Citrus Sinensis ID: 031484

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES
cHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEcccHHHHHHHHHHcccHHccccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHc
ccHHHHHHcccccccEEEEEccHHHHHHHHHHHHcccccEEEcccccHHHHHHHccEEEEcccHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcc
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLvrnhprllltpflHSMDLAYAAADLIVSRAGAMTCYEILatgkpsilipspnvaeghqfKNASLMAKLAdsriitedeldsitLETTIEEILGNEALMAEMSERALKaakpgasaDIAQHILSLVES
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIItedeldsitlETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES
**NLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEA*******************************
**NLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSER*********SADIAQHILSLVES
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
B3QWT7365 UDP-N-acetylglucosamine-- yes no 0.924 0.402 0.422 3e-24
Q2S528370 UDP-N-acetylglucosamine-- yes no 0.937 0.402 0.393 9e-24
A6H195367 UDP-N-acetylglucosamine-- yes no 0.911 0.395 0.387 3e-22
B2RIF1379 UDP-N-acetylglucosamine-- yes no 0.905 0.379 0.394 5e-21
Q7MAW5379 UDP-N-acetylglucosamine-- yes no 0.905 0.379 0.387 8e-21
A5FIY3361 UDP-N-acetylglucosamine-- yes no 0.893 0.393 0.365 4e-20
A0M527366 UDP-N-acetylglucosamine-- yes no 0.880 0.382 0.384 2e-19
A4XI04370 UDP-N-acetylglucosamine-- yes no 0.855 0.367 0.377 4e-19
Q8R9G6364 UDP-N-acetylglucosamine-- yes no 0.729 0.318 0.422 1e-18
Q8A258372 UDP-N-acetylglucosamine-- yes no 0.943 0.403 0.344 3e-18
>sp|B3QWT7|MURG_CHLT3 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=murG PE=3 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 10  MEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYE 69
           +EK NL  IWQTG   F ++ + + +   L    F+  MD+AYAAADL V RAGA T  E
Sbjct: 217 LEKFNL--IWQTGKLDFADIATRIGSRKNLWYNAFIDQMDMAYAAADLAVCRAGASTLAE 274

Query: 70  ILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEAL 129
           I   GKPS+L+P P  A  HQF NA  +A    + +I   ++   T +T I  +L NE+ 
Sbjct: 275 ITHLGKPSVLVPYPYAAANHQFYNAKSLADNHAALLIENKDIGLETSKTEIMSLLQNESR 334

Query: 130 MAEMSERALKAAKPGASADIAQHILSLVE 158
           + +MSE +LK  KP A+  IA+H++ L E
Sbjct: 335 LKQMSENSLKLGKPHATRIIAEHVIRLAE 363
Cell wall formation. Catalyzes the transfer of a GlcNAc subunit on undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide (lipid intermediate I) to form undecaprenyl-pyrophosphoryl-MurNAc-(pentapeptide)GlcNAc (lipid intermediate II).
Chloroherpeton thalassium (strain ATCC 35110 / GB-78) (taxid: 517418)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 2EC: 2EC: 7
>sp|Q2S528|MURG_SALRD UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|A6H195|MURG_FLAPJ UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|B2RIF1|MURG_PORG3 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|Q7MAW5|MURG_PORGI UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|A5FIY3|MURG_FLAJ1 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|A0M527|MURG_GRAFK UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Gramella forsetii (strain KT0803) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|A4XI04|MURG_CALS8 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|Q8R9G6|MURG_THETN UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=murG PE=3 SV=1 Back     alignment and function description
>sp|Q8A258|MURG_BACTN UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=murG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
297734253 436 unnamed protein product [Vitis vinifera] 0.993 0.362 0.803 3e-68
225456027 431 PREDICTED: UDP-N-acetylglucosamine--N-ac 0.993 0.366 0.803 3e-68
255567808 437 UDP-N-acetylglucosamine--N-acetylmuramyl 1.0 0.363 0.792 1e-67
224118766 402 predicted protein [Populus trichocarpa] 1.0 0.395 0.786 1e-65
356511279 405 PREDICTED: UDP-N-acetylglucosamine--N-ac 0.993 0.390 0.734 2e-62
449521029 443 PREDICTED: UDP-N-acetylglucosamine--N-ac 0.993 0.356 0.708 7e-62
449439431 443 PREDICTED: UDP-N-acetylglucosamine--N-ac 0.993 0.356 0.702 4e-61
297839243 435 glycosyl transferase family 28 protein [ 1.0 0.365 0.647 4e-57
222618557 433 hypothetical protein OsJ_01999 [Oryza sa 1.0 0.367 0.616 5e-54
56202043 433 putative murG [Oryza sativa Japonica Gro 1.0 0.367 0.616 6e-54
>gi|297734253|emb|CBI15500.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%)

Query: 1   MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVS 60
           MLNLYYQML+E  NLFIIWQTGVEAF+EMESLV+NHP L+L+PFLH+MDLAYAAADL+VS
Sbjct: 273 MLNLYYQMLLEHKNLFIIWQTGVEAFDEMESLVKNHPHLVLSPFLHNMDLAYAAADLVVS 332

Query: 61  RAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTI 120
           RAGAMTC EILATGKPSILIPSPNVAEGHQFKNA LMA LA SR+ITEDELDS TL   I
Sbjct: 333 RAGAMTCTEILATGKPSILIPSPNVAEGHQFKNAILMADLAGSRVITEDELDSTTLRIAI 392

Query: 121 EEILGNEALMAEMSERALKAAKPGASADIAQHILSLVE 158
           EEIL + +LMA+M ERALK AKP ASA+IA HI+SLV+
Sbjct: 393 EEILDDPSLMADMCERALKVAKPHASAEIAHHIISLVK 430

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456027|ref|XP_002277203.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255567808|ref|XP_002524882.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis] gi|223535845|gb|EEF37506.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224118766|ref|XP_002317900.1| predicted protein [Populus trichocarpa] gi|222858573|gb|EEE96120.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511279|ref|XP_003524354.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449521029|ref|XP_004167534.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439431|ref|XP_004137489.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297839243|ref|XP_002887503.1| glycosyl transferase family 28 protein [Arabidopsis lyrata subsp. lyrata] gi|297333344|gb|EFH63762.1| glycosyl transferase family 28 protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|222618557|gb|EEE54689.1| hypothetical protein OsJ_01999 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|56202043|dbj|BAD73572.1| putative murG [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2027764431 AT1G73740 [Arabidopsis thalian 1.0 0.368 0.647 3.5e-52
TIGR_CMR|BA_4049364 BA_4049 "UDP-N-acetylglucosami 0.893 0.390 0.337 1.3e-15
TIGR_CMR|CHY_2069371 CHY_2069 "UDP-N-acetylglucosam 0.886 0.380 0.302 4e-14
TIGR_CMR|SO_4219362 SO_4219 "UDP-N-acetylglucosami 0.937 0.411 0.281 1e-13
TIGR_CMR|CPS_4465387 CPS_4465 "UDP-N-acetylglucosam 0.905 0.372 0.294 4.4e-13
TIGR_CMR|GSU_3069364 GSU_3069 "UDP-N-acetylglucosam 0.886 0.387 0.337 4.8e-13
TIGR_CMR|CBU_0135358 CBU_0135 "UDP-N-acetylglucosam 0.786 0.349 0.345 7.6e-13
UNIPROTKB|O06224410 murG "UDP-N-acetylglucosamine- 0.805 0.312 0.302 3e-12
UNIPROTKB|P17443355 murG [Escherichia coli K-12 (t 0.836 0.374 0.309 3.3e-10
TIGR_CMR|SPO_1195365 SPO_1195 "undecaprenyldiphosph 0.704 0.306 0.327 9.7e-10
TAIR|locus:2027764 AT1G73740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 541 (195.5 bits), Expect = 3.5e-52, P = 3.5e-52
 Identities = 103/159 (64%), Positives = 132/159 (83%)

Query:     1 MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVS 60
             +LN Y Q+L E  N F +WQTGVEAF+EM+SLVR+HPRL L+PFL S+ +AYAAADL++S
Sbjct:   270 LLNCYSQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVIS 329

Query:    61 RAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTI 120
             RAGAMTC EI+A GKPSILIPSP+  EG Q +NASLMA +  S++ITE+ELD+ITL   +
Sbjct:   330 RAGAMTCSEIMALGKPSILIPSPHSDEGDQVRNASLMADIVGSKLITEEELDTITLRAAM 389

Query:   121 EEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES 159
             E+ILGNE LM EMSERA KAAK  A++D+A+HI+S+++S
Sbjct:   390 EDILGNEELMMEMSERAFKAAKADAASDVAKHIISIIKS 428
GO:0005886 "plasma membrane" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=ISS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0030259 "lipid glycosylation" evidence=IEA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
TIGR_CMR|BA_4049 BA_4049 "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2069 CHY_2069 "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4219 SO_4219 "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4465 CPS_4465 "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3069 GSU_3069 "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0135 CBU_0135 "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|O06224 murG "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|P17443 murG [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1195 SPO_1195 "undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691
4th Layer2.4.1.2270.737

