCRG+NCGVQF LINEAYD+VM+N REEP+E   
Sbjct: 64  LKIQPGASESEVKKAFRQLALQYHPDVCRGSNCGVQFSLINEAYDIVMSNLREEPDESSQ 123

Query: 118 M---YQPYDGGIDEPFRGMNDPDWDLWEEWMGWEGAGIRDYSSHVNPYI 163
           M   Y+P D GIDEP RGMNDPDWD+WEEWMGWEGAGIRDYSSH+NPYI
Sbjct: 124 MYRSYEPSDQGIDEPMRGMNDPDWDMWEEWMGWEGAGIRDYSSHINPYI 172

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255543349|ref|XP_002512737.1| Chaperone protein dnaJ 8, chloroplast precursor, putative [Ricinus communis] gi|223547748|gb|EEF49240.1| Chaperone protein dnaJ 8, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|145688390|gb|ABC69274.2| putative DnaJ protein [Camellia sinensis] Back     alignment and taxonomy information
>gi|118489744|gb|ABK96673.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224115764|ref|XP_002332051.1| predicted protein [Populus trichocarpa] gi|222831937|gb|EEE70414.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388497078|gb|AFK36605.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356523203|ref|XP_003530231.1| PREDICTED: chaperone protein dnaJ 8, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255637318|gb|ACU18989.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|350539992|ref|NP_001233835.1| heat shock protein binding protein [Solanum lycopersicum] gi|307159102|gb|ADN39435.1| heat shock protein binding protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|359806152|ref|NP_001241196.1| uncharacterized protein LOC100804784 [Glycine max] gi|255647833|gb|ACU24376.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
TAIR|locus:2025792163 J8 [Arabidopsis thaliana (taxi 0.822 0.822 0.577 4.8e-39
TAIR|locus:2030352126 AT1G72070 [Arabidopsis thalian 0.515 0.666 0.377 4.7e-09
TIGR_CMR|DET_1411 330 DET_1411 "DnaJ family protein" 0.319 0.157 0.462 1.6e-08
UNIPROTKB|E1BWR7 345 DNAJB5 "Uncharacterized protei 0.319 0.150 0.519 1.8e-08
UNIPROTKB|Q5T657155 DNAJB5 "DnaJ homolog subfamily 0.319 0.335 0.5 2e-08
TAIR|locus:5019474746244 AT3G05345 "AT3G05345" [Arabido 0.423 0.282 0.408 4.2e-08
ZFIN|ZDB-GENE-050522-76199 zgc:110447 "zgc:110447" [Danio 0.472 0.386 0.320 6.8e-08
TAIR|locus:2174239268 AT5G59610 [Arabidopsis thalian 0.595 0.361 0.301 7.3e-08
UNIPROTKB|Q5BIP8 348 DNAJB5 "DnaJ homolog subfamily 0.319 0.149 0.5 1.1e-07
UNIPROTKB|O75953 348 DNAJB5 "DnaJ homolog subfamily 0.319 0.149 0.5 1.1e-07
TAIR|locus:2025792 J8 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 417 (151.9 bits), Expect = 4.8e-39, P = 4.8e-39
 Identities = 82/142 (57%), Positives = 96/142 (67%)

Query:    22 QLKNXXXXXXXX-GRVKVICXXXXXXXXXXVMDPYKTLRIQRGASESEVKKAFRQLALQY 80
             +LKN          R KV+C          VMDPYKTL+I+  +SE EVKKAFRQLA +Y
Sbjct:    28 RLKNSRRKNTKMLNRSKVVCSSSSS-----VMDPYKTLKIRPDSSEYEVKKAFRQLAKKY 82

Query:    81 HPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDEPFRGMNDPDWDL 140
             HPDVCRG+NCGVQF  INEAYD+V+   + +    E  ++P+D   DE   GMNDPD D 
Sbjct:    83 HPDVCRGSNCGVQFQTINEAYDIVLKQIKNQMEGTE-EFEPFDV-YDEGLNGMNDPDCDT 140

Query:   141 WEEWMGWEGAGIRDYSSHVNPY 162
             WEEWMGWEGAG RDYSSHVNPY
Sbjct:   141 WEEWMGWEGAGTRDYSSHVNPY 162
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IEP
TAIR|locus:2030352 AT1G72070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1411 DET_1411 "DnaJ family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWR7 DNAJB5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T657 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:5019474746 AT3G05345 "AT3G05345" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-76 zgc:110447 "zgc:110447" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2174239 AT5G59610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BIP8 DNAJB5 "DnaJ homolog subfamily B member 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75953 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SAG8DNAJ8_ARATHNo assigned EC number0.58920.93860.9386yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
pfam0022663 pfam00226, DnaJ, DnaJ domain 8e-18
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 9e-18
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 7e-17
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-14
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-14
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 4e-13
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-12
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-11
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-10
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-10
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-10
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-10
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-10
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-09
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-09
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 5e-09
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-09
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 8e-09
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 9e-09
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-08
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-08
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-08
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 7e-08
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 9e-08
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-07
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 1e-07
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-07
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 5e-07
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 7e-07
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-06
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 4e-06
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 5e-06
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 6e-06
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-06
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 7e-06
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 8e-06
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-05
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-04
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 72.6 bits (179), Expect = 8e-18
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 53  DPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQ-FHLINEAYD 102
           D Y+ L + R AS+ E+KKA+R+LAL+YHPD   G+    + F  INEAY+
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYE 51

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 163
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.91
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
PRK14288 369 chaperone protein DnaJ; Provisional 99.87
PRK14296 372 chaperone protein DnaJ; Provisional 99.87
PRK14287 371 chaperone protein DnaJ; Provisional 99.86
PRK14286 372 chaperone protein DnaJ; Provisional 99.86
PRK14298 377 chaperone protein DnaJ; Provisional 99.85
PRK14276 380 chaperone protein DnaJ; Provisional 99.85
PRK14278 378 chaperone protein DnaJ; Provisional 99.85
PRK14280 376 chaperone protein DnaJ; Provisional 99.85
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.84
PRK14299 291 chaperone protein DnaJ; Provisional 99.84
PRK14297 380 chaperone protein DnaJ; Provisional 99.84
PRK14285 365 chaperone protein DnaJ; Provisional 99.84
PRK14294 366 chaperone protein DnaJ; Provisional 99.83
PRK14301 373 chaperone protein DnaJ; Provisional 99.83
PRK14283 378 chaperone protein DnaJ; Provisional 99.82
PRK14282 369 chaperone protein DnaJ; Provisional 99.82
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.82
PRK10767 371 chaperone protein DnaJ; Provisional 99.82
PRK14291 382 chaperone protein DnaJ; Provisional 99.82
PRK14292 371 chaperone protein DnaJ; Provisional 99.82
PRK14277 386 chaperone protein DnaJ; Provisional 99.81
PRK14290 365 chaperone protein DnaJ; Provisional 99.81
PRK14279 392 chaperone protein DnaJ; Provisional 99.8
PRK14281 397 chaperone protein DnaJ; Provisional 99.8
PRK14284 391 chaperone protein DnaJ; Provisional 99.8
PRK14300 372 chaperone protein DnaJ; Provisional 99.8
PRK14293 374 chaperone protein DnaJ; Provisional 99.8
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.79
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.77
PRK14289 386 chaperone protein DnaJ; Provisional 99.76
PRK14295 389 chaperone protein DnaJ; Provisional 99.76
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.75
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.69
PHA03102153 Small T antigen; Reviewed 99.69
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.69
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.68
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.66
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.6
PRK05014171 hscB co-chaperone HscB; Provisional 99.5
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
PRK01356166 hscB co-chaperone HscB; Provisional 99.46
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.43
PRK03578176 hscB co-chaperone HscB; Provisional 99.43
PRK00294173 hscB co-chaperone HscB; Provisional 99.43
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.4
PTZ00100116 DnaJ chaperone protein; Provisional 99.4
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
PHA02624 647 large T antigen; Provisional 99.37
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.23
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.19
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.18
PRK01773173 hscB co-chaperone HscB; Provisional 99.18
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.98
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.59
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.54
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.27
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.74
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.32
KOG0431453 consensus Auxilin-like protein and related protein 97.14
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.35
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.51
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 92.99
PF1344662 RPT: A repeated domain in UCH-protein 91.6
KOG0724 335 consensus Zuotin and related molecular chaperones 88.2
PF14687112 DUF4460: Domain of unknown function (DUF4460) 85.54
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=1.2e-28  Score=208.86  Aligned_cols=92  Identities=33%  Similarity=0.533  Sum_probs=80.6

Q ss_pred             cCCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCC-CCcHHHHHHHHHHHHHHhcCcCCCCCCchhhhccCCCCCCCC-
Q 031261           51 VMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCR-GNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGIDE-  128 (163)
Q Consensus        51 ~~d~Y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~-~~~a~~~f~~I~~Ay~vL~d~~~~~~~~~R~~Yd~~g~~~~~-  128 (163)
                      .+|||+||||+++|+.+|||+|||+|+++||||+|+ ...|+++|++|++||+||+|+      +||++||+||....+ 
T Consensus         3 ~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~------eKRa~YD~fG~~~~~~   76 (371)
T COG0484           3 KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDP------EKRAAYDQFGHAGFKA   76 (371)
T ss_pred             ccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCH------HHHHHhhccCcccccc
Confidence            579999999999999999999999999999999999 557999999999999999999      899999999997754 


Q ss_pred             -CCC-----CCCCcchHHHHHhhcCC
Q 031261          129 -PFR-----GMNDPDWDLWEEWMGWE  148 (163)
Q Consensus       129 -~~~-----~~~~~~~~~~~~~f~~~  148 (163)
                       ++.     ++++++.++|++||+++
T Consensus        77 gg~gg~g~~~fgg~~~DIF~~~FgGg  102 (371)
T COG0484          77 GGFGGFGFGGFGGDFGDIFEDFFGGG  102 (371)
T ss_pred             CCcCCCCcCCCCCCHHHHHHHhhcCC
Confidence             222     23335789999999744

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-07
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 1e-06
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-06
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-06
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 5e-06
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 5e-06
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 5e-06
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 7e-06
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-05
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-05
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-04
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-04
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 2e-04
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 3e-04
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 7e-04
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 8e-04
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 8e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 9e-04
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)
Query: 53  DPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREE 111
           D Y+TL + RGAS+ E+K+A+R+ AL+YHPD  +      +F  I EAYD++ +  + E
Sbjct: 4   DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKRE 62
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 3e-17
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 7e-16
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 9e-16
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-15
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-14
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-14
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 7e-14
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 8e-14
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-13
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-13
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-13
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 1e-13
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-13
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-13
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-13
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-13
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 5e-13
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 9e-13
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-12
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-12
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-12
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-12
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 5e-12
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-10
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-09
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 4e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-09
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-07
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 8e-07
2guz_A71 Mitochondrial import inner membrane translocase su 9e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 1e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 6e-06
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 7e-06
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-04
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 71.3 bits (175), Expect = 3e-17
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 17/99 (17%)

Query: 9   GANGSSGSSSSWTQLKNMKKKKMMMGRVKVICSASYSSSSSSVMDPYKTLRIQRGASESE 68
           G++GSSGSS+S+T+ +    +++   +                 D +  L ++ GAS  E
Sbjct: 1   GSSGSSGSSASFTKEQADAIRRIRNSK-----------------DSWDMLGVKPGASRDE 43

Query: 69  VKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNN 107
           V KA+R+LA+  HPD C        F  +  A   ++ N
Sbjct: 44  VNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKN 82
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.86
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.86
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.86
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.86
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.85
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.85
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.84
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.83
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.82
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.81
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.81
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.81
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.81
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.8
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.8
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.8
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.79
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.77
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.73
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.73
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.72
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.72
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.71
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.7
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.68
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.67
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.67
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.63
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.62
2guz_A71 Mitochondrial import inner membrane translocase su 99.62
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.6
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.03
2guz_B65 Mitochondrial import inner membrane translocase su 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.98
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.86  E-value=2e-22  Score=135.73  Aligned_cols=74  Identities=36%  Similarity=0.605  Sum_probs=67.9

Q ss_pred             CCCcCCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCCCCcHHHHHHHHHHHHHHhcCcCCCCCCchhhhccCCCCCCC
Q 031261           48 SSSVMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNNCGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGID  127 (163)
Q Consensus        48 ~~~~~d~Y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~~~~a~~~f~~I~~Ay~vL~d~~~~~~~~~R~~Yd~~g~~~~  127 (163)
                      .....|+|+||||+++++.++||++|++|++++|||+++.+.+.+.|++|++||++|+|+      .+|..||.+|....
T Consensus         3 ~~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~~~~f~~i~~Ay~~L~d~------~~R~~YD~~~~~~~   76 (78)
T 2ctp_A            3 SGSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNP------EKRKQYDQFGSGPS   76 (78)
T ss_dssp             CSCSCCHHHHHTCCTTCCHHHHHHHHHHHHTTSCTTTCSSHHHHHHHHHHHHHHHHHTSH------HHHHHHHHTCSCSC
T ss_pred             CCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCH------HHHHHHHHcCcccc
Confidence            345689999999999999999999999999999999998777899999999999999999      79999999987543
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 163
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-09
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 5e-09
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-08
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 4e-08
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-07
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-07
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-05
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 51.1 bits (122), Expect = 7e-10
 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 4/58 (6%)

Query: 53  DPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNN----CGVQFHLINEAYDMVMN 106
             +K + +    +  +VKK +R+  L  HPD   G        + F  +N+A+    N
Sbjct: 34  TKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFEN 91
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.89
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.83
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.82
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.72
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.7
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.68
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.67
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.89  E-value=9.4e-24  Score=140.24  Aligned_cols=71  Identities=31%  Similarity=0.625  Sum_probs=65.0

Q ss_pred             cCCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCCCCc-HHHHHHHHHHHHHHhcCcCCCCCCchhhhccCCCCCCC
Q 031261           51 VMDPYKTLRIQRGASESEVKKAFRQLALQYHPDVCRGNN-CGVQFHLINEAYDMVMNNFREEPNEPEIMYQPYDGGID  127 (163)
Q Consensus        51 ~~d~Y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~~~~-a~~~f~~I~~Ay~vL~d~~~~~~~~~R~~Yd~~g~~~~  127 (163)
                      .+|||+||||++++|.++||++|+++++++|||+++.+. +.+.|++|++||+||+|+      .+|..||+||....
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~------~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS------QKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSS------HHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCH------HHHHHHHHhCcccc
Confidence            469999999999999999999999999999999998654 678899999999999999      89999999987543
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure