Citrus Sinensis ID: 031467
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| 255548678 | 144 | conserved hypothetical protein [Ricinus | 0.779 | 0.861 | 0.823 | 2e-53 | |
| 224089396 | 139 | predicted protein [Populus trichocarpa] | 0.842 | 0.964 | 0.757 | 4e-52 | |
| 225430533 | 146 | PREDICTED: uncharacterized protein LOC10 | 0.647 | 0.705 | 0.864 | 3e-48 | |
| 296082159 | 109 | unnamed protein product [Vitis vinifera] | 0.654 | 0.954 | 0.855 | 3e-48 | |
| 449455499 | 153 | PREDICTED: uncharacterized protein LOC10 | 0.924 | 0.960 | 0.666 | 2e-47 | |
| 224141989 | 100 | predicted protein [Populus trichocarpa] | 0.628 | 1.0 | 0.86 | 2e-46 | |
| 18400663 | 144 | DnaJ/Hsp40 cysteine-rich domain-containi | 0.874 | 0.965 | 0.621 | 7e-44 | |
| 4337001 | 154 | Tsi1-interacting protein TSIP1 [Nicotian | 0.886 | 0.915 | 0.577 | 2e-43 | |
| 297825509 | 145 | hypothetical protein ARALYDRAFT_481346 [ | 0.729 | 0.8 | 0.646 | 2e-43 | |
| 356507180 | 139 | PREDICTED: uncharacterized protein LOC10 | 0.767 | 0.877 | 0.653 | 4e-41 |
| >gi|255548678|ref|XP_002515395.1| conserved hypothetical protein [Ricinus communis] gi|223545339|gb|EEF46844.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 213 bits (543), Expect = 2e-53, Method: Compositional matrix adjust.
Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 6/130 (4%)
Query: 32 TRKSP--MRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPV 89
T ++P M VVPRGT+ R VC V RASVVDSYESSSNF+KRMEQAWLISQQPRPV
Sbjct: 19 TNRAPINMGVVPRGTTTAFAR--VCRV--RASVVDSYESSSNFIKRMEQAWLISQQPRPV 74
Query: 90 SCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRA 149
C+SCNSNGH+DCKWCAGTGFFILGDN+LCQVPSRNTTCVICAGKGS+CCSDCKGTGFRA
Sbjct: 75 GCTSCNSNGHVDCKWCAGTGFFILGDNILCQVPSRNTTCVICAGKGSMCCSDCKGTGFRA 134
Query: 150 KWLGEPPISK 159
KWL EPPISK
Sbjct: 135 KWLEEPPISK 144
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224089396|ref|XP_002308715.1| predicted protein [Populus trichocarpa] gi|222854691|gb|EEE92238.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225430533|ref|XP_002285576.1| PREDICTED: uncharacterized protein LOC100242360 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296082159|emb|CBI21164.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455499|ref|XP_004145490.1| PREDICTED: uncharacterized protein LOC101210374 [Cucumis sativus] gi|449485210|ref|XP_004157101.1| PREDICTED: uncharacterized LOC101210374 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224141989|ref|XP_002324343.1| predicted protein [Populus trichocarpa] gi|222865777|gb|EEF02908.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18400663|ref|NP_565578.1| DnaJ/Hsp40 cysteine-rich domain-containing protein [Arabidopsis thaliana] gi|15294198|gb|AAK95276.1|AF410290_1 At2g24860/F27C12.22 [Arabidopsis thaliana] gi|20197874|gb|AAD23026.2| expressed protein [Arabidopsis thaliana] gi|20453299|gb|AAM19888.1| At2g24860/F27C12.22 [Arabidopsis thaliana] gi|21618127|gb|AAM67177.1| Tsi1-interacting protein TSIP1 [Arabidopsis thaliana] gi|51970710|dbj|BAD44047.1| unknown protein [Arabidopsis thaliana] gi|330252543|gb|AEC07637.1| DnaJ/Hsp40 cysteine-rich domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|4337001|gb|AAD18030.1| Tsi1-interacting protein TSIP1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|297825509|ref|XP_002880637.1| hypothetical protein ARALYDRAFT_481346 [Arabidopsis lyrata subsp. lyrata] gi|297326476|gb|EFH56896.1| hypothetical protein ARALYDRAFT_481346 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356507180|ref|XP_003522348.1| PREDICTED: uncharacterized protein LOC100810900 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| TAIR|locus:2047426 | 144 | AT2G24860 [Arabidopsis thalian | 0.761 | 0.840 | 0.707 | 1.3e-45 | |
| TAIR|locus:2079132 | 136 | AT3G47650 [Arabidopsis thalian | 0.691 | 0.808 | 0.263 | 7.8e-07 | |
| TAIR|locus:2044812 | 186 | EDA3 "embryo sac development a | 0.811 | 0.693 | 0.268 | 0.00011 | |
| UNIPROTKB|G4N8Z4 | 59 | MGG_17224 "Uncharacterized pro | 0.301 | 0.813 | 0.368 | 0.00021 | |
| ZFIN|ZDB-GENE-070424-72 | 417 | zgc:162724 "zgc:162724" [Danio | 0.358 | 0.136 | 0.338 | 0.00047 | |
| TAIR|locus:2005585 | 154 | LQY1 "LOW QUANTUM YIELD OF PHO | 0.371 | 0.383 | 0.306 | 0.00062 | |
| TAIR|locus:2175966 | 154 | AT5G17840 [Arabidopsis thalian | 0.339 | 0.350 | 0.315 | 0.00062 | |
| TAIR|locus:2009482 | 110 | AT1G22630 [Arabidopsis thalian | 0.377 | 0.545 | 0.323 | 0.00097 |
| TAIR|locus:2047426 AT2G24860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 479 (173.7 bits), Expect = 1.3e-45, P = 1.3e-45
Identities = 87/123 (70%), Positives = 99/123 (80%)
Query: 35 SPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSC 94
SP R+ G + RR V+AS VDS ESSSNF KRM+QAW+ISQQP PV CSSC
Sbjct: 22 SP-RITKLGF-VPVVRRFPATTTVKASAVDSPESSSNFAKRMDQAWIISQQPSPVGCSSC 79
Query: 95 NSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGE 154
NS GH++CKWCAGTGFFILGDNMLCQVPSRNT+CVIC+G+GS CSDCKGTGFRAKWL +
Sbjct: 80 NSKGHVECKWCAGTGFFILGDNMLCQVPSRNTSCVICSGQGSASCSDCKGTGFRAKWLEK 139
Query: 155 PPI 157
PP+
Sbjct: 140 PPV 142
|
|
| TAIR|locus:2079132 AT3G47650 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044812 EDA3 "embryo sac development arrest 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N8Z4 MGG_17224 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070424-72 zgc:162724 "zgc:162724" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005585 LQY1 "LOW QUANTUM YIELD OF PHOTOSYSTEM II 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175966 AT5G17840 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009482 AT1G22630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00061977 | hypothetical protein (139 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-06 | |
| PLN03165 | 111 | PLN03165, PLN03165, chaperone protein dnaJ-related | 3e-04 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 6e-04 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 8e-04 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 9e-04 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 0.001 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 0.001 |
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
Score = 46.8 bits (112), Expect = 1e-06
Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 9/74 (12%)
Query: 86 PRPVSCSSCN------SNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVC- 138
PR SC +C+ C C GTG + TC C G+G +
Sbjct: 141 PRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRRQQGTPFGFFQQQQTCPTCGGEGKIIK 200
Query: 139 --CSDCKGTGFRAK 150
CS CKG G +
Sbjct: 201 EPCSTCKGKGRVKE 214
|
This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354 |
| >gnl|CDD|178709 PLN03165, PLN03165, chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 99.4 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.33 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 99.25 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 98.99 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 98.99 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 98.99 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 98.98 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 98.97 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 98.95 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 98.94 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 98.92 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 98.9 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 98.89 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 98.88 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 98.87 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 98.86 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 98.86 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 98.85 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 98.85 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 98.83 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 98.82 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 98.82 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 98.82 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 98.8 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 98.79 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 98.79 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 98.79 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 98.78 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 98.76 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 98.75 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 98.71 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 98.65 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 98.62 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.04 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 97.95 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 97.42 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 97.16 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 97.09 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 97.03 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 97.03 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 96.96 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 96.91 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 96.9 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 96.88 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 96.88 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 96.88 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 96.83 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 96.82 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.79 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 96.76 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 96.75 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 96.75 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 96.72 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 96.7 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 96.67 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 96.66 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 96.66 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 96.65 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 96.63 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 96.61 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 96.6 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 96.57 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 96.45 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 96.45 | |
| KOG2824 | 281 | consensus Glutaredoxin-related protein [Posttransl | 96.44 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 96.44 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 96.39 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 96.39 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 96.05 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 96.03 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 95.67 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 95.47 | |
| PF07092 | 238 | DUF1356: Protein of unknown function (DUF1356); In | 91.4 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 89.65 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 87.71 | |
| PF07092 | 238 | DUF1356: Protein of unknown function (DUF1356); In | 84.93 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 84.14 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 82.37 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 81.95 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 81.81 |
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
Probab=99.40 E-value=3.4e-13 Score=102.74 Aligned_cols=68 Identities=25% Similarity=0.735 Sum_probs=57.5
Q ss_pred CCCCccCCCCCCCCcccCCCCCcccEEeecccccccCCCCceEcCCCCccceeeCCCCCceeEEeeccCCC
Q 031467 85 QPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEP 155 (159)
Q Consensus 85 ~~r~~~C~~C~GsG~~~C~~C~GtG~i~~~~~~~~~~~~~~~tCp~C~G~G~i~C~~C~GtG~v~kwl~~~ 155 (159)
....+.|..|+|+|..+|+.|+|+|++..... ...+..++|+.|.|+|+..|+.|+|.|++.+||..-
T Consensus 38 ~~~~v~C~~C~GsG~~~C~~C~G~G~v~~~~~---g~~q~~~~C~~C~G~Gk~~C~~C~G~G~~~~~~~~~ 105 (111)
T PLN03165 38 RENTQPCFPCSGTGAQVCRFCVGSGNVTVELG---GGEKEVSKCINCDGAGSLTCTTCQGSGIQPRYLDRR 105 (111)
T ss_pred hccCCCCCCCCCCCCcCCCCCcCcCeEEEEeC---CcEEEEEECCCCCCcceeeCCCCCCCEEEeeeeccc
Confidence 34578899999999999999999999864321 122567899999999999999999999999999764
|
|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07092 DUF1356: Protein of unknown function (DUF1356); InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PF07092 DUF1356: Protein of unknown function (DUF1356); InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.24 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 99.24 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.04 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 98.12 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 97.83 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.61 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 97.35 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 97.3 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.07 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 96.79 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 87.29 |
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.24 E-value=6.9e-12 Score=90.91 Aligned_cols=60 Identities=30% Similarity=0.784 Sum_probs=50.4
Q ss_pred CCCccCCCCCCCCc------ccCCCCCcccEEeecccccccCCCCceEcCCCCcccee---eCCCCCceeEEe
Q 031467 86 PRPVSCSSCNSNGH------IDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSV---CCSDCKGTGFRA 149 (159)
Q Consensus 86 ~r~~~C~~C~GsG~------~~C~~C~GtG~i~~~~~~~~~~~~~~~tCp~C~G~G~i---~C~~C~GtG~v~ 149 (159)
++.+.|+.|+|+|+ .+|+.|+|+|++.....++ +.+++|+.|+|+|++ +|+.|+|.|++.
T Consensus 26 ~~~~~C~~C~G~G~~~g~~~~~C~~C~G~G~~~~~~G~~----~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~ 94 (104)
T 2ctt_A 26 NIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPF----VMRSTCRRCGGRGSIIISPCVVCRGAGQAK 94 (104)
T ss_dssp SCCEECSSSSSSSSCTTCCCEECSSSSSSCEEEEEETTE----EEEEECSSSSSSSEECSSCCSSSSSCSEEC
T ss_pred eeeeECCCCcCCccCCCCCCccCCCCCCCEEEEEEeCCE----EEEEECCcCCCcceECCCcCCCCCCeeEEE
Confidence 56789999999995 6899999999986543221 356899999999998 899999999986
|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 99.35 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.35 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 97.92 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.79 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 97.62 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 90.93 |
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Small proteins fold: DnaJ/Hsp40 cysteine-rich domain superfamily: DnaJ/Hsp40 cysteine-rich domain family: DnaJ/Hsp40 cysteine-rich domain domain: Cysteine-rich domain of the chaperone protein DnaJ species: Escherichia coli [TaxId: 562]
Probab=99.35 E-value=1.7e-13 Score=94.26 Aligned_cols=61 Identities=28% Similarity=0.765 Sum_probs=50.9
Q ss_pred CCCccCCCCCCCCc------ccCCCCCcccEEeecccccccCCCCceEcCCCCcccee---eCCCCCceeEEee
Q 031467 86 PRPVSCSSCNSNGH------IDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSV---CCSDCKGTGFRAK 150 (159)
Q Consensus 86 ~r~~~C~~C~GsG~------~~C~~C~GtG~i~~~~~~~~~~~~~~~tCp~C~G~G~i---~C~~C~GtG~v~k 150 (159)
++.+.|+.|+|+|+ .+|+.|+|+|++.....++ +..++|+.|+|+|++ +|+.|+|+|+|.+
T Consensus 9 ~~~~~C~~C~G~G~~~g~~~~~C~~C~G~G~v~~~~g~~----~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~k 78 (79)
T d1exka_ 9 PTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFF----AVQQTCPHCQGRGTLIKDPCNKCHGHGRVER 78 (79)
T ss_dssp CCEEECGGGTTTSBCSSSCCEECTTTTTSSEEEEEETTE----EEEEECTTTTTSSEECSSBCGGGTTSSEEEC
T ss_pred eeeccCCCCcCcccCCCccceeCCCccceeEEEEecccc----eeeEECcccCcceeECCCCCCCCCCceEeec
Confidence 46789999999995 5699999999986543322 456799999999998 9999999999975
|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|