Citrus Sinensis ID: 031280
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| 255560876 | 282 | polypeptide deformylase, putative [Ricin | 1.0 | 0.574 | 0.839 | 2e-76 | |
| 225452422 | 275 | PREDICTED: peptide deformylase 1B, chlor | 1.0 | 0.589 | 0.814 | 2e-73 | |
| 11320966 | 273 | peptide deformylase [Arabidopsis thalian | 0.993 | 0.589 | 0.782 | 4e-73 | |
| 15241461 | 273 | peptide deformylase 1B [Arabidopsis thal | 0.993 | 0.589 | 0.782 | 8e-73 | |
| 21553551 | 273 | Formylmethionine deformylase [Arabidopsi | 0.993 | 0.589 | 0.782 | 1e-72 | |
| 350535262 | 279 | peptide deformylase 1B, chloroplastic [S | 1.0 | 0.580 | 0.790 | 1e-72 | |
| 297811599 | 273 | predicted protein [Arabidopsis lyrata su | 0.993 | 0.589 | 0.788 | 5e-72 | |
| 327200558 | 193 | Chain A, Crystal Structure Of Arabidopsi | 0.993 | 0.834 | 0.782 | 6e-72 | |
| 224060121 | 258 | peptide deformylase [Populus trichocarpa | 0.993 | 0.624 | 0.807 | 2e-71 | |
| 327200562 | 193 | Chain A, Crystal Structure Of Arabidopsi | 0.993 | 0.834 | 0.776 | 4e-71 |
| >gi|255560876|ref|XP_002521451.1| polypeptide deformylase, putative [Ricinus communis] gi|223539350|gb|EEF40941.1| polypeptide deformylase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 289 bits (740), Expect = 2e-76, Method: Compositional matrix adjust.
Identities = 136/162 (83%), Positives = 151/162 (93%)
Query: 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVL+NPR+NKYS K++P+ EGC
Sbjct: 121 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLINPRLNKYSKKIVPFNEGC 180
Query: 61 LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
LSFPGI+ADV RPESVKIDARDINGARF+V+LS LPARVFQHE+DHL+GILFF+RMTD+V
Sbjct: 181 LSFPGIYADVLRPESVKIDARDINGARFTVNLSGLPARVFQHEYDHLEGILFFDRMTDEV 240
Query: 121 LDSIREQLEALEKKYEDKTGLQSPEKIEASKRRKAAVGFGKS 162
LDSIR QL+ALEKK+EDKTG SPEKIE K +KAA GFGKS
Sbjct: 241 LDSIRAQLQALEKKFEDKTGYASPEKIETRKTKKAAAGFGKS 282
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225452422|ref|XP_002276964.1| PREDICTED: peptide deformylase 1B, chloroplastic [Vitis vinifera] gi|296087647|emb|CBI34903.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|11320966|gb|AAG33980.1|AF269165_1 peptide deformylase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15241461|ref|NP_196970.1| peptide deformylase 1B [Arabidopsis thaliana] gi|30684999|ref|NP_850821.1| peptide deformylase 1B [Arabidopsis thaliana] gi|39932734|sp|Q9FUZ2.2|DEF1B_ARATH RecName: Full=Peptide deformylase 1B, chloroplastic; Short=AtDEF2; Short=AtPDF1B; Short=PDF 1B; AltName: Full=Polypeptide deformylase; Flags: Precursor gi|7573315|emb|CAB87633.1| putative protein [Arabidopsis thaliana] gi|15292891|gb|AAK92816.1| unknown protein [Arabidopsis thaliana] gi|20465677|gb|AAM20307.1| unknown protein [Arabidopsis thaliana] gi|332004676|gb|AED92059.1| peptide deformylase 1B [Arabidopsis thaliana] gi|332004677|gb|AED92060.1| peptide deformylase 1B [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21553551|gb|AAM62644.1| Formylmethionine deformylase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|350535262|ref|NP_001234441.1| peptide deformylase 1B, chloroplastic [Solanum lycopersicum] gi|17433052|sp|Q9FV54.1|DEF1B_SOLLC RecName: Full=Peptide deformylase 1B, chloroplastic; Short=PDF 1B; AltName: Full=Polypeptide deformylase; Flags: Precursor gi|11320950|gb|AAG33972.1| peptide deformylase-like protein [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|297811599|ref|XP_002873683.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297319520|gb|EFH49942.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|327200558|pdb|3M6O|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) gi|327200559|pdb|3M6O|B Chain B, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) gi|327200560|pdb|3M6P|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) In Complex With Actinonin gi|327200561|pdb|3M6P|B Chain B, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) In Complex With Actinonin gi|335892336|pdb|3O3J|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) In Complex With Inhibitor 6b gi|335892375|pdb|3PN2|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) (Crystallized In Peg-550-Mme) gi|335892376|pdb|3PN3|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) In Complex With Inhibitor 21 gi|335892377|pdb|3PN3|B Chain B, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) In Complex With Inhibitor 21 gi|335892378|pdb|3PN4|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) In Complex With Actinonin (Crystallized In Peg-550-Mme) | Back alignment and taxonomy information |
|---|
| >gi|224060121|ref|XP_002300047.1| peptide deformylase [Populus trichocarpa] gi|222847305|gb|EEE84852.1| peptide deformylase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|327200562|pdb|3M6Q|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41q Mutant In Complex With Actinonin gi|335892379|pdb|3PN5|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) G41q Mutant | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| TAIR|locus:2222667 | 273 | PDF1B "peptide deformylase 1B" | 0.993 | 0.589 | 0.782 | 2.7e-68 | |
| GENEDB_PFALCIPARUM|PFI0380c | 241 | PFI0380c "formylmethionine def | 0.839 | 0.564 | 0.452 | 1.9e-26 | |
| UNIPROTKB|Q8I372 | 241 | PFI0380c "Formylmethionine def | 0.839 | 0.564 | 0.452 | 1.9e-26 | |
| TIGR_CMR|BA_4005 | 156 | BA_4005 "polypeptide deformyla | 0.691 | 0.717 | 0.406 | 4e-19 | |
| UNIPROTKB|Q9KN16 | 168 | def2 "Peptide deformylase 2" [ | 0.765 | 0.738 | 0.425 | 5.1e-19 | |
| TIGR_CMR|VC_A0150 | 168 | VC_A0150 "polypeptide deformyl | 0.765 | 0.738 | 0.425 | 5.1e-19 | |
| TIGR_CMR|SO_0032 | 168 | SO_0032 "polypeptide deformyla | 0.808 | 0.779 | 0.402 | 2.8e-18 | |
| TIGR_CMR|CPS_0020 | 171 | CPS_0020 "polypeptide deformyl | 0.783 | 0.742 | 0.356 | 3.6e-18 | |
| UNIPROTKB|P0A6K3 | 169 | def [Escherichia coli K-12 (ta | 0.802 | 0.769 | 0.406 | 5.8e-18 | |
| TIGR_CMR|SPO_3219 | 172 | SPO_3219 "peptide deformylase" | 0.827 | 0.779 | 0.370 | 1.6e-17 |
| TAIR|locus:2222667 PDF1B "peptide deformylase 1B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 693 (249.0 bits), Expect = 2.7e-68, P = 2.7e-68
Identities = 126/161 (78%), Positives = 150/161 (93%)
Query: 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
MFDVMYKTDGIGLSAPQVG+NVQLMVFNP GE GEG+EIVLVNP++ KYS+K++P++EGC
Sbjct: 112 MFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGC 171
Query: 61 LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
LSFPGI+A+V RP+SVKIDARDI G RFS+SLS LPAR+FQHE+DHL+G+LFF+RMTD V
Sbjct: 172 LSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQV 231
Query: 121 LDSIREQLEALEKKYEDKTGLQSPEKIEASKRRKAAVGFGK 161
LDSIRE+LEALEKKYE+KTGL SPE++EA ++RKA VGFGK
Sbjct: 232 LDSIREELEALEKKYEEKTGLPSPERVEARQKRKAGVGFGK 272
|
|
| GENEDB_PFALCIPARUM|PFI0380c PFI0380c "formylmethionine deformylase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8I372 PFI0380c "Formylmethionine deformylase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4005 BA_4005 "polypeptide deformylase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KN16 def2 "Peptide deformylase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_A0150 VC_A0150 "polypeptide deformylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_0032 SO_0032 "polypeptide deformylase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0020 CPS_0020 "polypeptide deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6K3 def [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3219 SPO_3219 "peptide deformylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| pfam01327 | 155 | pfam01327, Pep_deformylase, Polypeptide deformylas | 3e-52 | |
| cd00487 | 141 | cd00487, Pep_deformylase, Polypeptide or peptide d | 3e-50 | |
| PRK00150 | 165 | PRK00150, def, peptide deformylase; Reviewed | 4e-46 | |
| COG0242 | 168 | COG0242, Def, N-formylmethionyl-tRNA deformylase [ | 8e-46 | |
| PRK12846 | 165 | PRK12846, PRK12846, peptide deformylase; Reviewed | 2e-39 | |
| PRK14597 | 166 | PRK14597, PRK14597, peptide deformylase; Provision | 3e-33 | |
| PRK14598 | 187 | PRK14598, PRK14598, peptide deformylase; Provision | 1e-31 | |
| PRK14596 | 199 | PRK14596, PRK14596, peptide deformylase; Provision | 2e-28 | |
| TIGR00079 | 161 | TIGR00079, pept_deformyl, peptide deformylase | 3e-27 | |
| PRK14595 | 162 | PRK14595, PRK14595, peptide deformylase; Provision | 8e-18 | |
| PRK09218 | 136 | PRK09218, PRK09218, peptide deformylase; Validated | 5e-15 |
| >gnl|CDD|216435 pfam01327, Pep_deformylase, Polypeptide deformylase | Back alignment and domain information |
|---|
Score = 163 bits (414), Expect = 3e-52
Identities = 49/118 (41%), Positives = 75/118 (63%)
Query: 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
M + MY +G+GL+APQ+G++ ++ V + E GE E +VL+NP + S + + EEGC
Sbjct: 34 MLETMYAANGVGLAAPQIGVSKRIFVIDVGDEDGEPEPLVLINPEIISASEETVEGEEGC 93
Query: 61 LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTD 118
LS PG+ +VERP+ + + +D+NG + ARV QHE DHL GILF +R++
Sbjct: 94 LSVPGLRGEVERPKRITVRYQDLNGNEHELEADGFLARVLQHEIDHLNGILFLDRLSK 151
|
Length = 155 |
| >gnl|CDD|238271 cd00487, Pep_deformylase, Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|234668 PRK00150, def, peptide deformylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223320 COG0242, Def, N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|237227 PRK12846, PRK12846, peptide deformylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237761 PRK14597, PRK14597, peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237762 PRK14598, PRK14598, peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184758 PRK14596, PRK14596, peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232815 TIGR00079, pept_deformyl, peptide deformylase | Back alignment and domain information |
|---|
| >gnl|CDD|184757 PRK14595, PRK14595, peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181704 PRK09218, PRK09218, peptide deformylase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| COG0242 | 168 | Def N-formylmethionyl-tRNA deformylase [Translatio | 100.0 | |
| PRK14597 | 166 | peptide deformylase; Provisional | 100.0 | |
| PRK12846 | 165 | peptide deformylase; Reviewed | 100.0 | |
| PRK14598 | 187 | peptide deformylase; Provisional | 100.0 | |
| PRK00150 | 165 | def peptide deformylase; Reviewed | 100.0 | |
| TIGR00079 | 161 | pept_deformyl peptide deformylase. Peptide deformy | 100.0 | |
| PRK14595 | 162 | peptide deformylase; Provisional | 100.0 | |
| PF01327 | 156 | Pep_deformylase: Polypeptide deformylase; InterPro | 100.0 | |
| PRK14596 | 199 | peptide deformylase; Provisional | 100.0 | |
| cd00487 | 141 | Pep_deformylase Polypeptide or peptide deformylase | 100.0 | |
| PRK09218 | 136 | peptide deformylase; Validated | 100.0 | |
| KOG3137 | 267 | consensus Peptide deformylase [Translation, riboso | 100.0 | |
| COG4740 | 176 | Predicted metalloprotease [General function predic | 98.16 |
| >COG0242 Def N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-53 Score=337.50 Aligned_cols=131 Identities=37% Similarity=0.707 Sum_probs=122.4
Q ss_pred CHHhhhcCCCeeEeccccCccccEEEEecCCCCC-CCceeEEEcceEEeeCCceeecccccCCcCCCceeeccCCeEEEE
Q 031280 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERG-EGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKID 79 (162)
Q Consensus 1 m~~tM~~~~gvGLAApQIG~~~ri~vi~~~~~~~-~~~~~v~INP~Iv~~s~~~~~~~EgCLS~pg~~~~V~R~~~I~V~ 79 (162)
|++|||+++||||||||||+++|+||++..++.. ...+.+||||+|++.|.+....+|||||+||+++.|+||.+|+|+
T Consensus 35 M~etm~~~~GVGLAApQIGi~kri~vi~~~~~~~~~~~~~vlINP~I~~~~~~~~~~~EGCLSvP~~~~~V~R~~~I~V~ 114 (168)
T COG0242 35 MLETMYAAEGVGLAAPQIGISKRIFVIDVEEDGRPKEPPLVLINPEIISKSEETLTGEEGCLSVPGVRGEVERPERITVK 114 (168)
T ss_pred HHHHHHhCCCeeeeehhcCceeeEEEEEccCccCcCcCceEEECCEEeecCCcccccCcceEeecCceeeeecccEEEEE
Confidence 8999999999999999999999999999976532 345689999999999888888999999999999999999999999
Q ss_pred EEcCCCCEEEEEEecchhhhHHhhhhhhCCceeeecCCHHHHHHHHHHHHHH
Q 031280 80 ARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEAL 131 (162)
Q Consensus 80 y~d~~G~~~~~~~~G~~Ar~~QHEiDHL~Gil~~Drl~~~~~~~~~~~~~~~ 131 (162)
|+|.+|++++++++||+|||||||+|||||+||+||+++..++.+.++++++
T Consensus 115 ~~D~~G~~~~~~a~G~lA~~iQHEiDHLnGvlf~D~l~~~k~~~~~~~~~~~ 166 (168)
T COG0242 115 YLDRNGKPQELEAEGLLARCIQHEIDHLNGVLFIDRLSPLKRDRLKKKLKKL 166 (168)
T ss_pred EEcCCCCEEEEEEcCceeEEeEeeccccCcEEeeeecChhhhhhHHHHHHHh
Confidence 9999999999999999999999999999999999999998888888888764
|
|
| >PRK14597 peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >PRK12846 peptide deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14598 peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >PRK00150 def peptide deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00079 pept_deformyl peptide deformylase | Back alignment and domain information |
|---|
| >PRK14595 peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >PF01327 Pep_deformylase: Polypeptide deformylase; InterPro: IPR023635 Peptide deformylase (PDF) is an essential metalloenzyme required for the removal of the formyl group at the N terminus of nascent polypeptide chains in eubacteria: 3 | Back alignment and domain information |
|---|
| >PRK14596 peptide deformylase; Provisional | Back alignment and domain information |
|---|
| >cd00487 Pep_deformylase Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes | Back alignment and domain information |
|---|
| >PRK09218 peptide deformylase; Validated | Back alignment and domain information |
|---|
| >KOG3137 consensus Peptide deformylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4740 Predicted metalloprotease [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 162 | ||||
| 3m6o_A | 193 | Crystal Structure Of Arabidopsis Thaliana Peptide D | 1e-74 | ||
| 3m6q_A | 193 | Crystal Structure Of Arabidopsis Thaliana Peptide D | 7e-74 | ||
| 3m6r_A | 193 | Crystal Structure Of Arabidopsis Thaliana Peptide D | 8e-74 | ||
| 3cpm_A | 193 | Plant Peptide Deformylase Pdf1b Crystal Structure L | 2e-68 | ||
| 1rl4_A | 188 | Plasmodium Falciparum Peptide Deformylase Complex W | 2e-28 | ||
| 4dr9_A | 192 | Crystal Structure Of A Peptide Deformylase From Syn | 1e-26 | ||
| 1rqc_A | 185 | Crystals Of Peptide Deformylase From Plasmodium Fal | 6e-26 | ||
| 1jym_A | 183 | Crystals Of Peptide Deformylase From Plasmodium Fal | 1e-23 | ||
| 3uwa_A | 154 | Crystal Structure Of A Probable Peptide Deformylase | 9e-21 | ||
| 1y6h_A | 177 | Crystal Structure Of Lipdf Length = 177 | 2e-20 | ||
| 1n5n_A | 180 | Crystal Structure Of Peptide Deformylase From Pseud | 4e-20 | ||
| 1lry_A | 167 | Crystal Structure Of P. Aeruginosa Peptide Deformyl | 6e-20 | ||
| 1ix1_A | 171 | Crystal Structure Of P.Aeruginosa Peptide Deformyla | 7e-20 | ||
| 1szz_A | 177 | Crystal Structure Of Peptide Deformylase From Lepto | 9e-20 | ||
| 3qu1_A | 171 | Peptide Deformylase From Vibrio Cholerae Length = 1 | 5e-19 | ||
| 1ws0_A | 156 | Structure Analysis Of Peptide Deformylase From Baci | 5e-18 | ||
| 1lme_A | 176 | Crystal Structure Of Peptide Deformylase From Therm | 7e-18 | ||
| 1v3y_A | 192 | The Crystal Structure Of Peptide Deformylase From T | 7e-18 | ||
| 2w3t_A | 188 | Chloro Complex Of The Ni-Form Of E.Coli Deformylase | 1e-17 | ||
| 4al2_A | 186 | Peptide Deformylase (Ni-Form) With Hydrosulfide Len | 1e-17 | ||
| 3k6l_A | 169 | The Structure Of E.Coli Peptide Deformylase (Pdf) I | 1e-17 | ||
| 1icj_A | 168 | Pdf Protein Is Crystallized As Ni2+ Containing Form | 1e-17 | ||
| 4az4_A | 186 | E.Coli Deformylase With Co(Ii) And Hydrosulfide Len | 1e-17 | ||
| 1dff_A | 164 | Peptide Deformylase Length = 164 | 2e-17 | ||
| 2ew5_A | 181 | Structure Of Helicobacter Pylori Peptide Deformylas | 1e-16 | ||
| 2def_A | 147 | Peptide Deformylase Catalytic Core (Residues 1-147) | 2e-16 | ||
| 1def_A | 147 | Peptide Deformylase Catalytic Core (Residues 1-147) | 2e-16 | ||
| 1zxz_A | 197 | X-Ray Structure Of Peptide Deformylase From Arabido | 3e-16 | ||
| 4al3_A | 186 | Peptide Deformylase (Co-Form) With Mercaptoethanol | 3e-16 | ||
| 3oca_A | 209 | Crystal Structure Of Peptide Deformylase From Ehrli | 6e-16 | ||
| 3u04_A | 190 | Crystal Structure Of Peptide Deformylase From Ehrli | 7e-16 | ||
| 3fwx_A | 169 | The Crystal Structure Of The Peptide Deformylase Fr | 4e-15 | ||
| 1lqw_A | 183 | Crystal Structure Of S.Aureus Peptide Deformylase L | 7e-15 | ||
| 1lmh_A | 184 | Crystal Structure Of S. Aureus Peptide Deformylase | 2e-14 | ||
| 3g5k_A | 183 | Structure And Activity Of Human Mitochondrial Pepti | 3e-14 | ||
| 1q1y_A | 191 | Crystal Structures Of Peptide Deformylase From Stap | 9e-14 | ||
| 1lm4_A | 194 | Structure Of Peptide Deformylase From Staphylococcu | 2e-13 | ||
| 3dld_A | 171 | Crystal Structure Of Peptide Deformylase, Xoo1075, | 2e-13 | ||
| 2okl_A | 185 | Crystal Structure Of Peptide Deformylase 2 With Act | 4e-13 | ||
| 1lqy_A | 184 | Crystal Structure Of Bacillus Stearothermophilus Pe | 7e-13 | ||
| 3e3u_A | 197 | Crystal Structure Of Mycobacterium Tuberculosis Pep | 5e-12 | ||
| 3g6n_A | 191 | Crystal Structure Of An Efpdf Complex With Met-Ala- | 2e-09 | ||
| 2os3_A | 205 | Structures Of Actinonin Bound Peptide Deformylases | 3e-09 | ||
| 3cmd_A | 196 | Crystal Structure Of Peptide Deformylase From Vre-E | 3e-09 | ||
| 3str_P | 203 | Strep Peptide Deformylase With A Time Dependent Thi | 4e-09 | ||
| 2ai7_A | 203 | S.Pneumoniae Polypeptide Deformylase Complexed With | 4e-09 | ||
| 2aie_P | 203 | S.Pneumoniae Polypeptide Deformylase Complexed With | 4e-09 | ||
| 2os1_A | 188 | Structures Of Actinonin Bound Peptide Deformylases | 2e-08 | ||
| 1lm6_A | 215 | Crystal Structure Of Peptide Deformylase From Strep | 1e-07 | ||
| 3svj_P | 203 | Strep Peptide Deformylase With A Time Dependent Thi | 1e-07 | ||
| 2os0_A | 188 | Structures Of Actinonin Bound Peptide Deformylases | 1e-07 | ||
| 3l87_A | 238 | The Crystal Structure Of Smu.143c From Streptococcu | 4e-07 |
| >pdb|3M6O|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) Length = 193 | Back alignment and structure |
|
| >pdb|3M6Q|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41q Mutant In Complex With Actinonin Length = 193 | Back alignment and structure |
| >pdb|3M6R|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41m Mutant In Complex With Actinonin Length = 193 | Back alignment and structure |
| >pdb|3CPM|A Chain A, Plant Peptide Deformylase Pdf1b Crystal Structure Length = 193 | Back alignment and structure |
| >pdb|1RL4|A Chain A, Plasmodium Falciparum Peptide Deformylase Complex With Inhibitor Length = 188 | Back alignment and structure |
| >pdb|4DR9|A Chain A, Crystal Structure Of A Peptide Deformylase From Synechococcus Elongatus In Complex With Actinonin Length = 192 | Back alignment and structure |
| >pdb|1RQC|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 185 | Back alignment and structure |
| >pdb|1JYM|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 183 | Back alignment and structure |
| >pdb|3UWA|A Chain A, Crystal Structure Of A Probable Peptide Deformylase From Synechococcus Phage S-Ssm7 Length = 154 | Back alignment and structure |
| >pdb|1Y6H|A Chain A, Crystal Structure Of Lipdf Length = 177 | Back alignment and structure |
| >pdb|1N5N|A Chain A, Crystal Structure Of Peptide Deformylase From Pseudomonas Aeruginosa Length = 180 | Back alignment and structure |
| >pdb|1LRY|A Chain A, Crystal Structure Of P. Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 167 | Back alignment and structure |
| >pdb|1IX1|A Chain A, Crystal Structure Of P.Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 171 | Back alignment and structure |
| >pdb|1SZZ|A Chain A, Crystal Structure Of Peptide Deformylase From Leptospira Interrogans Complexed With Inhibitor Actinonin Length = 177 | Back alignment and structure |
| >pdb|3QU1|A Chain A, Peptide Deformylase From Vibrio Cholerae Length = 171 | Back alignment and structure |
| >pdb|1WS0|A Chain A, Structure Analysis Of Peptide Deformylase From Bacillus Cereus Length = 156 | Back alignment and structure |
| >pdb|1LME|A Chain A, Crystal Structure Of Peptide Deformylase From Thermotoga Maritima Length = 176 | Back alignment and structure |
| >pdb|1V3Y|A Chain A, The Crystal Structure Of Peptide Deformylase From Thermus Thermophilus Hb8 Length = 192 | Back alignment and structure |
| >pdb|2W3T|A Chain A, Chloro Complex Of The Ni-Form Of E.Coli Deformylase Length = 188 | Back alignment and structure |
| >pdb|4AL2|A Chain A, Peptide Deformylase (Ni-Form) With Hydrosulfide Length = 186 | Back alignment and structure |
| >pdb|3K6L|A Chain A, The Structure Of E.Coli Peptide Deformylase (Pdf) In Complex With Peptidomimetic Ligand Bb2827 Length = 169 | Back alignment and structure |
| >pdb|1ICJ|A Chain A, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) Length = 168 | Back alignment and structure |
| >pdb|4AZ4|A Chain A, E.Coli Deformylase With Co(Ii) And Hydrosulfide Length = 186 | Back alignment and structure |
| >pdb|1DFF|A Chain A, Peptide Deformylase Length = 164 | Back alignment and structure |
| >pdb|2EW5|A Chain A, Structure Of Helicobacter Pylori Peptide Deformylase In Complex With Inhibitor Length = 181 | Back alignment and structure |
| >pdb|2DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 20 Structures Length = 147 | Back alignment and structure |
| >pdb|1DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 9 Structures Length = 147 | Back alignment and structure |
| >pdb|1ZXZ|A Chain A, X-Ray Structure Of Peptide Deformylase From Arabidopsis Thaliana (Atpdf1a); Crystals Grown In Peg-5000 Mme As Precipitant Length = 197 | Back alignment and structure |
| >pdb|4AL3|A Chain A, Peptide Deformylase (Co-Form) With Mercaptoethanol Length = 186 | Back alignment and structure |
| >pdb|3OCA|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis Length = 209 | Back alignment and structure |
| >pdb|3U04|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis In Complex With Actinonin Length = 190 | Back alignment and structure |
| >pdb|3FWX|A Chain A, The Crystal Structure Of The Peptide Deformylase From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 169 | Back alignment and structure |
| >pdb|1LQW|A Chain A, Crystal Structure Of S.Aureus Peptide Deformylase Length = 183 | Back alignment and structure |
| >pdb|1LMH|A Chain A, Crystal Structure Of S. Aureus Peptide Deformylase Length = 184 | Back alignment and structure |
| >pdb|3G5K|A Chain A, Structure And Activity Of Human Mitochondrial Peptide Deformylase, A Novel Cancer Target Length = 183 | Back alignment and structure |
| >pdb|1Q1Y|A Chain A, Crystal Structures Of Peptide Deformylase From Staphylococcus Aureus Complexed With Actinonin Length = 191 | Back alignment and structure |
| >pdb|1LM4|A Chain A, Structure Of Peptide Deformylase From Staphylococcus Aureus At 1.45 A Length = 194 | Back alignment and structure |
| >pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 171 | Back alignment and structure |
| >pdb|2OKL|A Chain A, Crystal Structure Of Peptide Deformylase 2 With Actinonin From Bacillus Cereus Length = 185 | Back alignment and structure |
| >pdb|1LQY|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Peptide Deformylase Complexed With Antibiotic Actinonin Length = 184 | Back alignment and structure |
| >pdb|3E3U|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Peptide Deformylase In Complex With Inhibitor Length = 197 | Back alignment and structure |
| >pdb|3G6N|A Chain A, Crystal Structure Of An Efpdf Complex With Met-Ala-Ser Length = 191 | Back alignment and structure |
| >pdb|2OS3|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 205 | Back alignment and structure |
| >pdb|3CMD|A Chain A, Crystal Structure Of Peptide Deformylase From Vre-E.Faecium Length = 196 | Back alignment and structure |
| >pdb|3STR|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Hydroxamic Acid Length = 203 | Back alignment and structure |
| >pdb|2AI7|A Chain A, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 485345 Length = 203 | Back alignment and structure |
| >pdb|2AIE|P Chain P, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 505684 Length = 203 | Back alignment and structure |
| >pdb|2OS1|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 | Back alignment and structure |
| >pdb|1LM6|A Chain A, Crystal Structure Of Peptide Deformylase From Streptococcus Pneumoniae Length = 215 | Back alignment and structure |
| >pdb|3SVJ|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Amide Length = 203 | Back alignment and structure |
| >pdb|2OS0|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 | Back alignment and structure |
| >pdb|3L87|A Chain A, The Crystal Structure Of Smu.143c From Streptococcus Mutans Ua159 Length = 238 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| 3pn3_A | 193 | Peptide deformylase 1B, chloroplastic; PDF, N-term | 6e-69 | |
| 1rl4_A | 188 | Formylmethionine deformylase; crystal engineering, | 2e-51 | |
| 1y6h_A | 177 | Peptide deformylase; open and close conformation, | 6e-49 | |
| 3dld_A | 171 | Peptide deformylase; bacterial blight, XOO1075, xa | 8e-48 | |
| 3g5k_A | 183 | Peptide deformylase, mitochondrial; actinonin, hyd | 7e-47 | |
| 1zxz_A | 197 | PDF, peptide deformylase, mitochondrial; PDF1A, eu | 2e-46 | |
| 1lme_A | 176 | PDF, peptide deformylase; thermophIle, metalloenzy | 2e-45 | |
| 2okl_A | 185 | Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. | 8e-45 | |
| 3e3u_A | 197 | Peptide deformylase; metallo-enzyme, hydrolase, ir | 3e-44 | |
| 1n5n_A | 180 | Peptide deformylase; metalloenzyme, drug design, d | 5e-44 | |
| 1v3y_A | 192 | Peptide deformylase; protein synthesis, riken stru | 1e-43 | |
| 2ew5_A | 181 | Peptide deformylase; inhibitor, hydrolase; HET: Y1 | 2e-43 | |
| 1ws0_A | 156 | Peptide deformylase 1; alpha + beta topology, hydr | 2e-43 | |
| 3svj_P | 203 | Peptide deformylase 3; alpha-beta, metal binding p | 3e-43 | |
| 1xeo_A | 168 | Peptide deformylase; cobalt deformylase, formate, | 8e-43 | |
| 2w3t_A | 188 | Peptide deformylase; protein biosynthesis, iron, n | 2e-42 | |
| 3u04_A | 190 | Peptide deformylase 1; ssgcid, actinonin, ehrlichi | 8e-42 | |
| 2os0_A | 188 | Peptide deformylase; PDF, hydrolase; 1.30A {Entero | 8e-42 | |
| 3qu1_A | 171 | Peptide deformylase 2; structural genomics, center | 3e-41 | |
| 3l87_A | 238 | Peptide deformylase; hydrolase, iron, metal-bindin | 2e-40 | |
| 1lm4_A | 194 | Peptide deformylase PDF1; metalloenzyme, hydrolase | 2e-38 |
| >3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Length = 193 | Back alignment and structure |
|---|
Score = 206 bits (526), Expect = 6e-69
Identities = 126/161 (78%), Positives = 150/161 (93%)
Query: 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
MFDVMYKTDGIGLSAPQVG+NVQLMVFNP GE GEG+EIVLVNP++ KYS+K++P++EGC
Sbjct: 32 MFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGC 91
Query: 61 LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
LSFPGI+A+V RP+SVKIDARDI G RFS+SLS LPAR+FQHE+DHL+G+LFF+RMTD V
Sbjct: 92 LSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQV 151
Query: 121 LDSIREQLEALEKKYEDKTGLQSPEKIEASKRRKAAVGFGK 161
LDSIRE+LEALEKKYE+KTGL SPE++EA ++RKA VGFGK
Sbjct: 152 LDSIREELEALEKKYEEKTGLPSPERVEARQKRKAGVGFGK 192
|
| >1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Length = 188 | Back alignment and structure |
|---|
| >1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Length = 177 | Back alignment and structure |
|---|
| >3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} Length = 171 | Back alignment and structure |
|---|
| >3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Length = 183 | Back alignment and structure |
|---|
| >1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Length = 197 | Back alignment and structure |
|---|
| >1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Length = 176 | Back alignment and structure |
|---|
| >2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Length = 185 | Back alignment and structure |
|---|
| >3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Length = 197 | Back alignment and structure |
|---|
| >1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Length = 180 | Back alignment and structure |
|---|
| >1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Length = 192 | Back alignment and structure |
|---|
| >2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Length = 181 | Back alignment and structure |
|---|
| >1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Length = 156 | Back alignment and structure |
|---|
| >3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} PDB: 3str_P* 3sw8_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Length = 203 | Back alignment and structure |
|---|
| >1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Length = 168 | Back alignment and structure |
|---|
| >2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Length = 188 | Back alignment and structure |
|---|
| >3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} PDB: 3oca_A Length = 190 | Back alignment and structure |
|---|
| >2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Length = 188 | Back alignment and structure |
|---|
| >3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} Length = 171 | Back alignment and structure |
|---|
| >3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Length = 238 | Back alignment and structure |
|---|
| >1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Length = 194 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| 3pn3_A | 193 | Peptide deformylase 1B, chloroplastic; PDF, N-term | 100.0 | |
| 3u04_A | 190 | Peptide deformylase 1; ssgcid, actinonin, ehrlichi | 100.0 | |
| 1xeo_A | 168 | Peptide deformylase; cobalt deformylase, formate, | 100.0 | |
| 1n5n_A | 180 | Peptide deformylase; metalloenzyme, drug design, d | 100.0 | |
| 3qu1_A | 171 | Peptide deformylase 2; structural genomics, center | 100.0 | |
| 1rl4_A | 188 | Formylmethionine deformylase; crystal engineering, | 100.0 | |
| 2w3t_A | 188 | Peptide deformylase; protein biosynthesis, iron, n | 100.0 | |
| 2ew5_A | 181 | Peptide deformylase; inhibitor, hydrolase; HET: Y1 | 100.0 | |
| 1lme_A | 176 | PDF, peptide deformylase; thermophIle, metalloenzy | 100.0 | |
| 1v3y_A | 192 | Peptide deformylase; protein synthesis, riken stru | 100.0 | |
| 3e3u_A | 197 | Peptide deformylase; metallo-enzyme, hydrolase, ir | 100.0 | |
| 1y6h_A | 177 | Peptide deformylase; open and close conformation, | 100.0 | |
| 3uwb_A | 154 | RIIA-RIIB membrane-associated protein; actinonin, | 100.0 | |
| 4dr9_A | 192 | Peptide deformylase; hydrolase-hydrolase inhibitor | 100.0 | |
| 3dld_A | 171 | Peptide deformylase; bacterial blight, XOO1075, xa | 100.0 | |
| 1ws0_A | 156 | Peptide deformylase 1; alpha + beta topology, hydr | 100.0 | |
| 3g5k_A | 183 | Peptide deformylase, mitochondrial; actinonin, hyd | 100.0 | |
| 1zxz_A | 197 | PDF, peptide deformylase, mitochondrial; PDF1A, eu | 100.0 | |
| 2okl_A | 185 | Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. | 100.0 | |
| 2os0_A | 188 | Peptide deformylase; PDF, hydrolase; 1.30A {Entero | 100.0 | |
| 1lm4_A | 194 | Peptide deformylase PDF1; metalloenzyme, hydrolase | 100.0 | |
| 3svj_P | 203 | Peptide deformylase 3; alpha-beta, metal binding p | 100.0 | |
| 3l87_A | 238 | Peptide deformylase; hydrolase, iron, metal-bindin | 100.0 |
| >3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-63 Score=398.97 Aligned_cols=162 Identities=78% Similarity=1.296 Sum_probs=143.9
Q ss_pred CHHhhhcCCCeeEeccccCccccEEEEecCCCCCCCceeEEEcceEEeeCCceeecccccCCcCCCceeeccCCeEEEEE
Q 031280 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDA 80 (162)
Q Consensus 1 m~~tM~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~v~INP~Iv~~s~~~~~~~EgCLS~pg~~~~V~R~~~I~V~y 80 (162)
|++|||+++||||||||||+++|+||++..+..++..+.+||||+|++.|+++...+|||||+||+++.|+||.+|+|+|
T Consensus 32 M~eTM~~a~GvGLAApQIGv~~Ri~Vid~~~~~~~~~~~vlINP~I~~~s~~~~~~~EGCLSvPg~~~~V~R~~~I~V~~ 111 (193)
T 3pn3_A 32 MFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDA 111 (193)
T ss_dssp HHHHHHHTTCSEEEGGGGTCCBSEEEECTTCSTTSSCCEEEEEEEEEEECSCEEEEEECCTTSTTCCEEEEEESCEEEEE
T ss_pred HHHHHHHCCCeEEEccccCcceEEEEEECCCCcCCcccEEEECCEEEecCCcEEEeecccccCCCCCCcCcCCCEEEEEE
Confidence 89999999999999999999999999998754434468999999999999998889999999999999999999999999
Q ss_pred EcCCCCEEEEEEecchhhhHHhhhhhhCCceeeecCCHHHHHHHHHHHHHHHHhhHhhcCCCChHHHHHHHhhhhccccC
Q 031280 81 RDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEALEKKYEDKTGLQSPEKIEASKRRKAAVGFG 160 (162)
Q Consensus 81 ~d~~G~~~~~~~~G~~Ar~~QHEiDHL~Gil~~Drl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (162)
+|++|++++++++||+|||||||+|||+|+||+||+++.++.++.+++++++++|+.++++|+||.|..++.+|+++|||
T Consensus 112 ~D~~G~~~~~~~~G~~Ar~iQHEiDHL~GiLfiDrl~~~kr~~~~~k~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 191 (193)
T 3pn3_A 112 RDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQVLDSIREELEALEKKYEEKTGLPSPERVEARQKRKAGVGFG 191 (193)
T ss_dssp ECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHTTHHHHHHHHHHHHHHHSSCCSSCGGGC----------
T ss_pred EcCCCCEEEEEEEChhhhhhhHHHHHhCCEeeeeecCHHHHHHHHHHHHHHHHHHHhccCCCCHHHHHHHhhhhhhhccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CC
Q 031280 161 KS 162 (162)
Q Consensus 161 ~~ 162 (162)
||
T Consensus 192 ~~ 193 (193)
T 3pn3_A 192 KR 193 (193)
T ss_dssp --
T ss_pred CC
Confidence 98
|
| >3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} SCOP: d.167.1.0 PDB: 3oca_A | Back alignment and structure |
|---|
| >1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... | Back alignment and structure |
|---|
| >1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* | Back alignment and structure |
|---|
| >3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} SCOP: d.167.1.0 | Back alignment and structure |
|---|
| >1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A | Back alignment and structure |
|---|
| >2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A | Back alignment and structure |
|---|
| >2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A | Back alignment and structure |
|---|
| >1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 | Back alignment and structure |
|---|
| >1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 | Back alignment and structure |
|---|
| >3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* | Back alignment and structure |
|---|
| >3uwb_A RIIA-RIIB membrane-associated protein; actinonin, probable peptide deformylase hydrolase-antibiotic complex; HET: BB2; 1.70A {Synechococcus phage s-ssm7} PDB: 3uwa_A* | Back alignment and structure |
|---|
| >4dr9_A Peptide deformylase; hydrolase-hydrolase inhibitor complex; HET: BB2; 1.90A {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} SCOP: d.167.1.0 | Back alignment and structure |
|---|
| >1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* | Back alignment and structure |
|---|
| >3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A | Back alignment and structure |
|---|
| >1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A | Back alignment and structure |
|---|
| >2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* | Back alignment and structure |
|---|
| >2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A | Back alignment and structure |
|---|
| >1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* | Back alignment and structure |
|---|
| >3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} SCOP: d.167.1.1 PDB: 3str_P* 3sw8_P* 4eox_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* | Back alignment and structure |
|---|
| >3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 162 | ||||
| d1v3ya_ | 182 | d.167.1.1 (A:) Peptide deformylase {Thermus thermo | 8e-32 | |
| d1y6ha_ | 177 | d.167.1.1 (A:) Peptide deformylase {Leptospira int | 2e-30 | |
| d1lmea_ | 154 | d.167.1.1 (A:) Peptide deformylase {Thermotoga mar | 8e-25 | |
| d1ix1a_ | 169 | d.167.1.1 (A:) Peptide deformylase {Pseudomonas ae | 2e-24 | |
| d1rl4a_ | 165 | d.167.1.1 (A:) Peptide deformylase {Malaria parasi | 2e-23 | |
| d1lm6a_ | 202 | d.167.1.1 (A:) Peptide deformylase {Streptococcus | 1e-22 | |
| d1xeoa1 | 164 | d.167.1.1 (A:1-164) Peptide deformylase {Escherich | 1e-22 | |
| d1lqya_ | 184 | d.167.1.1 (A:) Peptide deformylase {Bacillus stear | 5e-22 | |
| d1lm4a_ | 194 | d.167.1.1 (A:) Peptide deformylase {Staphylococcus | 7e-21 |
| >d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Length = 182 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Peptide deformylase superfamily: Peptide deformylase family: Peptide deformylase domain: Peptide deformylase species: Thermus thermophilus [TaxId: 274]
Score = 110 bits (275), Expect = 8e-32
Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 11/149 (7%)
Query: 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEE----------IVLVNPRVNKYS 50
M + M++ G+GL+APQ+G++ +L V + EGEE + +V V Y
Sbjct: 33 MLETMFEAKGVGLAAPQIGLSQRLFVAVEYADEPEGEEERPLRELVRRVYVVANPVITYR 92
Query: 51 NKMIPYEEGCLSFPGIHA-DVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQG 109
++ EGCLS PG+++ +V R E ++++ +D G + L ARVFQHE DHL G
Sbjct: 93 EGLVEGTEGCLSLPGLYSEEVPRAERIRVEYQDEEGRGRVLELEGYMARVFQHEIDHLDG 152
Query: 110 ILFFERMTDDVLDSIREQLEALEKKYEDK 138
ILFFER+ ++ E A +++ +
Sbjct: 153 ILFFERLPKPKREAFLEANRAELVRFQKE 181
|
| >d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Length = 177 | Back information, alignment and structure |
|---|
| >d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Length = 154 | Back information, alignment and structure |
|---|
| >d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 169 | Back information, alignment and structure |
|---|
| >d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 | Back information, alignment and structure |
|---|
| >d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Length = 202 | Back information, alignment and structure |
|---|
| >d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
| >d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 184 | Back information, alignment and structure |
|---|
| >d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Length = 194 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| d1xeoa1 | 164 | Peptide deformylase {Escherichia coli [TaxId: 562] | 100.0 | |
| d1ix1a_ | 169 | Peptide deformylase {Pseudomonas aeruginosa [TaxId | 100.0 | |
| d1rl4a_ | 165 | Peptide deformylase {Malaria parasite (Plasmodium | 100.0 | |
| d1y6ha_ | 177 | Peptide deformylase {Leptospira interrogans [TaxId | 100.0 | |
| d1lmea_ | 154 | Peptide deformylase {Thermotoga maritima [TaxId: 2 | 100.0 | |
| d1v3ya_ | 182 | Peptide deformylase {Thermus thermophilus [TaxId: | 100.0 | |
| d1lqya_ | 184 | Peptide deformylase {Bacillus stearothermophilus [ | 100.0 | |
| d1lm6a_ | 202 | Peptide deformylase {Streptococcus pneumoniae [Tax | 100.0 | |
| d1lm4a_ | 194 | Peptide deformylase {Staphylococcus aureus [TaxId: | 100.0 |
| >d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Peptide deformylase superfamily: Peptide deformylase family: Peptide deformylase domain: Peptide deformylase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=3.9e-52 Score=325.87 Aligned_cols=130 Identities=41% Similarity=0.653 Sum_probs=121.7
Q ss_pred CHHhhhcCCCeeEeccccCccccEEEEecCCCCCCCceeEEEcceEEeeCCceeecccccCCcCCCceeeccCCeEEEEE
Q 031280 1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDA 80 (162)
Q Consensus 1 m~~tM~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~v~INP~Iv~~s~~~~~~~EgCLS~pg~~~~V~R~~~I~V~y 80 (162)
|++||++++|+||||||||+++|+||++..+.. ..+.+||||+|++.|+.. ..+|||||+||+.+.|+||.+|+|+|
T Consensus 34 m~~tm~~~~GvGLAApQIG~~~rifvv~~~~~~--~~~~v~iNP~I~~~~~~~-~~~EgCLS~Pg~~~~V~R~~~I~v~y 110 (164)
T d1xeoa1 34 MFETMYAEEGIGLAATQVDIHQRIIVIDVSENR--DERLVLINPELLEKSGET-GIEEGCLSIPEQRALVPRAEKVKIRA 110 (164)
T ss_dssp HHHHHHHTTCSEEEGGGGTCCBSEEEECCCTTS--CCCEEEEEEEEEEEECCB-CCEECCTTSTTCCEECCBCSEEEEEE
T ss_pred HHHHhhhcCcceeeehhhccccceEEEEeeccc--CceEEecCcEEeeeccee-eecCCcccccccccccccccEEEEEE
Confidence 789999999999999999999999999886543 357899999999988774 68999999999999999999999999
Q ss_pred EcCCCCEEEEEEecchhhhHHhhhhhhCCceeeecCCHHHHHHHHHHHHHHHH
Q 031280 81 RDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEALEK 133 (162)
Q Consensus 81 ~d~~G~~~~~~~~G~~Ar~~QHEiDHL~Gil~~Drl~~~~~~~~~~~~~~~~~ 133 (162)
+|++|++++.+++||.|||||||+|||+|+||+||+++..+..+.++++++++
T Consensus 111 ~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Dr~~~~~~~~~~kk~~k~~r 163 (164)
T d1xeoa1 111 LDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDR 163 (164)
T ss_dssp ECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHHHHHHHHHHHH
T ss_pred EcCCCCEEEEEEeeeeeehHHHHHHHhCCEehhhhcCHHHHHHHHHHHHHhhc
Confidence 99999999999999999999999999999999999999999999999998764
|
| >d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|