Citrus Sinensis ID: 031454

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
cEEEEccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccEEcccccccccccccccccccccEEcccccccEEEcccccccccccEEEEEcccccccccccccccccccEEEEccHHHHHHccccccccccccccccEEEcc
ccEccccccEEcccccccccccEEEEEEcccccccEEEEEcccccEEEEEccHHHHHHccccccccccccccccHHcEEEEEcccHHHHHHHcccccccccEEEEEccccccccccccccccccccEEEEccHHHHHHcccccHHHHHHHcccccEEcc
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILapnlkrismhdchYLEEIVSLEKLggqmqnripfaRLECLSLYGLEklrsiypralpfphlkelkvdlcpelkklpfdctsglERKLIIKGQEWWwnnlqwgdqatqnaflpclktlyf
MEIDYAGEEVKRilktngffslqrvsigrsklrhvTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
********EVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLY*
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPF*****L***LIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTLYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
O23317719 Probable disease resistan yes no 0.949 0.210 0.418 3e-22
Q8L3R3885 Disease resistance protei yes no 0.893 0.160 0.421 2e-21
O64973889 Disease resistance protei no no 0.861 0.154 0.407 4e-20
Q8RXS5888 Probable disease resistan no no 0.899 0.161 0.394 1e-19
P60838894 Probable disease resistan no no 0.880 0.156 0.402 4e-19
Q9C8T9898 Putative disease resistan no no 0.849 0.150 0.407 1e-18
O82484892 Putative disease resistan no no 0.886 0.158 0.364 1e-18
Q9SH22884 Probable disease resistan no no 0.849 0.152 0.4 3e-18
O22727967 Probable disease resistan no no 0.773 0.127 0.404 9e-18
Q9SI85893 Probable disease resistan no no 0.849 0.151 0.385 2e-17
>sp|O23317|DRL24_ARATH Probable disease resistance protein At4g14610 OS=Arabidopsis thaliana GN=At4g14610 PE=3 SV=1 Back     alignment and function desciption
 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 94/160 (58%), Gaps = 9/160 (5%)

Query: 8   EEVKRILKTNG-FFSLQRVSIGR-SKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLG 65
           +E+K  ++T+  F SL +V IG+   L+ +TWL+ APNL  +       LE+I+S EK  
Sbjct: 559 KEIKVEMRTSSCFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAA 618

Query: 66  GQMQNR----IPFARLECLSLYGLEKLRSIYPRALPFPHLKELKV-DLCPELKKLPFDCT 120
                     IPF +LECLSL  L KL+SIY   L FP L EL V + CP+LKKLP +  
Sbjct: 619 SVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSK 678

Query: 121 SGLER-KLIIK-GQEWWWNNLQWGDQATQNAFLPCLKTLY 158
           SG    +L++K G+  W   ++W D+AT+  FL   K+LY
Sbjct: 679 SGTAGVELVVKYGENKWLEGVEWEDKATELRFLATCKSLY 718
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
24461861 890 NBS-LRR type disease resistance protein 0.937 0.167 0.493 3e-31
24461864 899 NBS-LRR type disease resistance protein 0.943 0.166 0.461 2e-28
147866649 350 hypothetical protein VITISV_018478 [Viti 0.968 0.44 0.419 2e-28
24461866 890 NBS-LRR type disease resistance protein 0.949 0.169 0.431 6e-28
224122896 820 cc-nbs-lrr resistance protein [Populus t 0.886 0.171 0.465 2e-26
297743409 1145 unnamed protein product [Vitis vinifera] 0.786 0.109 0.460 2e-26
147852651 882 hypothetical protein VITISV_017542 [Viti 0.968 0.174 0.383 2e-26
359482672 905 PREDICTED: probable disease resistance p 0.968 0.170 0.389 5e-26
24461865 892 NBS-LRR type disease resistance protein 0.955 0.170 0.434 7e-26
225442867 893 PREDICTED: probable disease resistance p 0.968 0.172 0.395 1e-25
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 102/158 (64%), Gaps = 9/158 (5%)

Query: 1   MEIDYAGEEVKRILKTNGFFSLQRVSIGR-SKLRHVTWLILAPNLKRISMHDCHYLEEIV 59
           ++IDYAGE V+R     GF SLQ   +   SKL+ +T L+L PNLK I + DC  +EEI+
Sbjct: 740 LKIDYAGE-VQRY----GFHSLQSFEVNYCSKLKDLTLLVLIPNLKSIEVTDCEAMEEII 794

Query: 60  SLEKLGGQMQNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDC 119
           S+ +  G   N   FA+L+ L +  L  L+SIY + LPFP L+EL V  C ELKKLP D 
Sbjct: 795 SVGEFAG---NPNAFAKLQYLGIGNLPNLKSIYWKPLPFPCLEELTVSDCYELKKLPLDS 851

Query: 120 TSGLERKLIIKGQEWWWNNLQWGDQATQNAFLPCLKTL 157
            S  E K++I+G   WW NLQW D+ATQNAFL C ++L
Sbjct: 852 NSAKEHKIVIRGAANWWRNLQWEDEATQNAFLSCFQSL 889

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|147866649|emb|CAN81572.1| hypothetical protein VITISV_018478 [Vitis vinifera] Back     alignment and taxonomy information
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297743409|emb|CBI36276.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.893 0.160 0.421 6.4e-23
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.842 0.150 0.408 3.9e-20
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.880 0.156 0.402 8.3e-20
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.836 0.148 0.413 1.7e-19
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.867 0.155 0.401 2.2e-19
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.842 0.151 0.402 3.6e-19
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.880 0.156 0.366 9.7e-19
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.849 0.152 0.394 2e-18
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.842 0.150 0.402 7e-18
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.792 0.130 0.406 7.9e-18
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 6.4e-23, P = 6.4e-23
 Identities = 62/147 (42%), Positives = 91/147 (61%)

Query:    11 KRILKTNGFFSLQRVSI-GRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQ 69
             K+ L    F +L  V I G   L+ +TWL+ APNL  + +  C +LE+I+S EK    ++
Sbjct:   734 KKNLTNPNFSNLSNVRIEGCDGLKDLTWLLFAPNLINLRVWGCKHLEDIISKEKAASVLE 793

Query:    70 NRI-PFARLECLSLYGLEKLRSIYPRALPFPHLKELKV-DLCPELKKLPFDCTSGLE-RK 126
               I PF +LECL+LY L +L+SIY  ALPF  L+ L + + CP+L+KLP D  S ++  +
Sbjct:   794 KEILPFQKLECLNLYQLSELKSIYWNALPFQRLRCLDILNNCPKLRKLPLDSKSVVKVEE 853

Query:   127 LIIKGQEWWW-NNLQWGDQATQNAFLP 152
              +IK +E  W   ++W D+ATQ  FLP
Sbjct:   854 FVIKYKEKKWIERVEWEDEATQYRFLP 880
GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0009617 "response to bacterium" evidence=ISS
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034583001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1042 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.76
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.45
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.24
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.37
PRK15386 426 type III secretion protein GogB; Provisional 97.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.24
PRK15386 426 type III secretion protein GogB; Provisional 97.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.78
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.7
KOG0617 264 consensus Ras suppressor protein (contains leucine 96.49
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.42
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.31
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.29
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.06
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 94.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.89
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.84
PLN03150623 hypothetical protein; Provisional 93.38
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 93.2
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 93.05
PLN03150623 hypothetical protein; Provisional 92.8
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 92.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 90.13
KOG0617264 consensus Ras suppressor protein (contains leucine 90.03
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 89.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 87.76
KOG4341 483 consensus F-box protein containing LRR [General fu 87.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 87.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.7
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 84.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 84.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.72
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 81.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 80.88
KOG0472 565 consensus Leucine-rich repeat protein [Function un 80.32
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=98.76  E-value=2.2e-08  Score=94.70  Aligned_cols=114  Identities=18%  Similarity=0.217  Sum_probs=75.1

Q ss_pred             cccCccccccccCCCCCCCceEEEEecCCcCCcc-cccCCCCcceEEEEcCcCCccccccccccc----------c---c
Q 031454            3 IDYAGEEVKRILKTNGFFSLQRVSIGRSKLRHVT-WLILAPNLKRISMHDCHYLEEIVSLEKLGG----------Q---M   68 (159)
Q Consensus         3 ~~~~~~~~~~~p~~~~~~~L~~L~I~~~~l~~l~-~l~~Lp~Le~L~I~~C~~l~~l~~~~~~~~----------~---~   68 (159)
                      ++|.+|+.+++|....+.+|++|++.+++++.++ ....+++|+.|++++|..+..++.......          +   .
T Consensus       594 L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~l  673 (1153)
T PLN03210        594 LRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVEL  673 (1153)
T ss_pred             EEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCcccc
Confidence            5789999999999888888888888875566653 245677777777777766665543111000          0   0


Q ss_pred             -CCCCCCCccceecccCcccccccCCCCcCCCCccEEeEeccCCCCccCC
Q 031454           69 -QNRIPFARLECLSLYGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPF  117 (159)
Q Consensus        69 -~~~~~fp~L~~L~l~~~~~L~~i~~~~~~~psLe~L~i~~Cp~L~~lP~  117 (159)
                       .....+++|+.|.+.+|.+++.++... .+++|+.|.+.+|..++.+|.
T Consensus       674 p~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~  722 (1153)
T PLN03210        674 PSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPD  722 (1153)
T ss_pred             chhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCcccccc
Confidence             123345677777777777777766532 567777777777777776664

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.4
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.4
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.32
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.3
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.24
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.16
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.09
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.03
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.02
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.0
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.99
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.98
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.98
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.98
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.98
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.97
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.94
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.94
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.94
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.94
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.92
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.92
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.88
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.87
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.86
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.86
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.85
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.82
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.81
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.8
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.79
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.78
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.78
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.78
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.77
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.76
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.75
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.72
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.7
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.62
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.62
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.61
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.61
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.59
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.57
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.57
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.57
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.57
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.57
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.56
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 97.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.54
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.54
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.52
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.51
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.51
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.51
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.5
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.5
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.46
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.46
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.43
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.4
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.4
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.4
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.39
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.32
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 97.32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.24
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.16
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.01
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 96.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 96.93
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.78
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 96.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.75
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.75
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 96.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.47
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 96.35
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.8
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.69
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.34
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 94.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.02
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 94.02
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 93.45
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 93.08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.02
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 92.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 91.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 91.09
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 90.73
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 86.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 86.82
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 81.91
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=98.68  E-value=5.1e-08  Score=78.52  Aligned_cols=120  Identities=19%  Similarity=0.179  Sum_probs=79.5

Q ss_pred             CCCceEEEEecCCcCCcc-cccCCCCcceEEEEcCcCCccccccc-cccc-------------cc-CCCCCCCccceecc
Q 031454           19 FFSLQRVSIGRSKLRHVT-WLILAPNLKRISMHDCHYLEEIVSLE-KLGG-------------QM-QNRIPFARLECLSL   82 (159)
Q Consensus        19 ~~~L~~L~I~~~~l~~l~-~l~~Lp~Le~L~I~~C~~l~~l~~~~-~~~~-------------~~-~~~~~fp~L~~L~l   82 (159)
                      +++|++|++++++++.++ .+..+++|++|++++|. +..++..- ....             .. .....+++|+.|++
T Consensus       182 l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~-l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L  260 (328)
T 4fcg_A          182 LVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLIL  260 (328)
T ss_dssp             STTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSC-CCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEEC
T ss_pred             CCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCC-CCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEEC
Confidence            777888888775565553 36677777888777774 33333210 0000             00 23456789999999