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
cd03785350 cd03785, GT1_MurG, MurG is an N-acetylglucosaminyl 1e-48
PRK00726357 PRK00726, murG, undecaprenyldiphospho-muramoylpent 2e-45
COG0707357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety 2e-34
TIGR01133348 TIGR01133, murG, undecaprenyldiphospho-muramoylpen 2e-29
pfam04101167 pfam04101, Glyco_tran_28_C, Glycosyltransferase fa 3e-26
PRK12446352 PRK12446, PRK12446, undecaprenyldiphospho-muramoyl 4e-06
PRK13609380 PRK13609, PRK13609, diacylglycerol glucosyltransfe 5e-06
COG4671400 COG4671, COG4671, Predicted glycosyl transferase [ 8e-06
TIGR03492396 TIGR03492, TIGR03492, conserved hypothetical prote 1e-05
PLN02605382 PLN02605, PLN02605, monogalactosyldiacylglycerol s 4e-05
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 4e-04
PRK13608391 PRK13608, PRK13608, diacylglycerol glucosyltransfe 0.001
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 0.004
>gnl|CDD|99961 cd03785, GT1_MurG, MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information 
 Score =  159 bits (405), Expect = 1e-48
 Identities = 51/145 (35%), Positives = 75/145 (51%), Gaps = 1/145 (0%)

Query: 9   LMEKHNLFIIWQTGVEAFNEMESLVRNH-PRLLLTPFLHSMDLAYAAADLIVSRAGAMTC 67
            + +  L +I QTG     E++           + PF+  M  AYAAADL++SRAGA T 
Sbjct: 206 ELLRKRLQVIHQTGKGDLEEVKKAYEELGVNYEVFPFIDDMAAAYAAADLVISRAGASTV 265

Query: 68  YEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNE 127
            E+ A G P+ILIP P  A+ HQ  NA  + K   + +I ++EL    L   + E+L + 
Sbjct: 266 AELAALGLPAILIPLPYAADDHQTANARALVKAGAAVLIPQEELTPERLAAALLELLSDP 325

Query: 128 ALMAEMSERALKAAKPGASADIAQH 152
             +  M+E A   A+P A+  IA  
Sbjct: 326 ERLKAMAEAARSLARPDAAERIADL 350

It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. Length = 350
>gnl|CDD|234825 PRK00726, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233284 TIGR01133, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>gnl|CDD|217893 pfam04101, Glyco_tran_28_C, Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>gnl|CDD|171505 PRK12446, PRK12446, undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237445 PRK13609, PRK13609, diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227017 COG4671, COG4671, Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234231 TIGR03492, TIGR03492, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|215325 PLN02605, PLN02605, monogalactosyldiacylglycerol synthase Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|184179 PRK13608, PRK13608, diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.93
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.87
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.87
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.87
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.86
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.85
PLN02605382 monogalactosyldiacylglycerol synthase 99.85
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.83
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.82
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.76
TIGR03492396 conserved hypothetical protein. This protein famil 99.76
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.76
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.74
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.74
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 99.73
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.72
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.7
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 99.69
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.69
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.69
cd03820348 GT1_amsD_like This family is most closely related 99.68
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 99.67
cd03814364 GT1_like_2 This family is most closely related to 99.67
cd04962371 GT1_like_5 This family is most closely related to 99.66
cd03818396 GT1_ExpC_like This family is most closely related 99.66
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.66
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.66
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.65
cd03808359 GT1_cap1E_like This family is most closely related 99.64
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 99.64
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.64
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.63
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.63
cd04951360 GT1_WbdM_like This family is most closely related 99.63
cd04949372 GT1_gtfA_like This family is most closely related 99.62
cd03801374 GT1_YqgM_like This family is most closely related 99.62
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.61
cd03807365 GT1_WbnK_like This family is most closely related 99.6
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.6
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 99.6
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.6
COG4671400 Predicted glycosyl transferase [General function p 99.6
PRK10307412 putative glycosyl transferase; Provisional 99.59
cd03823359 GT1_ExpE7_like This family is most closely related 99.59
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 99.57
cd03822366 GT1_ecORF704_like This family is most closely rela 99.57
cd03805392 GT1_ALG2_like This family is most closely related 99.57
cd03813475 GT1_like_3 This family is most closely related to 99.57
cd03794394 GT1_wbuB_like This family is most closely related 99.56
KOG3349170 consensus Predicted glycosyltransferase [General f 99.56
cd03812358 GT1_CapH_like This family is most closely related 99.56
PLN02670472 transferase, transferring glycosyl groups 99.56
cd03821375 GT1_Bme6_like This family is most closely related 99.56
cd03817374 GT1_UGDG_like This family is most closely related 99.55
cd04946407 GT1_AmsK_like This family is most closely related 99.54
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.54
cd03819355 GT1_WavL_like This family is most closely related 99.54
cd03816415 GT1_ALG1_like This family is most closely related 99.53
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.53
cd03796398 GT1_PIG-A_like This family is most closely related 99.53
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.52
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.52
cd03825365 GT1_wcfI_like This family is most closely related 99.51
cd03798377 GT1_wlbH_like This family is most closely related 99.5
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.5
cd03795357 GT1_like_4 This family is most closely related to 99.5
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 99.49
PLN03004451 UDP-glycosyltransferase 99.46
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.46
cd03811353 GT1_WabH_like This family is most closely related 99.46
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 99.45
PLN02562448 UDP-glycosyltransferase 99.43
PLN02210456 UDP-glucosyl transferase 99.43
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.42
PLN00142815 sucrose synthase 99.42
cd03804351 GT1_wbaZ_like This family is most closely related 99.42
cd03809365 GT1_mtfB_like This family is most closely related 99.42
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.42
PLN02501794 digalactosyldiacylglycerol synthase 99.41
PHA01630331 putative group 1 glycosyl transferase 99.4
PLN02949463 transferase, transferring glycosyl groups 99.39
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 99.39
PLN02846462 digalactosyldiacylglycerol synthase 99.37
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 99.37
PLN00414446 glycosyltransferase family protein 99.36
PLN02554481 UDP-glycosyltransferase family protein 99.35
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.34
PLN02448459 UDP-glycosyltransferase family protein 99.34
cd04955363 GT1_like_6 This family is most closely related to 99.34
PLN02208442 glycosyltransferase family protein 99.34
PRK14099485 glycogen synthase; Provisional 99.34
PLN02173449 UDP-glucosyl transferase family protein 99.33
PLN03007482 UDP-glucosyltransferase family protein 99.32
PLN02764453 glycosyltransferase family protein 99.31
PRK00654466 glgA glycogen synthase; Provisional 99.31
PLN00164480 glucosyltransferase; Provisional 99.31
PLN02992481 coniferyl-alcohol glucosyltransferase 99.31
PLN02207468 UDP-glycosyltransferase 99.3
cd03806419 GT1_ALG11_like This family is most closely related 99.3
PRK14098489 glycogen synthase; Provisional 99.29
PLN02167475 UDP-glycosyltransferase family protein 99.29
PLN02275371 transferase, transferring glycosyl groups 99.28
PRK14089347 ipid-A-disaccharide synthase; Provisional 99.25
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 99.25
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.24
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 99.24
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 99.24
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 99.23
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 99.22
PHA01633335 putative glycosyl transferase group 1 99.21
PLN02555480 limonoid glucosyltransferase 99.19
PLN02939977 transferase, transferring glycosyl groups 99.19
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 99.18
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 99.11
cd03802335 GT1_AviGT4_like This family is most closely relate 99.1
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 99.07
PRK10125405 putative glycosyl transferase; Provisional 99.06
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 99.06
PLN03015470 UDP-glucosyl transferase 99.05
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 99.04
PLN023161036 synthase/transferase 99.04
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 99.0
COG5017161 Uncharacterized conserved protein [Function unknow 99.0
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 98.97
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.92
PLN02534491 UDP-glycosyltransferase 98.87
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 98.87
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.86
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 98.77
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 98.75
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 98.75
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 98.64
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 98.54
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 98.53
KOG1111426 consensus N-acetylglucosaminyltransferase complex, 98.52
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 98.5
KOG0853495 consensus Glycosyltransferase [Cell wall/membrane/ 98.47
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 98.39
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 98.29
COG4370412 Uncharacterized protein conserved in bacteria [Fun 98.26
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.24
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 98.24
PF04464369 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate 97.73
PRK10017426 colanic acid biosynthesis protein; Provisional 97.67
KOG2941444 consensus Beta-1,4-mannosyltransferase [Posttransl 97.53
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 97.49
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 97.35
COG1817346 Uncharacterized protein conserved in archaea [Func 97.28
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 97.16
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 97.0
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 96.97
TIGR02193319 heptsyl_trn_I lipopolysaccharide heptosyltransfera 96.9
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 96.34
PRK10964322 ADP-heptose:LPS heptosyl transferase I; Provisiona 96.18
PF00982474 Glyco_transf_20: Glycosyltransferase family 20; In 96.01
PRK10117474 trehalose-6-phosphate synthase; Provisional 96.0
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 95.82
PF01075247 Glyco_transf_9: Glycosyltransferase family 9 (hept 95.63
PF05693633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 95.56
TIGR02195334 heptsyl_trn_II lipopolysaccharide heptosyltransfer 95.52
COG0859334 RfaF ADP-heptose:LPS heptosyltransferase [Cell env 95.5
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 95.42
KOG1387465 consensus Glycosyltransferase [Cell wall/membrane/ 95.38
KOG4626966 consensus O-linked N-acetylglucosamine transferase 95.35
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [ 95.22
PRK10422352 lipopolysaccharide core biosynthesis protein; Prov 95.14
TIGR02201344 heptsyl_trn_III lipopolysaccharide heptosyltransfe 94.44
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 94.34
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 94.34
COG1887388 TagB Putative glycosyl/glycerophosphate transferas 94.07
PF11071141 DUF2872: Protein of unknown function (DUF2872); In 93.59
COG0380486 OtsA Trehalose-6-phosphate synthase [Carbohydrate 93.53
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 92.99
TIGR00730178 conserved hypothetical protein, DprA/Smf-related, 92.7
PF15024559 Glyco_transf_18: Glycosyltransferase family 18 92.05
PF05014113 Nuc_deoxyrib_tr: Nucleoside 2-deoxyribosyltransfer 91.95
COG2327385 WcaK Polysaccharide pyruvyl transferase family pro 91.6
PF03641133 Lysine_decarbox: Possible lysine decarboxylase; In 90.98
TIGR03646144 YtoQ_fam YtoQ family protein. Members of this fami 90.96
PF1008797 DUF2325: Uncharacterized protein conserved in bact 89.34
PF04230286 PS_pyruv_trans: Polysaccharide pyruvyl transferase 88.96
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase Cs 86.93
COG1618179 Predicted nucleotide kinase [Nucleotide transport 86.84
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 85.35
COG4641373 Uncharacterized protein conserved in bacteria [Fun 83.96
COG1519 419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 83.53
PLN02929 301 NADH kinase 83.24
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 83.09
PRK04885 265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 82.25
PRK02649 305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 82.06
PRK03372 306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.52
PRK04539 296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.11
PF02445296 NadA: Quinolinate synthetase A protein; InterPro: 81.07
PRK01911 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 80.7
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=99.93  E-value=3.9e-24  Score=165.54  Aligned_cols=154  Identities=36%  Similarity=0.500  Sum_probs=136.4

Q ss_pred             HHHHHhhcC-CeeEEEEcCcccHHHHHHHhhcCCCeEEecccccHHHHHhhCceEEecCChHHHHHHHHhCCcEEEecCC
Q 031484            5 YYQMLMEKH-NLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSP   83 (159)
Q Consensus         5 ~~~~~~~~~-~~~~~~~~G~~~~~~l~~~~~~~~~v~~~~~~~~~~~~l~~ad~~i~~~G~~t~~Eal~~g~P~I~~p~~   83 (159)
                      +.+++..-. ++++++++|++..+++...+....-+.+.+|.++|..+|+.||++||++|++|+.|++++|+|+|++|.+
T Consensus       202 v~~~~~~l~~~~~v~~~~G~~~~~~~~~~~~~~~~~~v~~f~~dm~~~~~~ADLvIsRaGa~Ti~E~~a~g~P~IliP~p  281 (357)
T COG0707         202 VPEALAKLANRIQVIHQTGKNDLEELKSAYNELGVVRVLPFIDDMAALLAAADLVISRAGALTIAELLALGVPAILVPYP  281 (357)
T ss_pred             HHHHHHHhhhCeEEEEEcCcchHHHHHHHHhhcCcEEEeeHHhhHHHHHHhccEEEeCCcccHHHHHHHhCCCEEEeCCC
Confidence            334444444 6999999999877776665543212899999999999999999999999999999999999999999999


Q ss_pred             CCCCchHHHHHHHHHHcCceeeeccCCCChhHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhhh
Q 031484           84 NVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVE  158 (159)
Q Consensus        84 ~~~~~~q~~~~~~~~~~~~g~~~~~~~~~~~~l~~~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~  158 (159)
                      +..++||..|++++++.|.+.++...+++++.+.+.+.+++++|+..+.|+++++.+...++.+++++.++....
T Consensus       282 ~~~~~~Q~~NA~~l~~~gaa~~i~~~~lt~~~l~~~i~~l~~~~~~l~~m~~~a~~~~~p~aa~~i~~~~~~~~~  356 (357)
T COG0707         282 PGADGHQEYNAKFLEKAGAALVIRQSELTPEKLAELILRLLSNPEKLKAMAENAKKLGKPDAAERIADLLLALAK  356 (357)
T ss_pred             CCccchHHHHHHHHHhCCCEEEeccccCCHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHhc
Confidence            877889999999999999999999999999999999999999999999999999999999999999999887653

>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG3349 consensus Predicted glycosyltransferase [General function prediction only] Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional Back     alignment and domain information
>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II Back     alignment and domain information
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF11071 DUF2872: Protein of unknown function (DUF2872); InterPro: IPR019884 This entry represents a family of uncharacterised proteins, including YtoQ from Bacillus subtilis Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>TIGR00730 conserved hypothetical protein, DprA/Smf-related, family 2 Back     alignment and domain information
>PF15024 Glyco_transf_18: Glycosyltransferase family 18 Back     alignment and domain information
>PF05014 Nuc_deoxyrib_tr: Nucleoside 2-deoxyribosyltransferase; InterPro: IPR007710 Nucleoside 2-deoxyribosyltransferase (2 Back     alignment and domain information
>COG2327 WcaK Polysaccharide pyruvyl transferase family protein [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF03641 Lysine_decarbox: Possible lysine decarboxylase; InterPro: IPR005269 This entry represents a cytokinin-activating enzyme working in the direct activation pathway Back     alignment and domain information
>TIGR03646 YtoQ_fam YtoQ family protein Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04230 PS_pyruv_trans: Polysaccharide pyruvyl transferase; InterPro: IPR007345 Pyruvyl-transferases are involved in peptidoglycan-associated polymer biosynthesis Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02929 NADH kinase Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF02445 NadA: Quinolinate synthetase A protein; InterPro: IPR003473 Quinolinate synthetase catalyzes the second step of the de novo biosynthetic pathway of pyridine nucleotide formation Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
3s2u_A365 Crystal Structure Of The Pseudomonas Aeruginosa Mur 8e-14
1f0k_A364 The 1.9 Angstrom Crystal Structure Of E. Coli Murg 2e-09
>pdb|3S2U|A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-Glcnac Substrate Complex Length = 365 Back     alignment and structure 
Iteration: 1

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%)
Query: 41  LTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKL 100
           + PF+  M  AYA ADL++ RAGA+T  E+ A G P+ L+P P+  + HQ +NA  + + 
Sbjct: 239 VAPFISDMAAAYAWADLVICRAGALTVSELTAAGLPAFLVPLPHAIDDHQTRNAEFLVRS 298
Query: 101 ADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES 159
              R++ +    +  L   + E+L +   +  M+++A   AKP A+  +    L +   
Sbjct: 299 GAGRLLPQKSTGAAELAAQLSEVLMHPETLRSMADQARSLAKPEATRTVVDACLEVARG 357
>pdb|1F0K|A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 1e-42
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 7e-16
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 2e-08
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 2e-05
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 1e-04
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Length = 364 Back     alignment and structure
 Score =  143 bits (364), Expect = 1e-42
 Identities = 40/145 (27%), Positives = 72/145 (49%), Gaps = 5/145 (3%)

Query: 17  IIWQTGVEAFNEMESLVR--NHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATG 74
           I  Q+G  +   +E        P+  +T F+  M  AYA AD++V R+GA+T  EI A G
Sbjct: 215 IWHQSGKGSQQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAG 274

Query: 75  KPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMS 134
            P++ +P  +  +  Q+ NA  + K   ++II + +L    +  T+     +   +  M+
Sbjct: 275 LPALFVPFQH-KDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGW--SRETLLTMA 331

Query: 135 ERALKAAKPGASADIAQHILSLVES 159
           ERA  A+ P A+  +A  +  +  +
Sbjct: 332 ERARAASIPDATERVANEVSRVARA 356
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Length = 224 Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Length = 282 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.95
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.88
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.86
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.86
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.86
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.86
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.85
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.85
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.84
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.84
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.84
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.83
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.82
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.81
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.81
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.81
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.77
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.76
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 99.75
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.75
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 99.74
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.72
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.71
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.71
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.71
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.71
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 99.69
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 99.69
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 99.69
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.68
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 99.67
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 99.67
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.66
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 99.64
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 99.64
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.63
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.61
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.59
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.59
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 99.58
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 99.58
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.57
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 99.57
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 99.55
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 99.55
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 99.54
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 99.52
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 99.39
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 99.38
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 99.26
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 99.24
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 99.2
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 99.05
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 98.9
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 98.85
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 98.72
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.47
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 97.35
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 97.35
3tov_A349 Glycosyl transferase family 9; structural genomics 97.04
3l7i_A729 Teichoic acid biosynthesis protein F; GT-B fold, m 95.28
3ehd_A162 Uncharacterized conserved protein; PSI,MCSG,PF0501 92.48
2f62_A161 Nucleoside 2-deoxyribosyltransferase; SGPP, struct 91.48
4fyk_A152 Deoxyribonucleoside 5'-monophosphate N-glycosidas; 90.07
2iz6_A176 Molybdenum cofactor carrier protein; metal transpo 90.02
2khz_A165 C-MYC-responsive protein RCL; flexible loop, nucle 89.7
1s2d_A167 Purine trans deoxyribosylase; ribosylate intermedi 89.42
1ydh_A216 AT5G11950; structural genomics, protein structure 88.59
3sbx_A189 Putative uncharacterized protein; structural genom 87.13
2l2q_A109 PTS system, cellobiose-specific IIB component (CE; 86.01
1f8y_A157 Nucleoside 2-deoxyribosyltransferase; active site, 84.91
2q5c_A196 NTRC family transcriptional regulator; structural 82.52
1rcu_A195 Conserved hypothetical protein VT76; structural ge 81.44
2i2c_A 272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 80.03
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=99.95  E-value=9.5e-27  Score=180.26  Aligned_cols=147  Identities=27%  Similarity=0.437  Sum_probs=129.7

Q ss_pred             cCCeeEEEEcCcccHHHHHHHhhc-CCCeEEecccccHHHHHhhCceEEecCChHHHHHHHHhCCcEEEecCCCCCCchH
Q 031484           12 KHNLFIIWQTGVEAFNEMESLVRN-HPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQ   90 (159)
Q Consensus        12 ~~~~~~~~~~G~~~~~~l~~~~~~-~~~v~~~~~~~~~~~~l~~ad~~i~~~G~~t~~Eal~~g~P~I~~p~~~~~~~~q   90 (159)
                      ..++++++++|+.+.+.+.+.++. ..++.+.+|+++|.++|+.||++||++|++|++|++++|+|+|++|.++..+++|
T Consensus       209 ~~~~~vi~~~G~~~~~~~~~~~~~~~~~~~v~~f~~dm~~~l~~aDlvI~raG~~Tv~E~~a~G~P~Ilip~p~~~~~~Q  288 (365)
T 3s2u_A          209 EIRPAIRHQAGRQHAEITAERYRTVAVEADVAPFISDMAAAYAWADLVICRAGALTVSELTAAGLPAFLVPLPHAIDDHQ  288 (365)
T ss_dssp             TTCCEEEEECCTTTHHHHHHHHHHTTCCCEEESCCSCHHHHHHHCSEEEECCCHHHHHHHHHHTCCEEECC-----CCHH
T ss_pred             ccceEEEEecCccccccccceecccccccccccchhhhhhhhccceEEEecCCcchHHHHHHhCCCeEEeccCCCCCcHH
Confidence            346788899999877777666654 3589999999999999999999999999999999999999999999987778999


Q ss_pred             HHHHHHHHHcCceeeeccCCCChhHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhhh
Q 031484           91 FKNASLMAKLADSRIITEDELDSITLETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVE  158 (159)
Q Consensus        91 ~~~~~~~~~~~~g~~~~~~~~~~~~l~~~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~  158 (159)
                      ..|++++++.|.|++++.++++++.|.+++.++++||+.+++|++++++++..++++++++.|+++.+
T Consensus       289 ~~NA~~l~~~G~a~~l~~~~~~~~~L~~~i~~ll~d~~~~~~m~~~a~~~~~~~aa~~ia~~i~~lar  356 (365)
T 3s2u_A          289 TRNAEFLVRSGAGRLLPQKSTGAAELAAQLSEVLMHPETLRSMADQARSLAKPEATRTVVDACLEVAR  356 (365)
T ss_dssp             HHHHHHHHTTTSEEECCTTTCCHHHHHHHHHHHHHCTHHHHHHHHHHHHTCCTTHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHCCCEEEeecCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHhcCCccHHHHHHHHHHHHHc
Confidence            99999999999999999888889999999999999999999999999999999999999999998753
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>3ehd_A Uncharacterized conserved protein; PSI,MCSG,PF05014, structural genomics, protein structure INI midwest center for structural genomics; HET: MSE; 2.15A {Enterococcus faecalis} Back     alignment and structure
>2f62_A Nucleoside 2-deoxyribosyltransferase; SGPP, structural genomics, PSI, S genomics of pathogenic protozoa consortium; HET: 12M; 1.50A {Trypanosoma brucei} SCOP: c.23.14.1 PDB: 2a0k_A* 2f2t_A* 2f64_A* 2f67_A* Back     alignment and structure
>4fyk_A Deoxyribonucleoside 5'-monophosphate N-glycosidas; hydrolas; HET: SRA; 1.79A {Rattus norvegicus} PDB: 4fyh_A* 4fyi_A* 2klh_A* Back     alignment and structure
>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A Back     alignment and structure
>2khz_A C-MYC-responsive protein RCL; flexible loop, nucleus, phosphoprotein, nuclear protein; NMR {Rattus norvegicus} PDB: 2klh_A* Back     alignment and structure
>1s2d_A Purine trans deoxyribosylase; ribosylate intermediate, PTD, ARAA, transferase; HET: AR4 ADE; 2.10A {Lactobacillus helveticus} SCOP: c.23.14.1 PDB: 1s2g_A* 1s2i_A* 1s2l_A 1s3f_A* Back     alignment and structure
>1ydh_A AT5G11950; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG; 2.15A {Arabidopsis thaliana} SCOP: c.129.1.1 PDB: 2q4d_A Back     alignment and structure
>3sbx_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: AMP; 2.50A {Mycobacterium marinum M} Back     alignment and structure
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} Back     alignment and structure
>1f8y_A Nucleoside 2-deoxyribosyltransferase; active site, alpha/beta protein, biocatalyst, X- RAY crystallography; HET: 5MD; 2.40A {Lactobacillus leichmannii} SCOP: c.23.14.1 PDB: 1f8x_A* Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d1f0ka_351 c.87.1.2 (A:) Peptidoglycan biosynthesis glycosylt 4e-18
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 2e-14
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 3e-13
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 3e-12
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 4e-07
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Length = 351 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Peptidoglycan biosynthesis glycosyltransferase MurG
domain: Peptidoglycan biosynthesis glycosyltransferase MurG
species: Escherichia coli [TaxId: 562]

 Score = 77.5 bits (189), Expect = 4e-18
 Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 3/155 (1%)

Query: 5   YYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGA 64
               L +   ++     G +   E        P+  +T F+  M  AYA AD++V R+GA
Sbjct: 199 VAAKLGDSVTIWHQSGKGSQQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGA 258

Query: 65  MTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTIEEIL 124
           +T  EI A G P++ +P  +  +  Q+ NA  + K   ++II + +L    +  T+    
Sbjct: 259 LTVSEIAAAGLPALFVPFQH-KDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGW- 316

Query: 125 GNEALMAEMSERALKAAKPGASADIAQHILSLVES 159
            +   +  M+ERA  A+ P A+  +A  +  +  +
Sbjct: 317 -SRETLLTMAERARAASIPDATERVANEVSRVARA 350
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.9
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.78
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.76
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.75
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.7
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.62
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.6
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.55
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.55
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.5
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 99.46
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.45
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.4
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 99.14
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 99.0
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 98.93
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 98.83
d1pswa_348 ADP-heptose LPS heptosyltransferase II {Escherichi 95.41
d1s2da_167 Purine transdeoxyribosylase {Lactobacillus helveti 90.5
d1t35a_179 Hypothetical protein YvdD {Bacillus subtilis [TaxI 89.83
d1f8ya_156 Nucleoside 2-deoxyribosyltransferase {Lactobacillu 89.22
d2f62a1152 Nucleoside 2-deoxyribosyltransferase {Trypanosoma 89.04
d2q4oa1183 Hypothetical protein At2g37210/T2N18.3 {Thale cres 87.17
d1rcua_170 Hypothetical protein TM1055 {Thermotoga maritima [ 85.46
d1ydhb_181 Hypothetical protein At5g11950 {Thale cress (Arabi 85.03
d1weka_208 Hypothetical protein TT1465 (TTHA1644) {Thermus th 81.35
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Peptidoglycan biosynthesis glycosyltransferase MurG
domain: Peptidoglycan biosynthesis glycosyltransferase MurG
species: Escherichia coli [TaxId: 562]

Probab=99.90  E-value=1.7e-22  Score=151.79  Aligned_cols=121  Identities=30%  Similarity=0.481  Sum_probs=109.8

Q ss_pred             CCCeEEecccccHHHHHhhCceEEecCChHHHHHHHHhCCcEEEecCCCCCCchHHHHHHHHHHcCceeeeccCCCChhH
Q 031484           36 HPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSIT  115 (159)
Q Consensus        36 ~~~v~~~~~~~~~~~~l~~ad~~i~~~G~~t~~Eal~~g~P~I~~p~~~~~~~~q~~~~~~~~~~~~g~~~~~~~~~~~~  115 (159)
                      ..++.+.+|++++.++|+.||++||++|++|++|++++|+|+|++|.+. .+++|..|++++++.|.|+.++..+++++.
T Consensus       230 ~~~~~v~~f~~~~~~lm~~adl~It~~G~~T~~Eal~~g~P~I~iP~~~-~~~~Q~~NA~~l~~~G~~~~~~~~~~~~e~  308 (351)
T d1f0ka_         230 QPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQH-KDRQQYWNALPLEKAGAAKIIEQPQLSVDA  308 (351)
T ss_dssp             CTTSEEESCCSCHHHHHHHCSEEEECCCHHHHHHHHHHTCCEEECCCCC-TTCHHHHHHHHHHHTTSEEECCGGGCCHHH
T ss_pred             cccceeeeehhhHHHHHHhCchhhccccchHHHHHHHhCCceeeeeccc-CCchHHHHHHHHHHCCCEEEechhhCCHHH
Confidence            4688999999999999999999999999999999999999999999753 357899999999999999999888888999


Q ss_pred             HHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhhhC
Q 031484          116 LETTIEEILGNEALMAEMSERALKAAKPGASADIAQHILSLVES  159 (159)
Q Consensus       116 l~~~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~  159 (159)
                      +.+.+..+  +++.+.+|+++++++...++++++++.|+++.++
T Consensus       309 l~~~l~~l--~~~~~~~~~~~~~~~~~~~~a~~i~~~i~~l~~~  350 (351)
T d1f0ka_         309 VANTLAGW--SRETLLTMAERARAASIPDATERVANEVSRVARA  350 (351)
T ss_dssp             HHHHHHTC--CHHHHHHHHHHHHHTCCTTHHHHHHHHHHHHHTT
T ss_pred             HHHHHHhh--CHHHHHHHHHHHHccCCccHHHHHHHHHHHHHhc
Confidence            99988876  6777889999999999999999999999998753
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2da_ c.23.14.1 (A:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1t35a_ c.129.1.1 (A:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f8ya_ c.23.14.1 (A:) Nucleoside 2-deoxyribosyltransferase {Lactobacillus leichmannii [TaxId: 28039]} Back     information, alignment and structure
>d2f62a1 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2q4oa1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rcua_ c.129.1.1 (A:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydhb_ c.129.1.1 (B:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weka_ c.129.1.1 (A:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure