Citrus Sinensis ID: 031294
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| 225427234 | 165 | PREDICTED: glycine cleavage system H pro | 1.0 | 0.981 | 0.830 | 2e-76 | |
| 147770018 | 165 | hypothetical protein VITISV_038357 [Viti | 1.0 | 0.981 | 0.824 | 3e-76 | |
| 255557631 | 165 | glycine cleavage system h protein, putat | 1.0 | 0.981 | 0.806 | 6e-73 | |
| 388509560 | 166 | unknown [Lotus japonicus] | 1.0 | 0.975 | 0.783 | 2e-72 | |
| 449461527 | 165 | PREDICTED: glycine cleavage system H pro | 1.0 | 0.981 | 0.781 | 6e-72 | |
| 437993 | 162 | H-protein [Flaveria cronquistii] gi|4379 | 1.0 | 1.0 | 0.796 | 9e-72 | |
| 3688309 | 162 | H-Protein precursor [Flaveria pringlei] | 1.0 | 1.0 | 0.796 | 2e-71 | |
| 2499417 | 162 | RecName: Full=Glycine cleavage system H | 1.0 | 1.0 | 0.790 | 3e-71 | |
| 547500 | 161 | H-protein [Flaveria pringlei] | 0.993 | 1.0 | 0.795 | 1e-70 | |
| 351721381 | 199 | uncharacterized protein LOC100306654 [Gl | 1.0 | 0.814 | 0.769 | 1e-70 |
| >gi|225427234|ref|XP_002280707.1| PREDICTED: glycine cleavage system H protein, mitochondrial isoform 1 [Vitis vinifera] gi|297742112|emb|CBI33899.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 290 bits (741), Expect = 2e-76, Method: Compositional matrix adjust.
Identities = 137/165 (83%), Positives = 154/165 (93%), Gaps = 3/165 (1%)
Query: 1 MALRMWASSTANALRISCASK---TPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVG 57
MALRMWASSTANALR+SCASK +PAF+LSRCFSSVLDGLKYA+SHEWVKHEGSVAT+G
Sbjct: 1 MALRMWASSTANALRVSCASKAHVSPAFSLSRCFSSVLDGLKYATSHEWVKHEGSVATIG 60
Query: 58 ITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTET 117
ITDHAQDHLGEVVFVE+PE G SV +G GFG VESVKATSDVNSPISGEV+EVN+KL+E
Sbjct: 61 ITDHAQDHLGEVVFVEIPEPGGSVSKGNGFGAVESVKATSDVNSPISGEVVEVNSKLSEA 120
Query: 118 PGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 162
PGL+NSSPYE+GW+IKVKPS+PS+LESLM P+ YTKFCEEE+AAH
Sbjct: 121 PGLINSSPYEDGWMIKVKPSNPSELESLMGPKEYTKFCEEEDAAH 165
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147770018|emb|CAN76620.1| hypothetical protein VITISV_038357 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255557631|ref|XP_002519845.1| glycine cleavage system h protein, putative [Ricinus communis] gi|223540891|gb|EEF42449.1| glycine cleavage system h protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388509560|gb|AFK42846.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449461527|ref|XP_004148493.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like [Cucumis sativus] gi|449513621|ref|XP_004164375.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|437993|emb|CAA81073.1| H-protein [Flaveria cronquistii] gi|437999|emb|CAA81074.1| H-protein [Flaveria pringlei] gi|3688299|emb|CAB16912.1| H-protein [Flaveria pringlei] | Back alignment and taxonomy information |
|---|
| >gi|3688309|emb|CAB16914.1| H-Protein precursor [Flaveria pringlei] | Back alignment and taxonomy information |
|---|
| >gi|2499417|sp|Q39732.1|GCSH_FLAAN RecName: Full=Glycine cleavage system H protein, mitochondrial; Flags: Precursor gi|547558|emb|CAA85761.1| H-protein [Flaveria anomala] | Back alignment and taxonomy information |
|---|
| >gi|547500|emb|CAA85759.1| H-protein [Flaveria pringlei] | Back alignment and taxonomy information |
|---|
| >gi|351721381|ref|NP_001238231.1| uncharacterized protein LOC100306654 [Glycine max] gi|255629191|gb|ACU14940.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| UNIPROTKB|P16048 | 165 | GDCSH "Glycine cleavage system | 1.0 | 0.981 | 0.775 | 1.1e-66 | |
| TAIR|locus:2033802 | 166 | AT1G32470 "AT1G32470" [Arabido | 1.0 | 0.975 | 0.783 | 1.1e-66 | |
| TAIR|locus:2062435 | 165 | GDCH "AT2G35370" [Arabidopsis | 1.0 | 0.981 | 0.751 | 3.3e-63 | |
| TAIR|locus:2063464 | 156 | AT2G35120 "AT2G35120" [Arabido | 0.950 | 0.987 | 0.640 | 5.2e-49 | |
| POMBASE|SPBP19A11.01 | 169 | gcv3 "glycine decarboxylase co | 0.993 | 0.952 | 0.469 | 9.5e-34 | |
| TIGR_CMR|CHY_0490 | 130 | CHY_0490 "glycine cleavage sys | 0.783 | 0.976 | 0.503 | 2.3e-32 | |
| WB|WBGene00009918 | 146 | F52A8.5 [Caenorhabditis elegan | 0.777 | 0.863 | 0.515 | 1.6e-31 | |
| UNIPROTKB|P0A6T9 | 129 | gcvH [Escherichia coli K-12 (t | 0.783 | 0.984 | 0.515 | 3.3e-31 | |
| TIGR_CMR|SO_0780 | 129 | SO_0780 "glycine cleavage syst | 0.783 | 0.984 | 0.531 | 8.8e-31 | |
| WB|WBGene00008354 | 148 | gcsh-1 [Caenorhabditis elegans | 0.783 | 0.858 | 0.480 | 1.1e-30 |
| UNIPROTKB|P16048 GDCSH "Glycine cleavage system H protein, mitochondrial" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
Score = 678 (243.7 bits), Expect = 1.1e-66, P = 1.1e-66
Identities = 128/165 (77%), Positives = 147/165 (89%)
Query: 1 MALRMWASSTANALRISCASK---TPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVG 57
MALRMWASSTANAL++S +S+ +P F++SRCFS+VLDGLKYA SHEWVKHEGSVAT+G
Sbjct: 1 MALRMWASSTANALKLSSSSRLHLSPTFSISRCFSNVLDGLKYAPSHEWVKHEGSVATIG 60
Query: 58 ITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTET 117
ITDHAQDHLGEVVFVELPE G SV +G GFG VESVKATSDVNSPISGEVIEVNT LT
Sbjct: 61 ITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGK 120
Query: 118 PGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 162
PGL+NSSPYE+GW+IK+KP+SP +LESL+ + YTKFCEEE+AAH
Sbjct: 121 PGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH 165
|
|
| TAIR|locus:2033802 AT1G32470 "AT1G32470" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062435 GDCH "AT2G35370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2063464 AT2G35120 "AT2G35120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP19A11.01 gcv3 "glycine decarboxylase complex subunit H (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0490 CHY_0490 "glycine cleavage system H protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009918 F52A8.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6T9 gcvH [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_0780 SO_0780 "glycine cleavage system H protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008354 gcsh-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| PRK01202 | 127 | PRK01202, PRK01202, glycine cleavage system protei | 8e-72 | |
| COG0509 | 131 | COG0509, GcvH, Glycine cleavage system H protein ( | 6e-60 | |
| pfam01597 | 122 | pfam01597, GCV_H, Glycine cleavage H-protein | 2e-59 | |
| cd06848 | 96 | cd06848, GCS_H, Glycine cleavage H-protein | 1e-50 | |
| TIGR00527 | 128 | TIGR00527, gcvH, glycine cleavage system H protein | 1e-47 | |
| PRK13380 | 144 | PRK13380, PRK13380, glycine cleavage system protei | 2e-43 | |
| PRK00624 | 114 | PRK00624, PRK00624, glycine cleavage system protei | 4e-23 | |
| TIGR03077 | 110 | TIGR03077, not_gcvH, glycine cleavage protein H-li | 2e-21 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 9e-18 |
| >gnl|CDD|234918 PRK01202, PRK01202, glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
Score = 211 bits (540), Expect = 8e-72
Identities = 75/126 (59%), Positives = 92/126 (73%)
Query: 32 SSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVE 91
++ LKY SHEWV+ EG ATVGITDHAQ+ LG++VFVELPE G VK G FGVVE
Sbjct: 2 MNIPADLKYTKSHEWVRVEGDTATVGITDHAQEQLGDIVFVELPEVGDEVKAGETFGVVE 61
Query: 92 SVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAY 151
SVKA SD+ +P+SGEV+EVN L ++P LVN PY EGWL K+KPS S+L+ L+D +AY
Sbjct: 62 SVKAASDIYAPVSGEVVEVNEALEDSPELVNEDPYGEGWLFKIKPSDESELDDLLDAEAY 121
Query: 152 TKFCEE 157
EE
Sbjct: 122 EALIEE 127
|
Length = 127 |
| >gnl|CDD|223583 COG0509, GcvH, Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|201881 pfam01597, GCV_H, Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >gnl|CDD|133457 cd06848, GCS_H, Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >gnl|CDD|200024 TIGR00527, gcvH, glycine cleavage system H protein | Back alignment and domain information |
|---|
| >gnl|CDD|237370 PRK13380, PRK13380, glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|167014 PRK00624, PRK00624, glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132121 TIGR03077, not_gcvH, glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 100.0 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 100.0 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 100.0 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 100.0 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 100.0 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 100.0 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 100.0 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 100.0 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 100.0 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.35 | |
| KOG3266 | 172 | consensus Predicted glycine cleavage system H prot | 98.7 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 98.44 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 98.42 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 98.35 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 98.07 | |
| PRK06748 | 83 | hypothetical protein; Validated | 98.05 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 97.91 | |
| PRK07051 | 80 | hypothetical protein; Validated | 97.91 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.83 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 97.81 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.78 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 97.77 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 97.61 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.61 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 97.44 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 97.41 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 97.35 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 97.31 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 97.28 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 97.22 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 97.21 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 97.12 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 97.09 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 97.07 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 97.02 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 97.01 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 96.97 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 96.82 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 96.74 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 96.65 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 96.63 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 96.59 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 96.59 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 96.43 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 96.41 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 96.37 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 96.3 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 96.25 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 96.13 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 96.11 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 96.02 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 95.71 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 95.46 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 95.09 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 95.01 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 94.83 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 94.8 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 94.71 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 94.51 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 94.43 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 94.42 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 94.09 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 93.78 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 93.43 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 93.09 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 93.05 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 92.07 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 92.05 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 91.62 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 91.16 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 90.72 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 90.33 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 90.23 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 90.18 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 89.99 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 89.9 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 89.74 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 89.17 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 88.63 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 88.58 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 87.74 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 87.57 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 85.05 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 81.38 |
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-47 Score=290.97 Aligned_cols=126 Identities=58% Similarity=1.013 Sum_probs=121.9
Q ss_pred cccCCcceeeCCceEEEEeC-CEEEEeechhhhhhcCCeeEEEcCCCCceeecCCeEEEEEEecccceeecccceEEEee
Q 031294 32 SSVLDGLKYASSHEWVKHEG-SVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEV 110 (162)
Q Consensus 32 ~~~p~~~~Ys~~H~Wv~~e~-~~~~vGiTd~a~~~lG~I~~v~lp~~G~~v~~g~~l~~IEs~K~v~~i~sPvsG~Vv~v 110 (162)
+.+|++++|+.+|+||+.++ ++++||||+|||++||+|+||+||++|+++++|+++++|||.|++++++||++|+|++|
T Consensus 3 ~~~p~~l~Y~~~heWvr~e~d~~~tvGiT~~aq~~lGdiv~Velpe~G~~v~~g~~~~~vESvKaasdvyaPvsGeVvev 82 (131)
T COG0509 3 CNIPDDLKYTAEHEWVRVEGDGTATVGITDYAQDQLGDIVFVELPEVGAEVKAGESLAVVESVKAASDVYAPVSGEVVEV 82 (131)
T ss_pred ccccccceeccceEEEEecCCCEEEEeCCHHHHHhcCCEEEEEcCCCCCeecCCCeEEEEEeeeeeccccCCCceeEEEe
Confidence 57899999999999999986 89999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccCCCCcCCCCCCCCcEEEEEeCCh-hhhhcCCCHHHHHHHHHH
Q 031294 111 NTKLTETPGLVNSSPYEEGWLIKVKPSSP-SDLESLMDPQAYTKFCEE 157 (162)
Q Consensus 111 N~~l~~~P~lln~dpy~~GWl~~i~~~~~-~~~~~Lm~~~~Y~~~~~~ 157 (162)
|++|.++|++||+||||+|||++|+++++ ++++.||++++|.+++++
T Consensus 83 N~~l~~~PeliN~dPyg~gWi~klk~~d~~~~~~~L~~~~~y~~~~~~ 130 (131)
T COG0509 83 NEALVDSPELINSDPYGEGWIVKLKPADPSEELEALLDAEAYAELLKE 130 (131)
T ss_pred chhhhcChhhhccCCCCCceEEEEeeCChHHHHHhccCHHHHHHHhhc
Confidence 99999999999999999999999999997 559999999999999864
|
|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >KOG3266 consensus Predicted glycine cleavage system H protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 162 | ||||
| 1hpc_A | 131 | Refined Structures At 2 Angstroms And 2.2 Angstroms | 1e-58 | ||
| 2ka7_A | 124 | Nmr Solution Structure Of Tm0212 At 40 C Length = 1 | 2e-33 | ||
| 3a7a_B | 128 | Crystal Structure Of E. Coli Lipoate-protein Ligase | 3e-32 | ||
| 1zko_A | 136 | Crystal Structure Of Glycine Cleavage System H Prot | 3e-32 | ||
| 3a8i_E | 129 | Crystal Structure Of Et-Ehred-5-Ch3-Thf Complex Len | 1e-31 | ||
| 1onl_A | 128 | Crystal Structure Of Thermus Thermophilus Hb8 H-Pro | 2e-31 | ||
| 2edg_A | 130 | Solution Structure Of The Gcv_h Domain From Mouse G | 3e-31 | ||
| 3klr_A | 125 | Bovine H-Protein At 0.88 Angstrom Resolution Length | 8e-31 | ||
| 3mxu_A | 143 | Crystal Structure Of Glycine Cleavage System Protei | 3e-28 | ||
| 3ift_A | 142 | Crystal Structure Of Glycine Cleavage System Protei | 1e-25 | ||
| 3hgb_A | 155 | Crystal Structure Of Glycine Cleavage System Protei | 1e-25 | ||
| 3tzu_A | 137 | Crystal Structure Of A Glycine Cleavage System H Pr | 9e-18 |
| >pdb|1HPC|A Chain A, Refined Structures At 2 Angstroms And 2.2 Angstroms Of The Two Forms Of The H-Protein, A Lipoamide-Containing Protein Of The Glycine Decarboxylase Length = 131 | Back alignment and structure |
|
| >pdb|2KA7|A Chain A, Nmr Solution Structure Of Tm0212 At 40 C Length = 124 | Back alignment and structure |
| >pdb|3A7A|B Chain B, Crystal Structure Of E. Coli Lipoate-protein Ligase A In Complex With Octyl-amp And Apoh-protein Length = 128 | Back alignment and structure |
| >pdb|1ZKO|A Chain A, Crystal Structure Of Glycine Cleavage System H Protein (Tm0212) From Thermotoga Maritima At 1.65 A Resolution Length = 136 | Back alignment and structure |
| >pdb|3A8I|E Chain E, Crystal Structure Of Et-Ehred-5-Ch3-Thf Complex Length = 129 | Back alignment and structure |
| >pdb|1ONL|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 H-Protein Of The Glycine Cleavage System Length = 128 | Back alignment and structure |
| >pdb|2EDG|A Chain A, Solution Structure Of The Gcv_h Domain From Mouse Glycine Length = 130 | Back alignment and structure |
| >pdb|3KLR|A Chain A, Bovine H-Protein At 0.88 Angstrom Resolution Length = 125 | Back alignment and structure |
| >pdb|3MXU|A Chain A, Crystal Structure Of Glycine Cleavage System Protein H From Henselae Length = 143 | Back alignment and structure |
| >pdb|3IFT|A Chain A, Crystal Structure Of Glycine Cleavage System Protein H From Mycobacterium Tuberculosis, Using X-Rays From The Compact L Source Length = 142 | Back alignment and structure |
| >pdb|3HGB|A Chain A, Crystal Structure Of Glycine Cleavage System Protein H From Mycobacterium Tuberculosis Length = 155 | Back alignment and structure |
| >pdb|3TZU|A Chain A, Crystal Structure Of A Glycine Cleavage System H Protein (Gcvh) From Mycobacterium Marinum Length = 137 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 2e-76 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 1e-73 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 6e-73 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 6e-72 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 2e-71 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 1e-69 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 6e-68 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 2e-63 |
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Length = 131 | Back alignment and structure |
|---|
Score = 223 bits (570), Expect = 2e-76
Identities = 106/131 (80%), Positives = 118/131 (90%)
Query: 32 SSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVE 91
S+VLDGLKYA SHEWVKHEGSVAT+GITDHAQDHLGEVVFVELPE G SV +G GFG VE
Sbjct: 1 SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVE 60
Query: 92 SVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAY 151
SVKATSDVNSPISGEVIEVNT LT PGL+NSSPYE+GW+IK+KP+SP +LESL+ + Y
Sbjct: 61 SVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEY 120
Query: 152 TKFCEEENAAH 162
TKFCEEE+AAH
Sbjct: 121 TKFCEEEDAAH 131
|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Length = 136 | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Length = 128 | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} PDB: 2edg_A Length = 125 | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Length = 128 | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Length = 143 | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Length = 155 | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Length = 137 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 100.0 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 100.0 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 100.0 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 100.0 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 100.0 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 100.0 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 100.0 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 100.0 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 98.54 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 98.27 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 98.22 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 98.17 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 98.16 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 98.15 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 98.15 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 98.1 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 98.08 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 98.07 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 98.06 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 98.03 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 97.99 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 97.89 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 97.88 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 97.88 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 97.84 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 97.83 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 97.77 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 97.73 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 97.63 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 97.49 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 97.22 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 97.2 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 97.12 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 96.92 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 96.89 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 96.44 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 96.31 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 96.17 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 94.71 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 94.56 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 94.32 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 93.98 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 93.91 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 93.75 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 93.45 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 92.06 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 91.1 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 89.85 |
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-48 Score=293.51 Aligned_cols=123 Identities=50% Similarity=0.857 Sum_probs=120.5
Q ss_pred cceeeCCceEEEEeCCEEEEeechhhhhhcCCeeEEEcCCCCceeecCCeEEEEEEecccceeecccceEEEeecccccc
Q 031294 37 GLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTE 116 (162)
Q Consensus 37 ~~~Ys~~H~Wv~~e~~~~~vGiTd~a~~~lG~I~~v~lp~~G~~v~~g~~l~~IEs~K~v~~i~sPvsG~Vv~vN~~l~~ 116 (162)
+++||++|+||+.+|+.++||||+|||++||+|+||+||++|++|++|++|++|||.|++++|+||++|+|++||.+|.+
T Consensus 2 ~l~Yt~~HeWv~~e~~~~~vGITd~Aq~~lGdiv~velp~vG~~v~~G~~~~~VES~K~~sdi~aPvsG~VvevN~~l~~ 81 (125)
T 3klr_A 2 VRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAE 81 (125)
T ss_dssp CCEECTTSEEEEEETTEEEEEECHHHHHHHCSEEEEECCCTTCEECTTCEEEEEEESSCEEEEECSSSEEEEEECGGGTT
T ss_pred CcEeCCCCEEEEEcCCEEEEeeCHHHHhhCCCeEEEEeCCCCCEEcCCCEEEEEEEcceeeeeecCCCEEEEEEhhhhhh
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCcCCCCCCCCcEEEEEeCChhhhhcCCCHHHHHHHHHHhh
Q 031294 117 TPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEEN 159 (162)
Q Consensus 117 ~P~lln~dpy~~GWl~~i~~~~~~~~~~Lm~~~~Y~~~~~~e~ 159 (162)
+|++||+|||++|||++|++++++++++||++++|+++|++.+
T Consensus 82 ~P~liN~dpy~~gWl~ki~~~~~~e~~~Ll~~~~Y~~~~~~~~ 124 (125)
T 3klr_A 82 NPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIE 124 (125)
T ss_dssp CTTHHHHCTTTTTCCEEEEESCGGGGGGSBCHHHHHHHHHHHH
T ss_pred ChHhhcCCCCCCceEEEEEECCHHHHHhcCCHHHHHHHHhhhc
Confidence 9999999999999999999999999999999999999998764
|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 162 | ||||
| d1hpca_ | 131 | b.84.1.1 (A:) Protein H of glycine cleavage system | 5e-56 | |
| d1onla_ | 127 | b.84.1.1 (A:) Protein H of glycine cleavage system | 3e-54 |
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Length = 131 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Protein H of glycine cleavage system species: Pea (Pisum sativum) [TaxId: 3888]
Score = 170 bits (431), Expect = 5e-56
Identities = 106/131 (80%), Positives = 118/131 (90%)
Query: 32 SSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVE 91
S+VLDGLKYA SHEWVKHEGSVAT+GITDHAQDHLGEVVFVELPE G SV +G GFG VE
Sbjct: 1 SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVE 60
Query: 92 SVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAY 151
SVKATSDVNSPISGEVIEVNT LT PGL+NSSPYE+GW+IK+KP+SP +LESL+ + Y
Sbjct: 61 SVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEY 120
Query: 152 TKFCEEENAAH 162
TKFCEEE+AAH
Sbjct: 121 TKFCEEEDAAH 131
|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Length = 127 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 100.0 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 100.0 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 98.41 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 98.31 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 98.14 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 98.14 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 98.12 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 98.11 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 98.07 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 97.94 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 97.91 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 97.74 |
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Protein H of glycine cleavage system species: Pea (Pisum sativum) [TaxId: 3888]
Probab=100.00 E-value=1.4e-48 Score=294.82 Aligned_cols=131 Identities=81% Similarity=1.277 Sum_probs=128.6
Q ss_pred cccCCcceeeCCceEEEEeCCEEEEeechhhhhhcCCeeEEEcCCCCceeecCCeEEEEEEecccceeecccceEEEeec
Q 031294 32 SSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVN 111 (162)
Q Consensus 32 ~~~p~~~~Ys~~H~Wv~~e~~~~~vGiTd~a~~~lG~I~~v~lp~~G~~v~~g~~l~~IEs~K~v~~i~sPvsG~Vv~vN 111 (162)
+++|++++|+++|+|++.+|+.++||||+|||++||+|+||+||++|+.+++|++|++||+.|++.+|+||++|+|+++|
T Consensus 1 ~~v~~~~~Yt~~H~Wv~~e~~~~~vGit~~a~~~lG~i~~v~lp~~g~~v~~g~~~~~iEs~k~~~~i~sPv~G~vv~vN 80 (131)
T d1hpca_ 1 SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVN 80 (131)
T ss_dssp CCCCTTCEECTTSEEEEEETTEEEEEECHHHHHHHCSEEEEECCCTTCEECBTSEEEEEEESSCEEEEEBSSCEEEEEEC
T ss_pred CCCcCcceeCCCeEEEEecCCEEEEEECHHHHhhhhhheeecCCCCCccccCCCceEEEEeecccccccCCcchhheeeh
Confidence 46899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccCCCCcCCCCCCCCcEEEEEeCChhhhhcCCCHHHHHHHHHHhhccC
Q 031294 112 TKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 162 (162)
Q Consensus 112 ~~l~~~P~lln~dpy~~GWl~~i~~~~~~~~~~Lm~~~~Y~~~~~~e~~~~ 162 (162)
.+|.++|++||++||++|||++|++++++++++||++++|.+++++++++|
T Consensus 81 ~~l~~~P~llN~dpy~~gWl~~i~~~d~~~~~~Ll~~~~Y~~~~~e~~~~~ 131 (131)
T d1hpca_ 81 TGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH 131 (131)
T ss_dssp THHHHCTTHHHHCTTTTTCCEEEEESSGGGGGGSBCHHHHHHHHHHHHHCC
T ss_pred hhhhhCHHHHhCCCCCCcEEEEEEECCHHHHHhCCCHHHHHHHHhhhhccC
Confidence 999999999999999999999999999999999999999999999999887
|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|