Q ss_pred             cCcccccccCCCCcCCCCccEEeEeccCCCCccCCCCCCCCCCceEEechhhhhhhcc
Q 031454           83 YGLEKLRSIYPRALPFPHLKELKVDLCPELKKLPFDCTSGLERKLIIKGQEWWWNNLQ  140 (159)
Q Consensus        83 ~~~~~L~~i~~~~~~~psLe~L~i~~Cp~L~~lP~~~~~~~~~l~~v~~~~e~~~~l~  140 (159)
                      .+|..+..++.....+++|+.|.+.+|+.+..+|..... +.++.++.........+.
T Consensus       261 ~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~-L~~L~~l~l~~~~~~~l~  317 (328)
T 4fcg_A          261 KDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ-LPANCIILVPPHLQAQLD  317 (328)
T ss_dssp             TTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGG-SCTTCEEECCGGGSCC--
T ss_pred             CCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhh-ccCceEEeCCHHHHHHHh
Confidence            999988888776678899999999999999989876433 366777765554444433
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.26
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.16
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.08
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.06
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.03
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.0
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.96
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.83
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.83
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.82
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.78
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.66
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.63
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.6
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.44
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.2
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.19
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.17
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.03
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.03
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 96.98
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 96.86
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.85
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 96.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 92.79
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 85.55
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 80.7
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.26  E-value=4.8e-07  Score=64.53  Aligned_cols=103  Identities=15%  Similarity=0.126  Sum_probs=62.2

Q ss_pred             cccCccccccccCC-CCCCCceEEEEecCCcCCcccccCCCCcceEEEEcCcCCcccccccccccccCCCCCCCccceec
Q 031454            3 IDYAGEEVKRILKT-NGFFSLQRVSIGRSKLRHVTWLILAPNLKRISMHDCHYLEEIVSLEKLGGQMQNRIPFARLECLS   81 (159)
Q Consensus         3 ~~~~~~~~~~~p~~-~~~~~L~~L~I~~~~l~~l~~l~~Lp~Le~L~I~~C~~l~~l~~~~~~~~~~~~~~~fp~L~~L~   81 (159)
                      +|-.|....+++.. ..+++|++|++++++++.+..+..+++|++|.+++|. +..++...        ...+|+|+.|.
T Consensus        23 L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~~~~l~~L~~L~ls~N~-i~~l~~~~--------~~~l~~L~~L~   93 (162)
T d1a9na_          23 LDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNR-ICRIGEGL--------DQALPDLTELI   93 (162)
T ss_dssp             EECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECCCCCCSSCCEEECCSSC-CCEECSCH--------HHHCTTCCEEE
T ss_pred             EECCCCCCCccCccccccccCCEEECCCCCCCccCCcccCcchhhhhccccc-ccCCCccc--------cccccccccce
Confidence            45555556666553 3467777777777667666556667777777777774 55443210        13467788888


Q ss_pred             ccCcccccccCC--CCcCCCCccEEeEeccCCCCccC
Q 031454           82 LYGLEKLRSIYP--RALPFPHLKELKVDLCPELKKLP  116 (159)
Q Consensus        82 l~~~~~L~~i~~--~~~~~psLe~L~i~~Cp~L~~lP  116 (159)
                      +.++. ++.+..  ....+++|+.|.+.+|| +..+|
T Consensus        94 L~~N~-i~~~~~l~~l~~l~~L~~L~l~~N~-i~~~~  128 (162)
T d1a9na_          94 LTNNS-LVELGDLDPLASLKSLTYLCILRNP-VTNKK  128 (162)
T ss_dssp             CCSCC-CCCGGGGGGGGGCTTCCEEECCSSG-GGGST
T ss_pred             ecccc-ccccccccccccccccchhhcCCCc-ccccc
Confidence            77652 333322  12357788888888875 45554
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure