Citrus Sinensis ID: 031467


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MMSSGSSSCCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEPPISK
cccccccccccccccccccccccccccHHHHcccccccccccccccccccccEEEccEEEEEccccccHHHHHHHHHHHHHHHccccccccccccccccEEcccccccEEEEEccccccccccccEEccccccccEEEccccccccEEEEccccccccc
ccccccccccccccEEEEEEcEcccccEEEEEcccccEEEccccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHccccccEEEcccccccEEEEccccccEEEEEccccccccccccccEEEEccccEEEccccccccHHHHHcccccccc
mmssgsssccscravDVVTKSIDKKMDFAlltrkspmrvvprgtsitstrrsvcgvGVRASVVDSYESSSNFVKRMEQAWLisqqprpvscsscnsnghidckwcagtgffilgdnmlcqvpsrnttcvicagkgsvccsdckgtgfrakwlgeppisk
mmssgsssccscrAVDVVTKSIDKKMdfalltrkspmrvvprgtsitstrrsvcgvgVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTgfrakwlgeppisk
MMssgsssccscRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEPPISK
********CCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWL*******
**********************************************************************************SQQPRPVSCSSCNSNGHIDCKWCAGTGFFILG*N******SRNTTCVICAGKGSVCCSDCKGTGFRAKW*GE*****
***********CRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLI************NSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEPPISK
******SSCCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEPP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSSGSSSCCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEPPISK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
255548678144 conserved hypothetical protein [Ricinus 0.779 0.861 0.823 2e-53
224089396139 predicted protein [Populus trichocarpa] 0.842 0.964 0.757 4e-52
225430533146 PREDICTED: uncharacterized protein LOC10 0.647 0.705 0.864 3e-48
296082159109 unnamed protein product [Vitis vinifera] 0.654 0.954 0.855 3e-48
449455499153 PREDICTED: uncharacterized protein LOC10 0.924 0.960 0.666 2e-47
224141989100 predicted protein [Populus trichocarpa] 0.628 1.0 0.86 2e-46
18400663144 DnaJ/Hsp40 cysteine-rich domain-containi 0.874 0.965 0.621 7e-44
4337001154 Tsi1-interacting protein TSIP1 [Nicotian 0.886 0.915 0.577 2e-43
297825509145 hypothetical protein ARALYDRAFT_481346 [ 0.729 0.8 0.646 2e-43
356507180139 PREDICTED: uncharacterized protein LOC10 0.767 0.877 0.653 4e-41
>gi|255548678|ref|XP_002515395.1| conserved hypothetical protein [Ricinus communis] gi|223545339|gb|EEF46844.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 6/130 (4%)

Query: 32  TRKSP--MRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPV 89
           T ++P  M VVPRGT+    R  VC V  RASVVDSYESSSNF+KRMEQAWLISQQPRPV
Sbjct: 19  TNRAPINMGVVPRGTTTAFAR--VCRV--RASVVDSYESSSNFIKRMEQAWLISQQPRPV 74

Query: 90  SCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRA 149
            C+SCNSNGH+DCKWCAGTGFFILGDN+LCQVPSRNTTCVICAGKGS+CCSDCKGTGFRA
Sbjct: 75  GCTSCNSNGHVDCKWCAGTGFFILGDNILCQVPSRNTTCVICAGKGSMCCSDCKGTGFRA 134

Query: 150 KWLGEPPISK 159
           KWL EPPISK
Sbjct: 135 KWLEEPPISK 144




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224089396|ref|XP_002308715.1| predicted protein [Populus trichocarpa] gi|222854691|gb|EEE92238.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225430533|ref|XP_002285576.1| PREDICTED: uncharacterized protein LOC100242360 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082159|emb|CBI21164.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455499|ref|XP_004145490.1| PREDICTED: uncharacterized protein LOC101210374 [Cucumis sativus] gi|449485210|ref|XP_004157101.1| PREDICTED: uncharacterized LOC101210374 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224141989|ref|XP_002324343.1| predicted protein [Populus trichocarpa] gi|222865777|gb|EEF02908.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18400663|ref|NP_565578.1| DnaJ/Hsp40 cysteine-rich domain-containing protein [Arabidopsis thaliana] gi|15294198|gb|AAK95276.1|AF410290_1 At2g24860/F27C12.22 [Arabidopsis thaliana] gi|20197874|gb|AAD23026.2| expressed protein [Arabidopsis thaliana] gi|20453299|gb|AAM19888.1| At2g24860/F27C12.22 [Arabidopsis thaliana] gi|21618127|gb|AAM67177.1| Tsi1-interacting protein TSIP1 [Arabidopsis thaliana] gi|51970710|dbj|BAD44047.1| unknown protein [Arabidopsis thaliana] gi|330252543|gb|AEC07637.1| DnaJ/Hsp40 cysteine-rich domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4337001|gb|AAD18030.1| Tsi1-interacting protein TSIP1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|297825509|ref|XP_002880637.1| hypothetical protein ARALYDRAFT_481346 [Arabidopsis lyrata subsp. lyrata] gi|297326476|gb|EFH56896.1| hypothetical protein ARALYDRAFT_481346 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356507180|ref|XP_003522348.1| PREDICTED: uncharacterized protein LOC100810900 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2047426144 AT2G24860 [Arabidopsis thalian 0.761 0.840 0.707 1.3e-45
TAIR|locus:2079132136 AT3G47650 [Arabidopsis thalian 0.691 0.808 0.263 7.8e-07
TAIR|locus:2044812186 EDA3 "embryo sac development a 0.811 0.693 0.268 0.00011
UNIPROTKB|G4N8Z459 MGG_17224 "Uncharacterized pro 0.301 0.813 0.368 0.00021
ZFIN|ZDB-GENE-070424-72 417 zgc:162724 "zgc:162724" [Danio 0.358 0.136 0.338 0.00047
TAIR|locus:2005585154 LQY1 "LOW QUANTUM YIELD OF PHO 0.371 0.383 0.306 0.00062
TAIR|locus:2175966154 AT5G17840 [Arabidopsis thalian 0.339 0.350 0.315 0.00062
TAIR|locus:2009482110 AT1G22630 [Arabidopsis thalian 0.377 0.545 0.323 0.00097
TAIR|locus:2047426 AT2G24860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 479 (173.7 bits), Expect = 1.3e-45, P = 1.3e-45
 Identities = 87/123 (70%), Positives = 99/123 (80%)

Query:    35 SPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSC 94
             SP R+   G  +   RR      V+AS VDS ESSSNF KRM+QAW+ISQQP PV CSSC
Sbjct:    22 SP-RITKLGF-VPVVRRFPATTTVKASAVDSPESSSNFAKRMDQAWIISQQPSPVGCSSC 79

Query:    95 NSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGE 154
             NS GH++CKWCAGTGFFILGDNMLCQVPSRNT+CVIC+G+GS  CSDCKGTGFRAKWL +
Sbjct:    80 NSKGHVECKWCAGTGFFILGDNMLCQVPSRNTSCVICSGQGSASCSDCKGTGFRAKWLEK 139

Query:   155 PPI 157
             PP+
Sbjct:   140 PPV 142




GO:0005576 "extracellular region" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2079132 AT3G47650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044812 EDA3 "embryo sac development arrest 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8Z4 MGG_17224 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-72 zgc:162724 "zgc:162724" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2005585 LQY1 "LOW QUANTUM YIELD OF PHOTOSYSTEM II 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175966 AT5G17840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009482 AT1G22630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00061977
hypothetical protein (139 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-06
PLN03165111 PLN03165, PLN03165, chaperone protein dnaJ-related 3e-04
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 6e-04
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 8e-04
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 9e-04
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 0.001
COG1107 715 COG1107, COG1107, Archaea-specific RecJ-like exonu 0.001
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
 Score = 46.8 bits (112), Expect = 1e-06
 Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 9/74 (12%)

Query: 86  PRPVSCSSCN------SNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVC- 138
           PR  SC +C+            C  C GTG              +  TC  C G+G +  
Sbjct: 141 PRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRRQQGTPFGFFQQQQTCPTCGGEGKIIK 200

Query: 139 --CSDCKGTGFRAK 150
             CS CKG G   +
Sbjct: 201 EPCSTCKGKGRVKE 214


This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354

>gnl|CDD|178709 PLN03165, PLN03165, chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
PLN03165111 chaperone protein dnaJ-related; Provisional 99.4
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.33
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 99.25
PRK14298 377 chaperone protein DnaJ; Provisional 98.99
PRK14276 380 chaperone protein DnaJ; Provisional 98.99
PRK14280 376 chaperone protein DnaJ; Provisional 98.99
PRK14282 369 chaperone protein DnaJ; Provisional 98.98
PRK14278 378 chaperone protein DnaJ; Provisional 98.97
PRK14296 372 chaperone protein DnaJ; Provisional 98.95
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 98.94
PRK14277 386 chaperone protein DnaJ; Provisional 98.92
PRK14279 392 chaperone protein DnaJ; Provisional 98.9
PRK14281 397 chaperone protein DnaJ; Provisional 98.89
PRK14285 365 chaperone protein DnaJ; Provisional 98.88
PRK14297 380 chaperone protein DnaJ; Provisional 98.87
PRK14286 372 chaperone protein DnaJ; Provisional 98.86
PRK14287 371 chaperone protein DnaJ; Provisional 98.86
PTZ00037 421 DnaJ_C chaperone protein; Provisional 98.85
PRK14300 372 chaperone protein DnaJ; Provisional 98.85
PRK14284 391 chaperone protein DnaJ; Provisional 98.83
PRK10767 371 chaperone protein DnaJ; Provisional 98.82
PRK14288 369 chaperone protein DnaJ; Provisional 98.82
PRK14301 373 chaperone protein DnaJ; Provisional 98.82
PRK14295 389 chaperone protein DnaJ; Provisional 98.8
PRK14283 378 chaperone protein DnaJ; Provisional 98.79
PRK14289 386 chaperone protein DnaJ; Provisional 98.79
PRK14293 374 chaperone protein DnaJ; Provisional 98.79
PRK14291 382 chaperone protein DnaJ; Provisional 98.78
PRK14294 366 chaperone protein DnaJ; Provisional 98.76
PRK14290 365 chaperone protein DnaJ; Provisional 98.75
PRK14292 371 chaperone protein DnaJ; Provisional 98.71
KOG2813 406 consensus Predicted molecular chaperone, contains 98.65
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 98.62
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 98.04
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 97.95
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 97.42
PLN03165111 chaperone protein dnaJ-related; Provisional 97.16
PRK14279 392 chaperone protein DnaJ; Provisional 97.09
PRK14296 372 chaperone protein DnaJ; Provisional 97.03
PRK14284 391 chaperone protein DnaJ; Provisional 97.03
PRK10767 371 chaperone protein DnaJ; Provisional 96.96
PRK14282 369 chaperone protein DnaJ; Provisional 96.91
PRK14298 377 chaperone protein DnaJ; Provisional 96.9
PRK14300 372 chaperone protein DnaJ; Provisional 96.88
PRK14301 373 chaperone protein DnaJ; Provisional 96.88
PRK14286 372 chaperone protein DnaJ; Provisional 96.88
PRK14276 380 chaperone protein DnaJ; Provisional 96.83
PRK14285 365 chaperone protein DnaJ; Provisional 96.82
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 96.79
PRK14297 380 chaperone protein DnaJ; Provisional 96.76
PRK14295 389 chaperone protein DnaJ; Provisional 96.75
PRK14278 378 chaperone protein DnaJ; Provisional 96.75
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 96.72
PTZ00037 421 DnaJ_C chaperone protein; Provisional 96.7
PRK14288 369 chaperone protein DnaJ; Provisional 96.67
PRK14287 371 chaperone protein DnaJ; Provisional 96.66
PRK14290 365 chaperone protein DnaJ; Provisional 96.66
PRK14294 366 chaperone protein DnaJ; Provisional 96.65
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 96.63
PRK14289 386 chaperone protein DnaJ; Provisional 96.61
PRK14291 382 chaperone protein DnaJ; Provisional 96.6
PRK14280 376 chaperone protein DnaJ; Provisional 96.57
PRK14293 374 chaperone protein DnaJ; Provisional 96.45
PRK14277 386 chaperone protein DnaJ; Provisional 96.45
KOG2824281 consensus Glutaredoxin-related protein [Posttransl 96.44
PRK14281 397 chaperone protein DnaJ; Provisional 96.44
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 96.39
PRK14283 378 chaperone protein DnaJ; Provisional 96.39
KOG2813 406 consensus Predicted molecular chaperone, contains 96.05
PRK14292 371 chaperone protein DnaJ; Provisional 96.03
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 95.67
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 95.47
PF07092 238 DUF1356: Protein of unknown function (DUF1356); In 91.4
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 89.65
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 87.71
PF07092 238 DUF1356: Protein of unknown function (DUF1356); In 84.93
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 84.14
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 82.37
PRK00635 1809 excinuclease ABC subunit A; Provisional 81.95
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 81.81
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
Probab=99.40  E-value=3.4e-13  Score=102.74  Aligned_cols=68  Identities=25%  Similarity=0.735  Sum_probs=57.5

Q ss_pred             CCCCccCCCCCCCCcccCCCCCcccEEeecccccccCCCCceEcCCCCccceeeCCCCCceeEEeeccCCC
Q 031467           85 QPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSVCCSDCKGTGFRAKWLGEP  155 (159)
Q Consensus        85 ~~r~~~C~~C~GsG~~~C~~C~GtG~i~~~~~~~~~~~~~~~tCp~C~G~G~i~C~~C~GtG~v~kwl~~~  155 (159)
                      ....+.|..|+|+|..+|+.|+|+|++.....   ...+..++|+.|.|+|+..|+.|+|.|++.+||..-
T Consensus        38 ~~~~v~C~~C~GsG~~~C~~C~G~G~v~~~~~---g~~q~~~~C~~C~G~Gk~~C~~C~G~G~~~~~~~~~  105 (111)
T PLN03165         38 RENTQPCFPCSGTGAQVCRFCVGSGNVTVELG---GGEKEVSKCINCDGAGSLTCTTCQGSGIQPRYLDRR  105 (111)
T ss_pred             hccCCCCCCCCCCCCcCCCCCcCcCeEEEEeC---CcEEEEEECCCCCCcceeeCCCCCCCEEEeeeeccc
Confidence            34578899999999999999999999864321   122567899999999999999999999999999764



>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07092 DUF1356: Protein of unknown function (DUF1356); InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PF07092 DUF1356: Protein of unknown function (DUF1356); InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.24
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 99.24
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 99.04
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 98.12
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.83
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.61
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 97.35
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 97.3
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.07
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 96.79
3pmq_A 669 Decaheme cytochrome C MTRF; greek KEY, C type cyto 87.29
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.24  E-value=6.9e-12  Score=90.91  Aligned_cols=60  Identities=30%  Similarity=0.784  Sum_probs=50.4

Q ss_pred             CCCccCCCCCCCCc------ccCCCCCcccEEeecccccccCCCCceEcCCCCcccee---eCCCCCceeEEe
Q 031467           86 PRPVSCSSCNSNGH------IDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSV---CCSDCKGTGFRA  149 (159)
Q Consensus        86 ~r~~~C~~C~GsG~------~~C~~C~GtG~i~~~~~~~~~~~~~~~tCp~C~G~G~i---~C~~C~GtG~v~  149 (159)
                      ++.+.|+.|+|+|+      .+|+.|+|+|++.....++    +.+++|+.|+|+|++   +|+.|+|.|++.
T Consensus        26 ~~~~~C~~C~G~G~~~g~~~~~C~~C~G~G~~~~~~G~~----~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~   94 (104)
T 2ctt_A           26 NIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPF----VMRSTCRRCGGRGSIIISPCVVCRGAGQAK   94 (104)
T ss_dssp             SCCEECSSSSSSSSCTTCCCEECSSSSSSCEEEEEETTE----EEEEECSSSSSSSEECSSCCSSSSSCSEEC
T ss_pred             eeeeECCCCcCCccCCCCCCccCCCCCCCEEEEEEeCCE----EEEEECCcCCCcceECCCcCCCCCCeeEEE
Confidence            56789999999995      6899999999986543221    356899999999998   899999999986



>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 99.35
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 99.35
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 97.92
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 97.79
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 97.62
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 90.93
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Cysteine-rich domain of the chaperone protein DnaJ
species: Escherichia coli [TaxId: 562]
Probab=99.35  E-value=1.7e-13  Score=94.26  Aligned_cols=61  Identities=28%  Similarity=0.765  Sum_probs=50.9

Q ss_pred             CCCccCCCCCCCCc------ccCCCCCcccEEeecccccccCCCCceEcCCCCcccee---eCCCCCceeEEee
Q 031467           86 PRPVSCSSCNSNGH------IDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKGSV---CCSDCKGTGFRAK  150 (159)
Q Consensus        86 ~r~~~C~~C~GsG~------~~C~~C~GtG~i~~~~~~~~~~~~~~~tCp~C~G~G~i---~C~~C~GtG~v~k  150 (159)
                      ++.+.|+.|+|+|+      .+|+.|+|+|++.....++    +..++|+.|+|+|++   +|+.|+|+|+|.+
T Consensus         9 ~~~~~C~~C~G~G~~~g~~~~~C~~C~G~G~v~~~~g~~----~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~k   78 (79)
T d1exka_           9 PTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFF----AVQQTCPHCQGRGTLIKDPCNKCHGHGRVER   78 (79)
T ss_dssp             CCEEECGGGTTTSBCSSSCCEECTTTTTSSEEEEEETTE----EEEEECTTTTTSSEECSSBCGGGTTSSEEEC
T ss_pred             eeeccCCCCcCcccCCCccceeCCCccceeEEEEecccc----eeeEECcccCcceeECCCCCCCCCCceEeec
Confidence            46789999999995      5699999999986543322    456799999999998   9999999999975



>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure