Citrus Sinensis ID: 031359

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MFRPITRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
ccccHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHccccccccccccccHHHHHHHHHcccEEEEcccHHHHHcccccccEEccccccccccccccHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccccccccccHHHHHHHccccccc
cccccHcccccEEEHHHHHHccccEEEcccccccHHHHHHccHHHccccccccHHHHHHHHHcccEEEEcccHHHHHHccccccEEEEEEccccccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccEEccHHHHHHHHHccccccc
mfrpitrrglLSLTVdqqrcdnigfisskilsfcpkaslrgnleavgvptsvPVRVAHELLQAGhryldvrtpeefsaghatgainvpymyrvgsgmtknLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAawrqnglptep
mfrpitrrgllsltvdqqrCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEvstrfrkhdeiivgcqsgkRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
MFRPITRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
*******RGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWR********
********GLLSLTVDQQRCDNIGFISSKILSFCPKAS*************VPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT**
MFRPITRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
MFRPITRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRPITRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q38853182 Rhodanese-like domain-con yes no 0.900 0.796 0.611 3e-47
P27626183 Senescence-associated pro N/A no 0.695 0.612 0.696 9e-44
Q39129120 Thiosulfate sulfurtransfe no no 0.701 0.941 0.690 2e-41
Q9FKW8136 Thiosulfate sulfurtransfe no no 0.670 0.794 0.463 3e-24
Q8RUD6169 Rhodanese-like domain-con no no 0.664 0.633 0.401 3e-20
F4IPI4156 Rhodanese-like domain-con no no 0.869 0.897 0.326 1e-16
Q94A65224 Rhodanese-like domain-con no no 0.677 0.486 0.310 4e-09
Q7MQ91106 Thiosulfate sulfurtransfe yes no 0.590 0.896 0.303 5e-07
Q8DD53106 Thiosulfate sulfurtransfe yes no 0.590 0.896 0.303 5e-07
Q59WH7438 Adenylyltransferase and s N/A no 0.527 0.194 0.333 8e-07
>sp|Q38853|STR15_ARATH Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana GN=STR15 PE=2 SV=1 Back     alignment and function desciption
 Score =  187 bits (474), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 113/157 (71%), Gaps = 12/157 (7%)

Query: 6   TRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNL--EAVGVPTSVPVRVAHELLQA 63
           TRRG++   V   R  N  +  +   S       RGN+  EAV +PTSVPVRVA EL QA
Sbjct: 35  TRRGVI---VADLRNSNFRWRKATTTS-------RGNVAAEAVKIPTSVPVRVARELAQA 84

Query: 64  GHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQS 123
           G+RYLDVRTP+EFS GH T AINVPYMYRVGSGM KN  F+ +VS+ FRKHDEII+GC+S
Sbjct: 85  GYRYLDVRTPDEFSIGHPTRAINVPYMYRVGSGMVKNPSFLRQVSSHFRKHDEIIIGCES 144

Query: 124 GKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 160
           G+ S MA+TDLL AGF  ITDIAGG+ AW +N LP E
Sbjct: 145 GQMSFMASTDLLTAGFTAITDIAGGYVAWTENELPVE 181

Arabidopsis thaliana (taxid: 3702)
>sp|P27626|DIN1_RAPSA Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q39129|STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2 Back     alignment and function description
>sp|Q9FKW8|STR18_ARATH Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana GN=STR18 PE=1 SV=1 Back     alignment and function description
>sp|Q8RUD6|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1 Back     alignment and function description
>sp|F4IPI4|STR17_ARATH Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana GN=STR17 PE=2 SV=1 Back     alignment and function description
>sp|Q94A65|STR14_ARATH Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana GN=At4g27700 PE=2 SV=1 Back     alignment and function description
>sp|Q7MQ91|GLPE_VIBVY Thiosulfate sulfurtransferase GlpE OS=Vibrio vulnificus (strain YJ016) GN=glpE PE=3 SV=1 Back     alignment and function description
>sp|Q8DD53|GLPE_VIBVU Thiosulfate sulfurtransferase GlpE OS=Vibrio vulnificus (strain CMCP6) GN=glpE PE=3 SV=1 Back     alignment and function description
>sp|Q59WH7|UBA4_CANAL Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
224133954180 predicted protein [Populus trichocarpa] 0.931 0.833 0.772 3e-61
255579783182 Senescence-associated protein DIN1, puta 0.900 0.796 0.767 8e-61
351728052186 uncharacterized protein LOC100305968 [Gl 0.838 0.725 0.748 1e-53
357483967185 Senescence-associated protein DIN1 [Medi 0.838 0.729 0.75 2e-53
351726216185 uncharacterized protein LOC100499831 [Gl 0.838 0.729 0.748 7e-53
359497218177 PREDICTED: senescence-associated protein 0.950 0.864 0.664 8e-53
388501622179 unknown [Lotus japonicus] 0.838 0.754 0.727 3e-52
449434108184 PREDICTED: rhodanese-like domain-contain 0.968 0.847 0.639 1e-47
7340289150 OP1 [Cucumis sativus] 0.919 0.986 0.655 3e-47
147782977176 hypothetical protein VITISV_010789 [Viti 0.919 0.840 0.626 3e-47
>gi|224133954|ref|XP_002327720.1| predicted protein [Populus trichocarpa] gi|222836805|gb|EEE75198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 131/154 (85%), Gaps = 4/154 (2%)

Query: 7   RRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHR 66
           RRG+ +  V+ +RC +I  I+ K LSF PK SLR NLEA G+PTSVPVRVAHEL QAGHR
Sbjct: 30  RRGVFA--VNSRRC-SIN-INHKSLSFRPKTSLRWNLEATGIPTSVPVRVAHELHQAGHR 85

Query: 67  YLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKR 126
           YLDVRTP+EFS GHA GAIN+PYMYRVGSGMTKN KFVEEVS+ FRKHDEIIVGCQ GKR
Sbjct: 86  YLDVRTPDEFSTGHAAGAINIPYMYRVGSGMTKNPKFVEEVSSHFRKHDEIIVGCQLGKR 145

Query: 127 SMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 160
           SMMAATDLL AGF  +TDIAGGFAAW QNGLPT+
Sbjct: 146 SMMAATDLLAAGFTAVTDIAGGFAAWTQNGLPTD 179

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255579783|ref|XP_002530729.1| Senescence-associated protein DIN1, putative [Ricinus communis] gi|223529693|gb|EEF31635.1| Senescence-associated protein DIN1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351728052|ref|NP_001235646.1| uncharacterized protein LOC100305968 [Glycine max] gi|255627141|gb|ACU13915.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357483967|ref|XP_003612270.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|217071246|gb|ACJ83983.1| unknown [Medicago truncatula] gi|355513605|gb|AES95228.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|388495624|gb|AFK35878.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351726216|ref|NP_001236607.1| uncharacterized protein LOC100499831 [Glycine max] gi|255626991|gb|ACU13840.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359497218|ref|XP_002271073.2| PREDICTED: senescence-associated protein DIN1-like [Vitis vinifera] gi|296088206|emb|CBI35721.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388501622|gb|AFK38877.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449434108|ref|XP_004134838.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] gi|449491287|ref|XP_004158850.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|7340289|gb|AAF61174.1|AF245222_1 OP1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147782977|emb|CAN72959.1| hypothetical protein VITISV_010789 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
UNIPROTKB|B2C7Y6185 NRIP1 "Chloroplast N receptor- 0.881 0.767 0.650 1e-43
TAIR|locus:2128038182 SEN1 "AT4G35770" [Arabidopsis 0.751 0.664 0.715 1e-43
TAIR|locus:2156937120 STR16 "AT5G66040" [Arabidopsis 0.701 0.941 0.690 3.4e-38
TAIR|locus:2156882138 STR18 "AT5G66170" [Arabidopsis 0.745 0.869 0.432 3.4e-22
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.658 0.627 0.405 1.9e-19
TAIR|locus:2827795156 AT2G17850 "AT2G17850" [Arabido 0.869 0.897 0.326 2.9e-16
UNIPROTKB|Q607E4120 MCA1816 "Sulfurtransferase" [M 0.503 0.675 0.468 2.4e-12
UNIPROTKB|Q3Z6P8144 DET1392 "Sulfurtransferase" [D 0.509 0.569 0.408 1.2e-10
TIGR_CMR|DET_1392144 DET_1392 "rhodanese-like domai 0.509 0.569 0.408 1.2e-10
UNIPROTKB|Q8ECN1132 SO_3105 "Periplasmic rhodanese 0.590 0.719 0.339 7.6e-09
UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] Back     alignment and assigned GO terms
 Score = 461 (167.3 bits), Expect = 1.0e-43, P = 1.0e-43
 Identities = 93/143 (65%), Positives = 109/143 (76%)

Query:    18 QRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFS 77
             Q+  N G  S++   F   A++   ++   VPTSVPVRVA ELLQAGHRYLDVRT EEFS
Sbjct:    43 QKRRNFGN-SNRTPGFSWMATVGEKVQVSTVPTSVPVRVALELLQAGHRYLDVRTAEEFS 101

Query:    78 AGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNA 137
              GHA GAIN+PYM+R+GSGM KN  F E+V   F K DEIIVGCQ GKRS MAATDLL A
Sbjct:   102 DGHAPGAINIPYMFRIGSGMIKNPNFAEQVLEHFGKDDEIIVGCQLGKRSFMAATDLLAA 161

Query:   138 GFAGITDIAGGFAAWRQNGLPTE 160
             GF+G+TDIAGG+AAW +NGLPT+
Sbjct:   162 GFSGVTDIAGGYAAWTENGLPTD 184
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q607E4 MCA1816 "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q3Z6P8 DET1392 "Sulfurtransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1392 DET_1392 "rhodanese-like domain protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ECN1 SO_3105 "Periplasmic rhodanese domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q38853STR15_ARATHNo assigned EC number0.61140.90060.7967yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.10.914
3rd Layer2.8.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_570018
hypothetical protein (181 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
PLN02160136 PLN02160, PLN02160, thiosulfate sulfurtransferase 3e-29
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 1e-21
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 3e-20
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 5e-19
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 6e-18
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 1e-17
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 7e-13
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 9e-11
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 5e-10
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 1e-09
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 1e-09
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 2e-09
PRK00162108 PRK00162, glpE, thiosulfate sulfurtransferase; Val 2e-09
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 3e-09
cd0152996 cd01529, 4RHOD_Repeats, Member of the Rhodanese Ho 7e-08
PRK10287104 PRK10287, PRK10287, thiosulfate:cyanide sulfurtran 1e-07
TIGR02981101 TIGR02981, phageshock_pspE, phage shock operon rho 3e-07
cd0144496 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and 4e-07
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 7e-07
cd01447103 cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe 9e-07
COG2897285 COG2897, SseA, Rhodanese-related sulfurtransferase 2e-06
cd01449118 cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera 5e-06
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 1e-05
PRK11784 345 PRK11784, PRK11784, tRNA 2-selenouridine synthase; 3e-05
cd01523100 cd01523, RHOD_Lact_B, Member of the Rhodanese Homo 4e-05
TIGR03167 311 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine s 6e-05
cd01520128 cd01520, RHOD_YbbB, Member of the Rhodanese Homolo 2e-04
cd0153495 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese H 0.001
cd01521110 cd01521, RHOD_PspE2, Member of the Rhodanese Homol 0.004
>gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase Back     alignment and domain information 
 Score =  104 bits (259), Expect = 3e-29
 Identities = 51/111 (45%), Positives = 70/111 (63%), Gaps = 2/111 (1%)

Query: 51  SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVS 108
           SV V  A  LLQ+GH+YLDVRT +EF  GH   A  +N+PYM     G  KN +F+E+VS
Sbjct: 16  SVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVS 75

Query: 109 TRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT 159
           +     D+I+VGCQSG RS+ A T+L+ AG+  + +  GG+ AW  +  P 
Sbjct: 76  SLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNKGGGYLAWVDHSFPI 126

Length = 136
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|238787 cd01529, 4RHOD_Repeats, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>gnl|CDD|132026 TIGR02981, phageshock_pspE, phage shock operon rhodanese PspE Back     alignment and domain information
>gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|236982 PRK11784, PRK11784, tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>gnl|CDD|238781 cd01523, RHOD_Lact_B, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|234132 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine synthase Back     alignment and domain information
>gnl|CDD|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238792 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>gnl|CDD|238779 cd01521, RHOD_PspE2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
PLN02160136 thiosulfate sulfurtransferase 99.94
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.94
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.93
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.93
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.93
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.92
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.91
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.91
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.91
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.91
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.91
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.91
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.9
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.9
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.9
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.9
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.9
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.9
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.9
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.9
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.9
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.9
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.89
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.89
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.89
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.89
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.88
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.88
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.88
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.88
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.88
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.87
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.87
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.87
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.86
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.85
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.85
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.85
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.85
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.85
PRK01415247 hypothetical protein; Validated 99.84
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.84
PRK05320257 rhodanese superfamily protein; Provisional 99.84
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.83
PRK07411390 hypothetical protein; Validated 99.82
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.81
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.8
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.79
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.79
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.78
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.77
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.75
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.7
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 99.6
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.59
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.52
COG1054308 Predicted sulfurtransferase [General function pred 99.47
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 99.42
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.39
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.8
COG2603 334 Predicted ATPase [General function prediction only 97.79
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 97.56
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 97.5
KOG1093725 consensus Predicted protein kinase (contains TBC a 96.79
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 96.64
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 96.26
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 95.75
KOG3636 669 consensus Uncharacterized conserved protein, conta 95.74
COG3453130 Uncharacterized protein conserved in bacteria [Fun 94.19
KOG1717 343 consensus Dual specificity phosphatase [Defense me 93.21
PLN02727 986 NAD kinase 93.07
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 91.27
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 90.31
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 86.85
PRK11784345 tRNA 2-selenouridine synthase; Provisional 85.22
PF03853169 YjeF_N: YjeF-related protein N-terminus; InterPro: 84.74
PF09992170 DUF2233: Predicted periplasmic protein (DUF2233); 81.57
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 81.46
KOG0333 673 consensus U5 snRNP-like RNA helicase subunit [RNA 80.71
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information 
Probab=99.94  E-value=1.8e-26  Score=158.76  Aligned_cols=113  Identities=45%  Similarity=0.819  Sum_probs=94.2

Q ss_pred             CcccCHHHHHHHHhCCCEEEEcCChhhHhcCCCCCc--EEeccccccCCCCCCCHHHHHHHHhcCCCCCeEEEEeCCchh
Q 031359           49 PTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKR  126 (161)
Q Consensus        49 ~~~i~~~~~~~~~~~~~~liDvR~~~e~~~ghIpgA--~nip~~~~~~~~~~~~~~~~~~~~~~l~~~~~ivv~c~~g~~  126 (161)
                      ...++++++.++++++.+|||||++.||..||||||  +|+|+........+...++.......++++++||+||.+|.|
T Consensus        14 ~~~i~~~e~~~~~~~~~~lIDVR~~~E~~~ghIpgA~~iniP~~~~~~~~~l~~~~~~~~~~~~~~~~~~IivyC~sG~R   93 (136)
T PLN02160         14 VVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVSSLLNPADDILVGCQSGAR   93 (136)
T ss_pred             eeEeCHHHHHHHHhCCCEEEECCCHHHHhcCCCCCcceecccchhcCcccccCCHHHHHHHHhccCCCCcEEEECCCcHH
Confidence            457889999998887788999999999999999999  899974332223333445555454446788999999999999


Q ss_pred             HHHHHHHHHHCCCcceeEecccHHHHhhCCCCCCC
Q 031359          127 SMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP  161 (161)
Q Consensus       127 a~~~~~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~  161 (161)
                      |..++..|...||.+|++|.||+.+|.++|+|+++
T Consensus        94 S~~Aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~  128 (136)
T PLN02160         94 SLKATTELVAAGYKKVRNKGGGYLAWVDHSFPINQ  128 (136)
T ss_pred             HHHHHHHHHHcCCCCeeecCCcHHHHhhCCCCccc
Confidence            99999999999999999999999999999999864

>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PF03853 YjeF_N: YjeF-related protein N-terminus; InterPro: IPR004443 The YjeF N-terminal domains occur either as single proteins or fusions with other domains and are commonly associated with enzymes Back     alignment and domain information
>PF09992 DUF2233: Predicted periplasmic protein (DUF2233); InterPro: IPR018711 This entry contains proteins that catalyze the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides, this is achieved by removing GlcNAc residues from GlcNAc-alpha-P-mannose moieties, which are formed in the first step Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 9e-43
3tp9_A474 Crystal Structure Of Alicyclobacillus Acidocaldariu 2e-07
2kl3_A132 Solution Nmr Structure Of The Rhodanese-Like Domain 8e-06
3r2u_A466 2.1 Angstrom Resolution Crystal Structure Of Metall 2e-05
3ilm_A141 Crystal Structure Of The Alr3790 Protein From Anaba 2e-05
3k9r_A115 X-Ray Structure Of The Rhodanese-Like Domain Of The 2e-05
3hix_A106 Crystal Structure Of The Rhodanese_3 Like Domain Fr 2e-05
1gn0_A108 Escherichia Coli Glpe Sulfurtransferase Soaked With 3e-05
2jtq_A85 Rhodanese From E.Coli Length = 85 9e-05
3d1p_A139 Atomic Resolution Structure Of Uncharacterized Prot 2e-04
3gk5_A108 Crystal Structure Of Rhodanese-Related Protein (Tvg 2e-04
3nta_A574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 2e-04
2eg4_A230 Crystal Structure Of Probable Thiosulfate Sulfurtra 4e-04
1qxn_A137 Solution Structure Of The 30 Kda Polysulfide-Sulfur 5e-04
1gmx_A108 Escherichia Coli Glpe Sulfurtransferase Length = 10 6e-04
3icr_A588 Crystal Structure Of Oxidized Bacillus Anthracis Co 6e-04
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure 
Iteration: 1

 Score =  169 bits (427), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%)
Query: 48  VPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEV 107
           VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F+E+V
Sbjct: 16  VPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQV 75
Query: 108 STRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 160
           S+ F + D IIVGCQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 76  SSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 128
>pdb|3TP9|A Chain A, Crystal Structure Of Alicyclobacillus Acidocaldarius Protein With Beta-Lactamase And Rhodanese Domains Length = 474 Back     alignment and structure
>pdb|2KL3|A Chain A, Solution Nmr Structure Of The Rhodanese-Like Domain From Anabaena Sp Alr3790 Protein. Northeast Structural Genomics Consortium Target Nsr437a Length = 132 Back     alignment and structure
>pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466 Back     alignment and structure
>pdb|3ILM|A Chain A, Crystal Structure Of The Alr3790 Protein From Anabaena Sp. Northeast Structural Genomics Consortium Target Nsr437h Length = 141 Back     alignment and structure
>pdb|3K9R|A Chain A, X-Ray Structure Of The Rhodanese-Like Domain Of The Alr3790 Protein From Anabaena Sp. Northeast Structural Genomics Consortium Target Nsr437c. Length = 115 Back     alignment and structure
>pdb|3HIX|A Chain A, Crystal Structure Of The Rhodanese_3 Like Domain From Anabaena Sp Alr3790 Protein. Northeast Structural Genomics Consortium Target Nsr437i Length = 106 Back     alignment and structure
>pdb|1GN0|A Chain A, Escherichia Coli Glpe Sulfurtransferase Soaked With Kcn Length = 108 Back     alignment and structure
>pdb|2JTQ|A Chain A, Rhodanese From E.Coli Length = 85 Back     alignment and structure
>pdb|3D1P|A Chain A, Atomic Resolution Structure Of Uncharacterized Protein From Saccharomyces Cerevisiae Length = 139 Back     alignment and structure
>pdb|3GK5|A Chain A, Crystal Structure Of Rhodanese-Related Protein (Tvg0868615) From Thermoplasma Volcanium, Northeast Structural Genomics Consortium Target Tvr109a Length = 108 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|2EG4|A Chain A, Crystal Structure Of Probable Thiosulfate Sulfurtransferase Length = 230 Back     alignment and structure
>pdb|1QXN|A Chain A, Solution Structure Of The 30 Kda Polysulfide-Sulfur Transferase Homodimer From Wolinella Succinogenes Length = 137 Back     alignment and structure
>pdb|1GMX|A Chain A, Escherichia Coli Glpe Sulfurtransferase Length = 108 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1tq1_A129 AT5G66040, senescence-associated family protein; C 3e-49
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-29
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 9e-29
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 8e-25
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 1e-23
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 3e-23
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 3e-22
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 7e-22
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 1e-21
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-21
3foj_A100 Uncharacterized protein; protein SSP1007, structur 3e-21
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 3e-21
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 1e-05
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 4e-21
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 2e-20
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 6e-20
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 7e-20
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-16
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 9e-12
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-09
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 7e-20
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 2e-19
2jtq_A85 Phage shock protein E; solution structure rhodanes 2e-19
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 3e-18
3r2u_A466 Metallo-beta-lactamase family protein; structural 2e-17
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 3e-16
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 2e-15
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 5e-13
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 4e-12
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 6e-11
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 2e-10
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 7e-10
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 3e-09
3op3_A216 M-phase inducer phosphatase 3; structural genomics 4e-09
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 6e-09
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 4e-07
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 6e-07
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 7e-06
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 1e-05
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 2e-05
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 2e-05
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 3e-05
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 4e-05
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 5e-05
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 6e-05
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 6e-05
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 3e-04
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 3e-04
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 9e-04
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score =  154 bits (390), Expect = 3e-49
 Identities = 79/117 (67%), Positives = 93/117 (79%)

Query: 44  EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 103
           E   VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F
Sbjct: 12  EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 71

Query: 104 VEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 160
           +E+VS+ F + D IIVGCQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 72  LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 128
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Length = 280 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Length = 277 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Length = 296 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Length = 154 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Length = 302 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.97
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.97
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.96
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.96
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.96
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.95
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.95
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.95
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.95
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.95
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.94
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.94
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.94
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.94
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.94
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.94
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.93
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.93
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.93
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.93
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.93
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.92
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.92
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.91
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.91
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.91
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.91
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.91
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.91
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.91
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.9
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.9
1vee_A134 Proline-rich protein family; hypothetical protein, 99.9
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.9
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.89
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.89
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.89
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.89
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.89
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.89
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.89
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.89
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.88
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.88
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.87
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.87
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.87
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.87
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.87
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.86
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.86
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.85
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.85
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.83
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.83
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.83
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.82
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.8
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.8
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.78
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.77
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.77
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.76
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.51
2f46_A156 Hypothetical protein; structural genomics, joint c 98.24
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 94.85
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 94.12
1xri_A151 AT1G05000; structural genomics, protein structure 93.97
1v8c_A168 MOAD related protein; riken structural genomics/pr 93.85
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 92.19
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 92.09
2hcm_A164 Dual specificity protein phosphatase; structural g 92.0
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 91.9
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 91.21
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 90.38
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 90.14
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 90.13
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 89.91
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 89.44
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 88.84
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 88.7
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 86.78
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 86.5
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 86.36
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 85.74
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 85.3
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 84.8
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 83.5
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 82.8
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 82.33
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 82.29
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
Probab=99.97  E-value=1.4e-30  Score=170.34  Aligned_cols=99  Identities=25%  Similarity=0.402  Sum_probs=87.3

Q ss_pred             cccCHHHHHHHHhC--CCEEEEcCChhhHhcCCCCCcEEeccccccCCCCCCCHHHHHHHHhcCCCCCeEEEEeCCchhH
Q 031359           50 TSVPVRVAHELLQA--GHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKRS  127 (161)
Q Consensus        50 ~~i~~~~~~~~~~~--~~~liDvR~~~e~~~ghIpgA~nip~~~~~~~~~~~~~~~~~~~~~~l~~~~~ivv~c~~g~~a  127 (161)
                      ..|+++++++++.+  +++|||||++.||..||||||+|+|+.            .+......++++++||+||.+|.||
T Consensus         2 k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~~ip~~------------~l~~~~~~l~~~~~ivv~C~~G~rS   69 (103)
T 3iwh_A            2 KSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMD------------TIPDNLNSFNKNEIYYIVCAGGVRS   69 (103)
T ss_dssp             CEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCEECCGG------------GGGGCGGGCCTTSEEEEECSSSSHH
T ss_pred             CCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCcccCccc------------chhhhhhhhcCCCeEEEECCCCHHH
Confidence            36899999887754  388999999999999999999999993            3444556788999999999999999


Q ss_pred             HHHHHHHHHCCCcceeEecccHHHHhhCCCCCCC
Q 031359          128 MMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP  161 (161)
Q Consensus       128 ~~~~~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~  161 (161)
                      ..++..|++.||+++ .|.||+.+|.++|+|+++
T Consensus        70 ~~aa~~L~~~G~~~~-~l~GG~~~W~~~g~pves  102 (103)
T 3iwh_A           70 AKVVEYLEANGIDAV-NVEGGMHAWGDEGLEIKS  102 (103)
T ss_dssp             HHHHHHHHTTTCEEE-EETTHHHHHCSSSCBCCC
T ss_pred             HHHHHHHHHcCCCEE-EecChHHHHHHCCCccee
Confidence            999999999999755 699999999999999985
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 5e-35
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 3e-15
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 3e-11
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 2e-10
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 2e-10
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 3e-10
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 5e-10
d1yt8a3157 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase 9e-09
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 1e-08
d1okga2139 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran 2e-08
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 3e-08
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 1e-07
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 2e-07
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 5e-07
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 1e-06
d1urha2120 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran 2e-06
d1okga1156 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf 6e-06
d1rhsa2144 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ 1e-05
d1urha1147 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf 6e-05
d1rhsa1149 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta 6e-05
d1uara2141 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th 1e-04
d1t3ka_132 c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { 0.002
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  116 bits (291), Expect = 5e-35
 Identities = 79/117 (67%), Positives = 93/117 (79%)

Query: 44  EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 103
           E   VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F
Sbjct: 2   EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 61

Query: 104 VEEVSTRFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 160
           +E+VS+ F + D IIVGCQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 62  LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 118
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.97
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.95
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.95
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.94
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.94
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.93
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.93
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.93
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.93
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.93
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.92
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.91
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.91
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.9
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.89
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.89
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.75
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.71
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 95.62
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 94.91
d1ywfa1 272 Phosphotyrosine protein phosphatase PtpB {Mycobact 91.78
d1t5la2 181 Nucleotide excision repair enzyme UvrB {Bacillus c 91.51
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 91.32
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 90.38
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 87.58
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 87.07
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 86.08
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 85.62
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 85.44
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 84.79
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.15
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 83.45
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 83.14
d1jl3a_137 Arsenate reductase ArsC {Bacillus subtilis [TaxId: 83.07
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 81.64
d1vkra_97 PTS system mannitol-specific EIICBA component {Esc 80.65
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.97  E-value=9.6e-32  Score=178.67  Aligned_cols=115  Identities=68%  Similarity=1.123  Sum_probs=103.5

Q ss_pred             CCCcccCHHHHHHHHhCCCEEEEcCChhhHhcCCCCCcEEeccccccCCCCCCCHHHHHHHHhcCCCCCeEEEEeCCchh
Q 031359           47 GVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIVGCQSGKR  126 (161)
Q Consensus        47 ~~~~~i~~~~~~~~~~~~~~liDvR~~~e~~~ghIpgA~nip~~~~~~~~~~~~~~~~~~~~~~l~~~~~ivv~c~~g~~  126 (161)
                      ..+..++++.+.++++.+.+|||||++.||..||||||+|+|+............+++.+....++++++|||||.+|.|
T Consensus         5 ~~p~~i~~~~a~~l~~~g~~liDvR~~~e~~~ghi~ga~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~~C~~G~r   84 (119)
T d1tq1a_           5 RVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGR   84 (119)
T ss_dssp             CCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSCSH
T ss_pred             cCCCccCHHHHHHHHHCcCEEEECCCHHHHHcCCCCCccchhhcccccccccccHHHHHHHHHhcCCCcEEEEEcCCcCc
Confidence            56678999999999988999999999999999999999999986555555556677888888888999999999999999


Q ss_pred             HHHHHHHHHHCCCcceeEecccHHHHhhCCCCCCC
Q 031359          127 SMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP  161 (161)
Q Consensus       127 a~~~~~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~  161 (161)
                      |..++..|.+.||+||++|+||+.+|.++|+|++.
T Consensus        85 s~~a~~~L~~~G~~nv~~l~GG~~~W~~~g~P~ea  119 (119)
T d1tq1a_          85 SIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA  119 (119)
T ss_dssp             HHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC-
T ss_pred             HHHHHHHHHhcccCCeEEecChHHHHHHCCCCccC
Confidence            99999999999999999999999999999999974
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure