Citrus Sinensis ID: 031461
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| 359481570 | 523 | PREDICTED: LOW QUALITY PROTEIN: 70 kDa p | 1.0 | 0.304 | 0.709 | 3e-61 | |
| 255570494 | 523 | peptidylprolyl isomerase, putative [Rici | 1.0 | 0.304 | 0.723 | 3e-61 | |
| 356503354 | 538 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.993 | 0.293 | 0.727 | 9e-59 | |
| 356570407 | 533 | PREDICTED: LOW QUALITY PROTEIN: 70 kDa p | 0.981 | 0.292 | 0.614 | 3e-49 | |
| 355329948 | 573 | FK506-binding protein [Nicotiana tabacum | 0.993 | 0.275 | 0.607 | 4e-48 | |
| 115457870 | 585 | Os04g0352400 [Oryza sativa Japonica Grou | 0.981 | 0.266 | 0.602 | 9e-47 | |
| 224147353 | 548 | predicted protein [Populus trichocarpa] | 0.798 | 0.231 | 0.623 | 1e-46 | |
| 359497408 | 342 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.993 | 0.461 | 0.588 | 2e-46 | |
| 224065421 | 575 | predicted protein [Populus trichocarpa] | 0.993 | 0.274 | 0.588 | 2e-46 | |
| 359497288 | 571 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.993 | 0.276 | 0.588 | 2e-46 |
| >gi|359481570|ref|XP_003632641.1| PREDICTED: LOW QUALITY PROTEIN: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 239 bits (610), Expect = 3e-61, Method: Compositional matrix adjust.
Identities = 117/165 (70%), Positives = 138/165 (83%), Gaps = 6/165 (3%)
Query: 1 MDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEK------AAKIIEFHHSFTDDEKHQA 54
M+ HEK+EACERKKHDGN+LF+AGK+W ASKKYEK A K IEF HSFTD+EK QA
Sbjct: 359 MENHEKLEACERKKHDGNMLFKAGKFWHASKKYEKEIYLEXAEKYIEFDHSFTDEEKVQA 418
Query: 55 NGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEA 114
N LR+SC LNNAACKLKL +Y E S CTKVLEL+P N+KALYRRSQ++L+ SELEKAEA
Sbjct: 419 NALRISCNLNNAACKLKLGEYLEASKQCTKVLELDPSNIKALYRRSQSYLRISELEKAEA 478
Query: 115 DIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG 159
DI+RALTIDP+NR VKLVY EL+ KQ+EY ++Q +IF TMLS+MG
Sbjct: 479 DIRRALTIDPSNRDVKLVYKELQVKQKEYIRHQTQIFSTMLSRMG 523
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255570494|ref|XP_002526205.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223534483|gb|EEF36184.1| peptidylprolyl isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356503354|ref|XP_003520475.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356570407|ref|XP_003553380.1| PREDICTED: LOW QUALITY PROTEIN: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|355329948|dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|115457870|ref|NP_001052535.1| Os04g0352400 [Oryza sativa Japonica Group] gi|66153725|gb|AAD29708.2|AF140495_1 FK506-binding protein [Oryza sativa Japonica Group] gi|38347494|emb|CAE05842.2| OSJNBa0091C07.4 [Oryza sativa Japonica Group] gi|113564106|dbj|BAF14449.1| Os04g0352400 [Oryza sativa Japonica Group] gi|125589994|gb|EAZ30344.1| hypothetical protein OsJ_14391 [Oryza sativa Japonica Group] gi|215704766|dbj|BAG94794.1| unnamed protein product [Oryza sativa Japonica Group] gi|218194645|gb|EEC77072.1| hypothetical protein OsI_15470 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|224147353|ref|XP_002336458.1| predicted protein [Populus trichocarpa] gi|222835069|gb|EEE73518.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359497408|ref|XP_002268161.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like, partial [Vitis vinifera] gi|296090691|emb|CBI41091.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224065421|ref|XP_002301809.1| predicted protein [Populus trichocarpa] gi|222843535|gb|EEE81082.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359497288|ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera] gi|296085741|emb|CBI29552.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| UNIPROTKB|Q9XFE4 | 585 | OSJNBa0091C07.4 "OSJNBa0091C07 | 0.981 | 0.266 | 0.602 | 8.8e-47 | |
| UNIPROTKB|Q7F1F2 | 580 | OJ1191_A10.119 "cDNA clone:J03 | 0.993 | 0.272 | 0.575 | 4.4e-45 | |
| TAIR|locus:2090265 | 562 | ROF1 "AT3G25230" [Arabidopsis | 0.993 | 0.281 | 0.563 | 9.1e-45 | |
| TAIR|locus:2152561 | 578 | ROF2 "AT5G48570" [Arabidopsis | 0.993 | 0.273 | 0.537 | 2.2e-43 | |
| UNIPROTKB|Q6K5Q1 | 682 | P0579G08.8 "Putative peptidylp | 0.968 | 0.225 | 0.519 | 3.6e-39 | |
| TAIR|locus:2037650 | 164 | TPR6 "AT1G58450" [Arabidopsis | 0.987 | 0.957 | 0.481 | 9.5e-34 | |
| UNIPROTKB|A8J0I6 | 569 | FKB62 "Peptidyl-prolyl cis-tra | 0.981 | 0.274 | 0.365 | 7e-24 | |
| UNIPROTKB|F1NIM4 | 442 | FKBP4 "Uncharacterized protein | 0.993 | 0.357 | 0.341 | 2.4e-23 | |
| UNIPROTKB|F1NP08 | 464 | FKBP4 "Uncharacterized protein | 0.993 | 0.340 | 0.341 | 3.2e-23 | |
| UNIPROTKB|Q02790 | 459 | FKBP4 "Peptidyl-prolyl cis-tra | 0.993 | 0.344 | 0.335 | 1.8e-22 |
| UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 490 (177.5 bits), Expect = 8.8e-47, P = 8.8e-47
Identities = 94/156 (60%), Positives = 121/156 (77%)
Query: 2 DTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSC 61
D EKIEA +KK +GN+ F+ GKY +ASK+YEKAAK IE+ SFTDDEK Q+ L++SC
Sbjct: 403 DNAEKIEAAAKKKDEGNVWFKMGKYAKASKRYEKAAKYIEYDSSFTDDEKKQSKALKVSC 462
Query: 62 YLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALT 121
LNNAACKLKL++Y E LCTKVLELE NVKALYRR+QA+++ ++LE AE D+K+AL
Sbjct: 463 KLNNAACKLKLKEYREAEKLCTKVLELESTNVKALYRRTQAYIELADLELAELDVKKALE 522
Query: 122 IDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSK 157
IDP+NR VK+VY LK+K +EY K A+ +G M +K
Sbjct: 523 IDPDNRDVKMVYKTLKEKIKEYNKRDAKFYGNMFAK 558
|
|
| UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037650 TPR6 "AT1G58450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8J0I6 FKB62 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NP08 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q02790 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 7e-10 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 2e-06 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 3e-05 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 7e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 7e-04 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 0.001 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 0.002 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 0.003 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 52.8 bits (127), Expect = 7e-10
Identities = 36/109 (33%), Positives = 49/109 (44%), Gaps = 15/109 (13%)
Query: 17 GNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYS 76
GNL ++ G Y A + YEKA ++ + Y N AA KL Y
Sbjct: 7 GNLYYKLGDYDEALEYYEKALELDPDNAD---------------AYYNLAAAYYKLGKYE 51
Query: 77 ETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPN 125
E K LEL+P N KA Y A+ K + E+A ++AL +DPN
Sbjct: 52 EALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100
|
Length = 100 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.97 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.92 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 99.91 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.86 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.8 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.79 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.79 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.78 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.76 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.74 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.72 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.71 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.69 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 99.67 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.64 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.64 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.62 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.61 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.6 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.6 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.58 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.54 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.54 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.54 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 99.53 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 99.53 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.51 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.51 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 99.5 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.49 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.49 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.49 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.49 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.48 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.48 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.48 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.48 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.48 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.47 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.47 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.46 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.46 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.45 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.45 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.44 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.44 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.44 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.44 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.43 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 99.43 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.42 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.42 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.42 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.41 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 99.4 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.4 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.39 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.39 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.38 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.38 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 99.38 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.37 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.36 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.35 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.35 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 99.35 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 99.35 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.34 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 99.34 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 99.32 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.31 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 99.31 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.3 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.29 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.29 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.27 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.24 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 99.24 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.23 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 99.22 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 99.22 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.22 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.21 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 99.2 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.2 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 99.2 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.18 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 99.16 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.16 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 99.14 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 99.13 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 99.13 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 99.12 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 99.12 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.12 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 99.12 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 99.11 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.11 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 99.1 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 99.07 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 99.07 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.07 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.07 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.06 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.06 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.05 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 99.05 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.03 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.03 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.03 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.01 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.98 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.96 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.96 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.96 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.95 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.94 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.92 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.9 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.9 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.89 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.88 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.88 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.88 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.88 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.88 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.88 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.88 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.87 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 98.86 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.85 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.85 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.84 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.82 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.82 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.82 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 98.81 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.81 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 98.78 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.76 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.75 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.75 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.75 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.74 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.73 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.72 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.71 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.7 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.7 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.7 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.69 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.69 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 98.68 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.66 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.65 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.64 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.62 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.62 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.61 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.59 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 98.58 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.57 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.55 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.54 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.54 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.52 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.52 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.51 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.51 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.47 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 98.47 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.45 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.44 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.44 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 98.42 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.42 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 98.42 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.35 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.33 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.33 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.26 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 98.24 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.23 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 98.23 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 98.22 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 98.2 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 98.12 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 98.12 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.11 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 98.1 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 98.09 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 98.05 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 98.03 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 98.03 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 98.02 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 98.01 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 98.01 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 98.0 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.99 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 97.98 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.97 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.96 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.94 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.93 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 97.92 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.9 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.9 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.9 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 97.89 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 97.89 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.88 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.87 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.85 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.84 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 97.81 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.8 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.78 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.74 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.74 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.74 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.69 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.68 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.67 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.67 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.66 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.65 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.65 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.64 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.63 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.62 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 97.61 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.6 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.59 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.59 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.57 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.57 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 97.57 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.55 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 97.54 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 97.53 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 97.5 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.48 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.48 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.47 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.46 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 97.45 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 97.4 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 97.39 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.38 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.37 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 97.37 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.32 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.28 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 97.28 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.22 | |
| PF10952 | 140 | DUF2753: Protein of unknown function (DUF2753); In | 97.21 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 97.18 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.13 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.13 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 97.07 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 97.04 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 97.01 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.99 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.95 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 96.94 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.92 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 96.89 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 96.87 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.87 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.84 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.79 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 96.77 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.73 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 96.71 | |
| PF06957 | 422 | COPI_C: Coatomer (COPI) alpha subunit C-terminus; | 96.68 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 96.65 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 96.65 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.59 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 96.49 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.45 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.44 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 96.36 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 96.34 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 96.23 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 96.23 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 96.21 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 96.11 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 96.07 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 96.06 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 95.98 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 95.9 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 95.89 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 95.73 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 95.71 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 95.63 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 95.61 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 95.52 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 95.52 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 95.48 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 95.39 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 95.33 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 95.31 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 95.31 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 95.21 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 95.2 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 94.99 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 94.87 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 94.86 | |
| PHA02537 | 230 | M terminase endonuclease subunit; Provisional | 94.72 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 94.7 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 94.34 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 94.31 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 94.31 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 94.3 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 94.29 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 94.26 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 94.24 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 94.14 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 94.06 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 93.99 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 93.81 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 93.75 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 93.73 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 93.67 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 93.58 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 93.55 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 93.54 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 93.47 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 93.15 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 93.14 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 93.03 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 92.81 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 92.59 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 92.57 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 92.4 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 92.28 | |
| PF09670 | 379 | Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 | 92.02 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 92.02 | |
| cd02680 | 75 | MIT_calpain7_2 MIT: domain contained within Microt | 91.95 | |
| cd02684 | 75 | MIT_2 MIT: domain contained within Microtubule Int | 91.93 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 91.79 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 91.76 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 91.47 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 91.41 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 91.39 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 91.38 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 91.36 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 91.25 | |
| cd02678 | 75 | MIT_VPS4 MIT: domain contained within Microtubule | 91.21 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 91.14 | |
| cd02679 | 79 | MIT_spastin MIT: domain contained within Microtubu | 90.94 | |
| KOG3783 | 546 | consensus Uncharacterized conserved protein [Funct | 90.92 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 90.91 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 90.82 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 90.56 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 90.09 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 89.93 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 89.68 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 89.67 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 89.62 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 89.51 | |
| smart00745 | 77 | MIT Microtubule Interacting and Trafficking molecu | 89.43 | |
| cd02656 | 75 | MIT MIT: domain contained within Microtubule Inter | 89.37 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 89.08 | |
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 89.04 | |
| COG4941 | 415 | Predicted RNA polymerase sigma factor containing a | 89.02 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 88.96 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 88.92 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 88.82 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 88.75 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 88.22 | |
| cd02677 | 75 | MIT_SNX15 MIT: domain contained within Microtubule | 88.16 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 87.9 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 87.77 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 87.47 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 87.21 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 87.03 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 87.01 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 86.99 | |
| PF08311 | 126 | Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro | 86.46 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 86.41 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 86.26 | |
| PF15469 | 182 | Sec5: Exocyst complex component Sec5 | 86.23 | |
| PF12739 | 414 | TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex | 86.19 | |
| PF12854 | 34 | PPR_1: PPR repeat | 85.4 | |
| KOG1463 | 411 | consensus 26S proteasome regulatory complex, subun | 85.28 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 85.25 | |
| PF02064 | 121 | MAS20: MAS20 protein import receptor; InterPro: IP | 84.49 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 84.38 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 84.01 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 83.92 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 83.86 | |
| PF05053 | 618 | Menin: Menin; InterPro: IPR007747 MEN1, the gene r | 83.67 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 82.88 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 82.36 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 82.28 | |
| PF07219 | 108 | HemY_N: HemY protein N-terminus; InterPro: IPR0108 | 81.71 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 81.2 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 80.99 | |
| KOG1497 | 399 | consensus COP9 signalosome, subunit CSN4 [Posttran | 80.32 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 80.29 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 80.03 |
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.1e-28 Score=176.34 Aligned_cols=157 Identities=43% Similarity=0.771 Sum_probs=152.2
Q ss_pred ChHHHHHHHHHHHHhhhHHHHcccHHHHHHHHHHHHHHhcccCCCChHHHHHHHHHHHHHHhhHHHHHhhhhCHHHHHHH
Q 031461 2 DTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSL 81 (159)
Q Consensus 2 s~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~ 81 (159)
..++++..+...++.|+.+|+.|+|..|+..|.+|+...+.....++++......++..+++|+|.|+.+++.|.+|+..
T Consensus 200 ~~~e~l~~A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~ 279 (397)
T KOG0543|consen 200 FAEERLEAADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIES 279 (397)
T ss_pred chHHHHHHHHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHH
Confidence 45579999999999999999999999999999999999998888888999999999999999999999999999999999
Q ss_pred HHHHhhcCCccHHHHHHHHHHHHhhCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Q 031461 82 CTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKM 158 (159)
Q Consensus 82 ~~~al~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 158 (159)
|+++|.++|.|.+++|++|.++..+|+|+.|+.+|++++.++|+|..+...+..|..+++++.+.+++.|++||..+
T Consensus 280 c~kvLe~~~~N~KALyRrG~A~l~~~e~~~A~~df~ka~k~~P~Nka~~~el~~l~~k~~~~~~kekk~y~~mF~k~ 356 (397)
T KOG0543|consen 280 CNKVLELDPNNVKALYRRGQALLALGEYDLARDDFQKALKLEPSNKAARAELIKLKQKIREYEEKEKKMYANMFAKL 356 (397)
T ss_pred HHHHHhcCCCchhHHHHHHHHHHhhccHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999875
|
|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PHA02537 M terminase endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG3783 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >smart00745 MIT Microtubule Interacting and Trafficking molecule domain | Back alignment and domain information |
|---|
| >cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF15469 Sec5: Exocyst complex component Sec5 | Back alignment and domain information |
|---|
| >PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 159 | ||||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 4e-22 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 5e-21 | ||
| 1p5q_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Lengt | 1e-20 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 2e-20 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 1e-16 | ||
| 2if4_A | 338 | Crystal Structure Of A Multi-Domain Immunophilin Fr | 4e-14 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 6e-12 | ||
| 2fbn_A | 198 | Plasmodium Falciparum Putative Fk506-Binding Protei | 6e-11 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 2e-10 | ||
| 4apo_A | 165 | Aip Tpr Domain In Complex With Human Tomm20 Peptide | 2e-08 | ||
| 4aif_A | 144 | Aip Tpr Domain In Complex With Human Hsp90 Peptide | 5e-08 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 1e-05 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 2e-05 | ||
| 3rkv_A | 162 | C-Terminal Domain Of Protein C56c10.10, A Putative | 5e-05 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 1e-04 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 2e-04 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 3e-04 |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
|
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 | Back alignment and structure |
| >pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 1e-52 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 3e-49 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 1e-45 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 6e-45 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 2e-43 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 3e-38 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 1e-30 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 7e-22 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 3e-20 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 4e-20 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 4e-20 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 4e-20 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 4e-20 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 3e-19 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 4e-18 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 1e-17 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 1e-17 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 8e-16 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-11 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-15 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 8e-14 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 8e-11 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 6e-13 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 8e-13 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 4e-05 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-12 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 6e-10 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 7e-07 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 3e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-04 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 4e-10 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 2e-04 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 5e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-09 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-06 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-09 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 5e-08 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 6e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-09 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-06 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-08 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-08 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-04 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 3e-08 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 7e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 9e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-06 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-06 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 4e-07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-06 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 8e-07 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 9e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-04 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-06 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 9e-05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 5e-04 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 3e-06 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 3e-04 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 4e-06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 6e-06 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 7e-06 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 7e-06 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 7e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-04 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 7e-06 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 7e-04 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-04 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 7e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 5e-04 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 3e-05 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 3e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 1e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 1e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 4e-04 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 1e-04 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 1e-04 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 2e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 5e-04 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 6e-04 |
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
Score = 172 bits (436), Expect = 1e-52
Identities = 51/159 (32%), Positives = 81/159 (50%)
Query: 1 MDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLS 60
MDT EK+E K G + F+ GKY +A +Y K +E + ++ E + L+
Sbjct: 259 MDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLA 318
Query: 61 CYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRAL 120
+LN A C LKL +Y++ C K L L+ N K LYRR +A L +E E A+ D ++ L
Sbjct: 319 AFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVL 378
Query: 121 TIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG 159
++P N+ +L + K +E+ + I+ M K
Sbjct: 379 EVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFA 417
|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.95 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.93 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.93 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.93 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.92 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.92 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.89 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.87 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.87 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.87 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.85 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.85 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.85 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.84 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.84 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.82 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.82 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.81 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.8 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.8 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.8 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.8 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.78 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.78 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.78 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.78 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.77 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.77 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.77 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.76 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.76 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.76 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.74 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.73 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.73 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.72 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.72 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.71 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.71 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.71 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.71 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.71 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.7 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.7 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.69 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.69 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.69 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.68 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.67 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.67 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.67 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.67 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.66 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.66 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.66 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.65 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.65 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.65 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.64 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.64 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.64 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.63 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.63 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.63 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.63 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.63 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.63 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.63 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.63 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.62 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.62 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.62 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.62 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.62 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.62 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.61 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.61 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.61 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.61 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.61 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.61 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.6 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.6 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.6 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.6 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.59 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.59 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.59 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.59 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.59 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.59 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.58 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.58 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.58 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.58 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.57 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.57 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.57 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.55 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.55 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.55 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.54 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.53 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.53 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.53 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.52 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.52 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.51 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.51 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.51 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.51 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.5 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.49 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.49 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.49 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.49 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.48 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 99.47 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.47 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.47 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.47 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.46 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.46 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.46 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.46 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.45 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.45 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.45 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.44 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.44 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.44 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.43 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.43 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.42 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.42 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.41 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.41 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.41 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.41 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.4 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.4 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.39 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.39 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.39 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.38 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.38 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.38 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.37 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.36 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.36 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.36 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.35 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.35 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.34 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.33 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.33 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 99.32 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.32 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.31 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 99.3 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.3 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.3 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.3 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.29 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.27 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.26 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 99.25 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.24 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 99.23 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.23 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.22 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.22 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.22 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.21 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 99.19 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 99.18 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.18 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 99.17 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.16 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.15 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.15 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.14 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.13 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.13 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.12 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.1 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.1 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.09 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.08 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 99.05 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.03 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.02 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 99.0 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.97 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.94 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.93 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.93 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.82 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.81 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.79 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.78 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.77 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.76 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 98.76 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.74 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.74 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.72 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.72 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 98.68 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.68 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.63 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.62 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.5 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.47 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 98.44 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.36 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.31 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.18 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 98.1 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.09 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 98.05 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.92 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.9 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.84 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.82 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 97.78 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.77 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 97.77 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 97.54 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 97.38 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 97.21 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 97.12 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 96.9 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 96.82 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 96.76 | |
| 3mv2_A | 325 | Coatomer subunit alpha; vesicular membrane coat CO | 96.73 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 96.72 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 96.66 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 96.51 | |
| 3mkr_B | 320 | Coatomer subunit alpha; tetratricopeptide repeats | 96.43 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 96.35 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 96.03 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 95.78 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.77 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 95.43 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 95.17 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 95.09 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 94.32 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 94.23 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 93.94 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 93.94 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 93.91 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 93.86 | |
| 2v6x_A | 85 | Vacuolar protein sorting-associated protein 4; pro | 93.73 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 93.34 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 93.22 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 93.09 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 92.65 | |
| 3t5v_B | 455 | Nuclear mRNA export protein THP1; PCI, mRNA nuclea | 92.14 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 91.68 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 91.31 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 91.07 | |
| 3re2_A | 472 | Predicted protein; menin, multiple endocrine neopl | 90.08 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 89.92 | |
| 2crb_A | 97 | Nuclear receptor binding factor 2; NRBF-2, MIT dom | 89.73 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 89.43 | |
| 3u84_A | 550 | Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik | 88.55 | |
| 2dl1_A | 116 | Spartin; SPG20, MIT, structural genomics, NPPSFA, | 87.74 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 87.6 | |
| 2rkl_A | 53 | Vacuolar protein sorting-associated protein VTA1; | 87.35 | |
| 1qsa_A | 618 | Protein (soluble lytic transglycosylase SLT70); al | 87.25 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 87.0 | |
| 1om2_A | 95 | Protein (mitochondrial import receptor subunit TOM | 85.9 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 85.89 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 85.59 | |
| 1om2_A | 95 | Protein (mitochondrial import receptor subunit TOM | 85.19 | |
| 2cfu_A | 658 | SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 | 84.68 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 84.24 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 83.77 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 83.13 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 82.9 | |
| 2dl1_A | 116 | Spartin; SPG20, MIT, structural genomics, NPPSFA, | 82.72 | |
| 4gq4_A | 489 | Menin; tumor suppressor, nucleus, transcription-tr | 81.63 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 80.97 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 80.74 | |
| 2yin_A | 436 | DOCK2, dedicator of cytokinesis protein 2; apoptos | 80.69 | |
| 1wy6_A | 172 | Hypothetical protein ST1625; helical repeat protei | 80.66 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 80.62 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 80.6 |
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
Probab=99.95 E-value=3.6e-27 Score=153.65 Aligned_cols=154 Identities=25% Similarity=0.349 Sum_probs=131.3
Q ss_pred hHHHHHHHHHHHHhhhHHHHcccHHHHHHHHHHHHHHhcccC---CCChHHHHHHHHHHHHHHhhHHHHHhhhhCHHHHH
Q 031461 3 THEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHH---SFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETS 79 (159)
Q Consensus 3 ~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~al~~~~~~~---~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~ 79 (159)
+++++..+..++..|+.++..|+|++|+..|.+++.+.+..+ ..+++.+....+....++.++|.|+..+|+|++|+
T Consensus 4 ~~e~~~~a~~~~~~G~~~~~~~~~~~A~~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~~~~~~~~~~A~ 83 (162)
T 3rkv_A 4 EDDKLKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDRKNIPLYANMSQCYLNIGDLHEAE 83 (162)
T ss_dssp ----CHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHTSCTTSHHHHHHHHTHHHHHHHHHHHHHHHTCHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHH
Confidence 567888999999999999999999999999999999865422 22234556667788889999999999999999999
Q ss_pred HHHHHHhhcCCccHHHHHHHHHHHHhhCCHHHHHHHHHHHHhcCCCcH-HHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 031461 80 SLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNR-VVKLVYMELKDKQREYAKYQAEIFGTMLS 156 (159)
Q Consensus 80 ~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 156 (159)
.+|++++.++|+++.+++++|.++..+|++++|+.+|++++.++|+++ .+...+..+...+.+..+.+++.|++||+
T Consensus 84 ~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~~l~~~~~~~~~~~~~~k~~~~~~f~ 161 (162)
T 3rkv_A 84 ETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRVTYSKMFQ 161 (162)
T ss_dssp HHHHHHHHHSTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHTTSSCC-------
T ss_pred HHHHHHHhcCCcchHHHHHHHHHHHHHhcHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 999999999999999999999999999999999999999999999998 88999999999999999999999999996
|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* | Back alignment and structure |
|---|
| >2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >2rkl_A Vacuolar protein sorting-associated protein VTA1; dimerization motif, cytoplasm, endosome, lipid transport, membrane, protein transport; 1.50A {Saccharomyces cerevisiae} PDB: 3mhv_A | Back alignment and structure |
|---|
| >1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 | Back alignment and structure |
|---|
| >1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 | Back alignment and structure |
|---|
| >2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* | Back alignment and structure |
|---|
| >2yin_A DOCK2, dedicator of cytokinesis protein 2; apoptosis, DOCK, DOCK guanine nucleotide exchange factors; 2.70A {Homo sapiens} PDB: 3b13_A | Back alignment and structure |
|---|
| >1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 159 | ||||
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 5e-18 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 1e-15 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 6e-11 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 2e-10 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-07 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.001 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 5e-05 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 6e-05 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 7e-05 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 1e-04 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 0.001 |
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: FKBP51, C-terminal domain species: Monkey (Saimiri boliviensis) [TaxId: 27679]
Score = 74.2 bits (181), Expect = 5e-18
Identities = 50/158 (31%), Positives = 80/158 (50%)
Query: 1 MDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLS 60
MDT EK+E K G + F+ GKY +A +Y K +E + ++ E + L+
Sbjct: 6 MDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLA 65
Query: 61 CYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRAL 120
+LN A C LKL +Y++ C K L L+ N K LYRR +A L +E E A+ D ++ L
Sbjct: 66 AFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVL 125
Query: 121 TIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKM 158
++P N+ +L + K +E+ + + M K
Sbjct: 126 EVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKF 163
|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 100.0 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 100.0 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.96 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.93 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.93 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.88 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.82 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.8 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.76 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.75 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.74 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.73 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.69 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.69 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.68 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.65 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.65 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.65 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.64 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.64 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.6 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.6 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.59 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.56 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 99.56 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.55 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.4 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.4 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.38 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.36 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.36 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.28 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.23 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.19 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 99.17 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.17 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.11 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.06 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.99 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.95 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.93 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.93 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.89 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.88 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.83 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.8 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.66 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.25 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.96 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.83 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.6 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 95.04 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 94.48 | |
| d1wr0a1 | 77 | Vacuolar sorting protein 4b (VPS4B, SKD1 protein) | 91.8 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 91.55 | |
| d2cfua2 | 505 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 88.96 | |
| d1qsaa1 | 450 | 70 KDa soluble lytic transglycosylase (SLT70), sup | 88.07 | |
| d2o02a1 | 230 | zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | 86.23 | |
| d2o8pa1 | 220 | 14-3-3 domain containing protein cgd7_2470 {Crypto | 85.14 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 83.86 | |
| d1om2a_ | 95 | Mitochondrial import receptor subunit Tom20 {Rat ( | 83.01 | |
| d1om2a_ | 95 | Mitochondrial import receptor subunit Tom20 {Rat ( | 82.88 | |
| d1o9da_ | 236 | 14-3-3-like protein C {Common tobacco (Nicotiana t | 81.4 |
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: FKBP52 (FKBP4), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=3e-31 Score=173.39 Aligned_cols=158 Identities=34% Similarity=0.578 Sum_probs=152.6
Q ss_pred CChHHHHHHHHHHHHhhhHHHHcccHHHHHHHHHHHHHHhcccCCCChHHHHHHHHHHHHHHhhHHHHHhhhhCHHHHHH
Q 031461 1 MDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSS 80 (159)
Q Consensus 1 ~s~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~ 80 (159)
||+++++..+..+++.|+.+|..|+|++|+..|.++|.+.+..+............+...++.++|.||.++|+|++|+.
T Consensus 4 ~~~~ek~~~a~~l~~~G~~~~~~~~~~~Ai~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~y~k~~~~~~A~~ 83 (170)
T d1p5qa1 4 MNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIE 83 (170)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHH
T ss_pred CCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhhhccccchHHHhhhchhHHHHHHHHHHHHHhhhhcccccc
Confidence 79999999999999999999999999999999999999999888888888888889999999999999999999999999
Q ss_pred HHHHHhhcCCccHHHHHHHHHHHHhhCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Q 031461 81 LCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKM 158 (159)
Q Consensus 81 ~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 158 (159)
+++++|.++|+++.+++++|.++..+|++++|+.+|++++.++|+|+.+...+..+...+.+..+.++..|.++|+.+
T Consensus 84 ~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~P~n~~~~~~l~~~~~~~~~~~~~e~~~~~~~f~~~ 161 (170)
T d1p5qa1 84 SCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERL 161 (170)
T ss_dssp HHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hhhhhhhccccchhhhHHHHHHHHHhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999875
|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|