Citrus Sinensis ID: 031503

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MFINNLLSTKPPLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPSLAME

cccccccccccccEEccccccccccccccEEEEEEEEcHHHHHHHHHcccccccccccHHHHHHcccccEEEcHHHHHHHHHHHHccccccEEEEEEEEEEccccccccEEEEEEEEEEEEEcccEEEEEEEEEEEEcccEEEEEEEEEEEccccccc

ccHHHcccccccHHHHHccccHHHEEEccccEEEEEEcHHHHHHHHHcccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccccEEEEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEEEEEccccccc

mfinnllstkppllryfssleprilktgdilrqtrifssedvveyskvshdsnplhfnsesarnagfddrlVHGMLVASMFpqiisshfpgavyvsqslhfrlpvyigdevlgQLQAVNVREMKKRYLVKFSTKcikngellvldgeamaflpslame

mfinnllstkppllryfssleprilktgdilrqTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTkcikngellvlDGEAMAFLPSLAME

MFINNLLSTKPPLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPSLAME

*********KPPLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEY*******************AGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFL******

***********PLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPSL***

MFINNLLSTKPPLLRYFSSLEPRILKTGDILRQTRIFSSED**********SNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPSLAME

MF**NLLSTKPPLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPS****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFINNLLSTKPPLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPSLAME

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		158	2.2.26 [Sep-21-2011]
O32472		134	(R)-specific enoyl-CoA hy	N/A	no	0.803	0.947	0.351	3e-17
P86397		168	Hydroxyacyl-thioester deh	yes	no	0.841	0.791	0.286	2e-13
P77455		681	Bifunctional protein PaaZ	N/A	no	0.601	0.139	0.307	0.0006

>sp\|O32472\|PHAJ_AERPU (R)-specific enoyl-CoA hydratase OS=Aeromonas punctata GN=phaJ PE=1 SV=1	Back alignment and function desciption

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 4/131 (3%)

Query: 25  LKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQI 84
           L+ G   R ++ F + +V  ++ +S D NPLH +   A    F+  +VHGML+AS+F  +
Sbjct: 6   LEVGQKARLSKRFGAAEVAAFAALSEDFNPLHLDPAFAATTAFERPIVHGMLLASLFSGL 65

Query: 85  ISSHFP--GAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELL 142
           +    P  G++Y+ QSL F+LPV++GDEV  +++   +RE K   +   +T+    G  L
Sbjct: 66  LGQQLPGKGSIYLGQSLSFKLPVFVGDEVTAEVEVTALREDKP--IATLTTRIFTQGGAL 123

Query: 143 VLDGEAMAFLP 153
            + GEA+  LP
Sbjct: 124 AVTGEAVVKLP 134

Catalyzes the hydration of trans-2-enoyl-CoA with a chain-length of 4-6 carbon atoms, forming the corresponding (3R)-3-hydroxyacyl-CoA.
Aeromonas punctata (taxid: 648)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1EC: 9

>sp\|P86397\|HTD2_HUMAN Hydroxyacyl-thioester dehydratase type 2, mitochondrial OS=Homo sapiens GN=RPP14 PE=1 SV=1	Back alignment and function description

>sp\|P77455\|PAAZ_ECOLI Bifunctional protein PaaZ OS=Escherichia coli (strain K12) GN=paaZ PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		158
255570793		162	oxidoreductase, putative [Ricinus commun	1.0	0.975	0.708	1e-63
224068604		173	predicted protein [Populus trichocarpa]	1.0	0.913	0.670	2e-59
297746213		173	unnamed protein product [Vitis vinifera]	0.860	0.786	0.720	1e-55
225435224		383	PREDICTED: uncharacterized protein LOC10	0.860	0.355	0.720	3e-55
334188522		166	Thioesterase-like protein [Arabidopsis t	0.917	0.873	0.687	1e-53
297796989		346	hypothetical protein ARALYDRAFT_496171 [	0.917	0.419	0.673	2e-52
356499277		169	PREDICTED: hydroxyacyl-thioester dehydra	0.911	0.852	0.625	2e-50
388522593		168	unknown [Lotus japonicus]	1.0	0.940	0.602	5e-50
357493635		164	Hydroxyacyl-thioester dehydratase type 2	0.892	0.859	0.640	6e-50
449463667		162	PREDICTED: (R)-specific enoyl-CoA hydrat	0.822	0.802	0.684	7e-49

>gi\|255570793\|ref\|XP_002526349.1\| oxidoreductase, putative [Ricinus communis] gi\|223534308\|gb\|EEF36020.1\| oxidoreductase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/158 (70%), Positives = 138/158 (87%)

Query: 1   MFINNLLSTKPPLLRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSE 60
           MF+ +L+S   P  R FS   P +LKTGD++RQTR+FS++DV EYSKVS+D NPLHF+ E
Sbjct: 1   MFVKSLVSRTVPYARRFSWTAPTVLKTGDVIRQTRVFSNQDVTEYSKVSNDLNPLHFDDE 60

Query: 61  SARNAGFDDRLVHGMLVASMFPQIISSHFPGAVYVSQSLHFRLPVYIGDEVLGQLQAVNV 120
            ARNAGF+DR+VHGMLVA++FP+II+SHFPGAVYVSQ LHFR PVYIGDE++G++QAV++
Sbjct: 61  FARNAGFEDRIVHGMLVAALFPRIIASHFPGAVYVSQGLHFRSPVYIGDEIVGEVQAVSI 120

Query: 121 REMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPSLAME 158
           RE KKRY+VKFSTKC KNGELLVLDGEAMA LP+LA+E
Sbjct: 121 RENKKRYIVKFSTKCFKNGELLVLDGEAMAILPNLAVE 158

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224068604\|ref\|XP_002326156.1\| predicted protein [Populus trichocarpa] gi\|222833349\|gb\|EEE71826.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297746213\|emb\|CBI16269.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225435224\|ref\|XP_002282115.1\| PREDICTED: uncharacterized protein LOC100253475 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|334188522\|ref\|NP_001190580.1\| Thioesterase-like protein [Arabidopsis thaliana] gi\|10177725\|dbj\|BAB10971.1\| unnamed protein product [Arabidopsis thaliana] gi\|332009927\|gb\|AED97310.1\| Thioesterase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297796989\|ref\|XP_002866379.1\| hypothetical protein ARALYDRAFT_496171 [Arabidopsis lyrata subsp. lyrata] gi\|297312214\|gb\|EFH42638.1\| hypothetical protein ARALYDRAFT_496171 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356499277\|ref\|XP_003518468.1\| PREDICTED: hydroxyacyl-thioester dehydratase type 2, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|388522593\|gb\|AFK49358.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|357493635\|ref\|XP_003617106.1\| Hydroxyacyl-thioester dehydratase type 2 [Medicago truncatula] gi\|355518441\|gb\|AET00065.1\| Hydroxyacyl-thioester dehydratase type 2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449463667\|ref\|XP_004149553.1\| PREDICTED: (R)-specific enoyl-CoA hydratase-like [Cucumis sativus] gi\|449508663\|ref\|XP_004163376.1\| PREDICTED: (R)-specific enoyl-CoA hydratase-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		158
UNIPROTKB\|Q5LNQ1		164	SPO3152 "MaoC domain protein"	0.721	0.695	0.386	8.6e-17
TIGR_CMR\|SPO_3152		164	SPO_3152 "MaoC domain protein"	0.721	0.695	0.386	8.6e-17
UNIPROTKB\|Q81TF2		147	BAS1226 "MaoC family protein"	0.772	0.829	0.317	1.3e-15
TIGR_CMR\|BA_1326		147	BA_1326 "maoC family protein"	0.772	0.829	0.317	1.3e-15
UNIPROTKB\|F1NGH7		163	RPP14 "Uncharacterized protein	0.803	0.779	0.303	5.4e-15
UNIPROTKB\|Q81RV8		133	BAS1790 "MaoC family protein"	0.791	0.939	0.341	5.4e-15
TIGR_CMR\|BA_1929		133	BA_1929 "maoC family protein"	0.791	0.939	0.341	5.4e-15
DICTYBASE\|DDB_G0281965		150	DDB_G0281965 [Dictyostelium di	0.683	0.72	0.303	6.9e-15
UNIPROTKB\|P86397		168	RPP14 "Hydroxyacyl-thioester d	0.841	0.791	0.286	8.8e-15
UNIPROTKB\|Q0C3X3		143	HNE_0843 "MaoC domain protein"	0.854	0.944	0.314	3e-14

UNIPROTKB\|Q5LNQ1 SPO3152 "MaoC domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

 Score = 207 (77.9 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 46/119 (38%), Positives = 68/119 (57%)

Query:    38 SSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPG--AVYV 95
             + ED+  +++VS D NP+H + E AR+  F+ R+ HGML A +   +I    PG   VY+
Sbjct:    45 TDEDIEMFAQVSTDRNPVHLDDEYARDTIFEGRIAHGMLTAGLISAVIGEQLPGHGTVYM 104

Query:    96 SQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLPS 154
              QSL F  PV  GD V  +++ +++   K+R  VK    C  +G+  VL GEAM   PS
Sbjct:   105 GQSLKFLAPVRPGDTVYAEVKVIDIDFAKRR--VKLDCHCAVDGKK-VLVGEAMVLAPS 160

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

TIGR_CMR\|SPO_3152 SPO_3152 "MaoC domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

UNIPROTKB\|Q81TF2 BAS1226 "MaoC family protein" [Bacillus anthracis (taxid:1392)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_1326 BA_1326 "maoC family protein" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NGH7 RPP14 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q81RV8 BAS1790 "MaoC family protein" [Bacillus anthracis (taxid:1392)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_1929 BA_1929 "maoC family protein" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0281965 DDB_G0281965 [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|P86397 RPP14 "Hydroxyacyl-thioester dehydratase type 2, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0C3X3 HNE_0843 "MaoC domain protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		158
cd03449		128	cd03449, R_hydratase, (R)-hydratase [(R)-specific	1e-42
cd03441		127	cd03441, R_hydratase_like, (R)-hydratase [(R)-spec	2e-32
PRK08190		466	PRK08190, PRK08190, bifunctional enoyl-CoA hydrata	8e-20
pfam01575		123	pfam01575, MaoC_dehydratas, MaoC like domain	8e-17
COG2030		159	COG2030, MaoC, Acyl dehydratase [Lipid metabolism]	2e-15
cd03453		127	cd03453, SAV4209_like, SAV4209_like	5e-13
cd03446		140	cd03446, MaoC_like, MoaC_like Similar to the MaoC	1e-12
PRK13693		142	PRK13693, PRK13693, (3R)-hydroxyacyl-ACP dehydrata	3e-11
cd03451		146	cd03451, FkbR2, FkbR2 is a Streptomyces hygroscopi	2e-10
cd03452		142	cd03452, MaoC_C, MaoC_C The C-terminal hot dog fol	1e-09
cd03455		123	cd03455, SAV4209, SAV4209 is a Streptomyces avermi	9e-08
cd03447		126	cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog	4e-07
PRK11563		675	PRK11563, PRK11563, bifunctional aldehyde dehydrog	1e-06
cd03440		100	cd03440, hot_dog, The hotdog fold was initially id	8e-06
TIGR02278		663	TIGR02278, PaaN-DH, phenylacetic acid degradation	1e-05
pfam13452		132	pfam13452, zf-MaoC, Metal-binding domain of MaoC d	0.003

>gnl\|CDD\|239533 cd03449, R_hydratase, (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway	Back alignment and domain information

 Score =  137 bits (347), Expect = 1e-42
 Identities = 50/126 (39%), Positives = 70/126 (55%), Gaps = 4/126 (3%)

Query: 25  LKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQI 84
           LK GD    TR  + EDV  ++++S D NP+H + E A+   F  R+ HGML AS+   +
Sbjct: 1   LKVGDSASLTRTITEEDVELFAELSGDFNPIHLDEEYAKKTRFGGRIAHGMLTASLISAV 60

Query: 85  ISSHFP--GAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELL 142
           + +  P  G +Y+SQSL F  PV+IGD V   +     RE KKR  V   T C      +
Sbjct: 61  LGTLLPGPGTIYLSQSLRFLRPVFIGDTVTATVTVTEKREDKKR--VTLETVCTNQNGEV 118

Query: 143 VLDGEA 148
           V++GEA
Sbjct: 119 VIEGEA 124

(R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit. The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer. A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain. Length = 128

>gnl\|CDD\|239525 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase]	Back alignment and domain information

>gnl\|CDD\|236180 PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated	Back alignment and domain information

>gnl\|CDD\|216580 pfam01575, MaoC_dehydratas, MaoC like domain	Back alignment and domain information

>gnl\|CDD\|224941 COG2030, MaoC, Acyl dehydratase [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|239537 cd03453, SAV4209_like, SAV4209_like	Back alignment and domain information

>gnl\|CDD\|239530 cd03446, MaoC_like, MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain	Back alignment and domain information

>gnl\|CDD\|184249 PRK13693, PRK13693, (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional	Back alignment and domain information

>gnl\|CDD\|239535 cd03451, FkbR2, FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes	Back alignment and domain information

>gnl\|CDD\|239536 cd03452, MaoC_C, MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein	Back alignment and domain information

>gnl\|CDD\|239539 cd03455, SAV4209, SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit	Back alignment and domain information

>gnl\|CDD\|239531 cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit	Back alignment and domain information

>gnl\|CDD\|236931 PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E	Back alignment and domain information

>gnl\|CDD\|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN	Back alignment and domain information

>gnl\|CDD\|222140 pfam13452, zf-MaoC, Metal-binding domain of MaoC dehydratase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		158
cd03452		142	MaoC_C MaoC_C The C-terminal hot dog fold of the M	100.0
cd03453		127	SAV4209_like SAV4209_like. Similar in sequence to	100.0
cd03451		146	FkbR2 FkbR2 is a Streptomyces hygroscopicus protei	100.0
cd03446		140	MaoC_like MoaC_like Similar to the MaoC (monoamine	100.0
cd03449		128	R_hydratase (R)-hydratase [(R)-specific enoyl-CoA	99.97
cd03455		123	SAV4209 SAV4209 is a Streptomyces avermitilis prot	99.97
cd03454		140	YdeM YdeM is a Bacillus subtilis protein that belo	99.97
PRK13693		142	(3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro	99.97
COG2030		159	MaoC Acyl dehydratase [Lipid metabolism]	99.97
PRK08190		466	bifunctional enoyl-CoA hydratase/phosphate acetylt	99.97
cd03447		126	FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t	99.97
PRK13691		166	(3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro	99.96
PRK13692		159	(3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro	99.96
cd03441		127	R_hydratase_like (R)-hydratase [(R)-specific enoyl	99.96
TIGR02278		663	PaaN-DH phenylacetic acid degradation protein paaN	99.95
PRK11563		675	bifunctional aldehyde dehydrogenase/enoyl-CoA hydr	99.95
cd03450		149	NodN NodN (nodulation factor N) contains a single	99.95
PF01575		122	MaoC_dehydratas: MaoC like domain; InterPro: IPR00	99.94
PLN02864		310	enoyl-CoA hydratase	99.89
cd03448		122	HDE_HSD HDE_HSD The R-hydratase-like hot dog fold	99.89
PF13452		132	MaoC_dehydrat_N: N-terminal half of MaoC dehydrata	99.86
KOG1206		272	consensus Peroxisomal multifunctional beta-oxidati	99.81
PLN02864		310	enoyl-CoA hydratase	99.34
PRK00006		147	fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review	99.16
PRK04424		185	fatty acid biosynthesis transcriptional regulator;	99.14
COG3777		273	Uncharacterized conserved protein [Function unknow	99.08
cd01288		131	FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier	99.05
PRK13188		464	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl	98.91
TIGR02286		114	PaaD phenylacetic acid degradation protein PaaD. S	98.83
TIGR01750		140	fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd	98.81
cd00493		131	FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr	98.6
COG2050		141	PaaI HGG motif-containing thioesterase, possibly i	98.47
PF03061		79	4HBT: Thioesterase superfamily; InterPro: IPR00668	98.44
PRK10293		136	acyl-CoA esterase; Provisional	98.44
PRK10254		137	thioesterase; Provisional	98.43
cd03440		100	hot_dog The hotdog fold was initially identified i	98.4
PRK11688		154	hypothetical protein; Provisional	98.39
TIGR00369		117	unchar_dom_1 uncharacterized domain 1. Most protei	98.37
cd03443		113	PaaI_thioesterase PaaI_thioesterase is a tetrameri	98.37
cd01287		150	FabA FabA, beta-hydroxydecanoyl-acyl carrier prote	98.25
PF07977		138	FabA: FabA-like domain; InterPro: IPR013114 Fatty	98.22
PLN02322		154	acyl-CoA thioesterase	98.19
COG0764		147	FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca	98.19
cd03442		123	BFIT_BACH Brown fat-inducible thioesterase (BFIT).	98.12
cd00556		99	Thioesterase_II Thioesterase II (TEII) is thought	98.08
cd00586		110	4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat	98.07
cd01289		138	FabA_like Domain of unknown function, appears to b	98.02
PRK05174		172	3-hydroxydecanoyl-(acyl carrier protein) dehydrata	98.0
TIGR01749		169	fabA beta-hydroxyacyl-[acyl carrier protein] dehyd	97.92
PRK10800		130	acyl-CoA thioesterase YbgC; Provisional	97.92
cd03445		94	Thioesterase_II_repeat2 Thioesterase II (TEII) is	97.69
COG0824		137	FcbC Predicted thioesterase [General function pred	97.58
TIGR02799		126	thio_ybgC tol-pal system-associated acyl-CoA thioe	97.47
COG1607		157	Acyl-CoA hydrolase [Lipid metabolism]	97.46
PF13622		255	4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A	97.44
COG5496		130	Predicted thioesterase [General function predictio	97.28
TIGR00051		117	acyl-CoA thioester hydrolase, YbgC/YbaW family. Th	97.27
PF12119		218	DUF3581: Protein of unknown function (DUF3581); In	97.26
PRK10694		133	acyl-CoA esterase; Provisional	97.25
TIGR02447		138	yiiD_Cterm thioesterase domain, putative. This fam	97.2
PF13279		121	4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E	97.17
TIGR00189		271	tesB acyl-CoA thioesterase II. Subunit: homotetram	96.94
KOG3328		148	consensus HGG motif-containing thioesterase [Gener	96.8
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	96.69
PRK10526		286	acyl-CoA thioesterase II; Provisional	96.67
PF14539		132	DUF4442: Domain of unknown function (DUF4442); PDB	96.06
PLN02647		437	acyl-CoA thioesterase	95.77
PLN02370		419	acyl-ACP thioesterase	95.09
PLN02868		413	acyl-CoA thioesterase family protein	94.35
PF01643		261	Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0	94.32
PF03756		132	AfsA: A-factor biosynthesis hotdog domain; InterPr	93.9
COG1946		289	TesB Acyl-CoA thioesterase [Lipid metabolism]	93.44
PLN02647		437	acyl-CoA thioesterase	93.34
PF14765		295	PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_	92.98
PF09500		144	YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In	92.13
COG3777		273	Uncharacterized conserved protein [Function unknow	91.45
cd03444		104	Thioesterase_II_repeat1 Thioesterase II (TEII) is	90.22
KOG4781		237	consensus Uncharacterized conserved protein [Funct	89.34
PF02551		131	Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP	89.29
KOG3016		294	consensus Acyl-CoA thioesterase [Lipid transport a	87.48
COG1946		289	TesB Acyl-CoA thioesterase [Lipid metabolism]	85.02
PF01643		261	Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0	84.64
PRK10526		286	acyl-CoA thioesterase II; Provisional	83.73
PF13622		255	4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A	82.54
PF14765		295	PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_	82.45
TIGR00189		271	tesB acyl-CoA thioesterase II. Subunit: homotetram	80.63

>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein	Back alignment and domain information

Probab=100.00  E-value=4.4e-34  Score=203.42  Aligned_cols=132  Identities=23%  Similarity=0.370  Sum_probs=120.1

Q ss_pred             cccCCcEEe-eeEeeCHHHHHHHHhhcCCCCCcCCCHHHHhhCCCCCceechhhHHHHHHHHhhccCCCee---EEEEEE
Q 031503           24 ILKTGDILR-QTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFPGAV---YVSQSL   99 (158)
Q Consensus        24 dl~vG~~~~-~~~~vt~~~~~~fa~~sgD~npiH~D~~~A~~~g~~~~i~~G~~~~a~~~~~~~~~~~g~~---~~~~~~   99 (158)
                      |+++|++++ ..+++|++++..||.++||+||+|+|++||++++|+++|+||+++++++.+++..+.++..   ++.+++
T Consensus         4 d~~vG~~~~~~~~tvt~~~i~~Fa~~tgD~nPiH~D~e~A~~~~fg~~ia~G~l~~s~~~~l~~~~~~~~~~~~~g~~~~   83 (142)
T cd03452           4 QLRPGDSLLTHRRTVTEADIVNFACLTGDHFYAHMDEIAAKASFFGKRVAHGYFVLSAAAGLFVDPAPGPVLANYGLENL   83 (142)
T ss_pred             ccCCCCEEeeCCEEEcHHHHHHHHHhhCCCCccccCHHHHhhCCCCCeeecHHHHHHHHhhhCccCCcccEEEEeccceE
Confidence            799999997 7889999999999999999999999999999999999999999999999998876666543   456899


Q ss_pred             EEcCCcccCCEEEEEEEEEEEEecC--CeeEEEEEEEEEecCCcEEEEEEEEEEeecC
Q 031503          100 HFRLPVYIGDEVLGQLQAVNVREMK--KRYLVKFSTKCIKNGELLVLDGEAMAFLPSL  155 (158)
Q Consensus       100 rf~~Pv~~Gd~l~~~~~v~~~~~~~--~~~~v~~~~~~~n~~g~~v~~g~~~~~~~~~  155 (158)
                      +|++||++||+|+++.+|.++++++  +.+.+++++++.||+|++|++++.+++++++
T Consensus        84 rf~~PV~~GDtl~~~~~V~~~~~~~~~~~~~v~~~~~~~nq~g~~V~~~~~~~~~~~~  141 (142)
T cd03452          84 RFLEPVYPGDTIQVRLTCKRKIPRDGQDYGVVRWDAEVTNQNGELVASYDILTLVAKK  141 (142)
T ss_pred             EECCCCCCCCEEEEEEEEEEEeecCCCCcEEEEEEEEEEecCCCEEEEEEehHeeEec
Confidence            9999999999999999999998654  2478999999999999999999999998875

Orthologs of MaoC include PaaZ [Escherichia coli] and PaaN [Pseudomonas putida], which are putative ring-opening enzymes involved in phenylacetic acid degradation. The C-terminal domain of MaoC has sequence similarity to (R)-specific enoyl-CoA hydratase,Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. MaoC also has an N-terminal PutA domain like that found in the E. coli PutA proline dehydrogenase and other members of the aldehyde dehydrogenase family.

>cd03453 SAV4209_like SAV4209_like	Back alignment and domain information

>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes	Back alignment and domain information

>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain	Back alignment and domain information

>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway	Back alignment and domain information

>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit	Back alignment and domain information

>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function	Back alignment and domain information

>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional	Back alignment and domain information

>COG2030 MaoC Acyl dehydratase [Lipid metabolism]	Back alignment and domain information

>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated	Back alignment and domain information

>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit	Back alignment and domain information

>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional	Back alignment and domain information

>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional	Back alignment and domain information

>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase]	Back alignment and domain information

>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN	Back alignment and domain information

>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional	Back alignment and domain information

>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit	Back alignment and domain information

>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes	Back alignment and domain information

>PLN02864 enoyl-CoA hydratase	Back alignment and domain information

>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins	Back alignment and domain information

>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A	Back alignment and domain information

>KOG1206 consensus Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism]	Back alignment and domain information

>PLN02864 enoyl-CoA hydratase	Back alignment and domain information

>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed	Back alignment and domain information

>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional	Back alignment and domain information

>COG3777 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway	Back alignment and domain information

>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed	Back alignment and domain information

>TIGR02286 PaaD phenylacetic acid degradation protein PaaD	Back alignment and domain information

>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ	Back alignment and domain information

>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation	Back alignment and domain information

>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases	Back alignment and domain information

>PRK10293 acyl-CoA esterase; Provisional	Back alignment and domain information

>PRK10254 thioesterase; Provisional	Back alignment and domain information

>cd03440 hot_dog The hotdog fold was initially identified in the E	Back alignment and domain information

>PRK11688 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00369 unchar_dom_1 uncharacterized domain 1	Back alignment and domain information

>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria	Back alignment and domain information

>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site	Back alignment and domain information

>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes []

Back alignment and domain information

>PLN02322 acyl-CoA thioesterase	Back alignment and domain information

>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism]	Back alignment and domain information

>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT)	Back alignment and domain information

>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively	Back alignment and domain information

>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT)	Back alignment and domain information

>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ)	Back alignment and domain information

>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated	Back alignment and domain information

>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA	Back alignment and domain information

>PRK10800 acyl-CoA thioesterase YbgC; Provisional	Back alignment and domain information

>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively	Back alignment and domain information

>COG0824 FcbC Predicted thioesterase [General function prediction only]	Back alignment and domain information

>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase	Back alignment and domain information

>COG1607 Acyl-CoA hydrolase [Lipid metabolism]	Back alignment and domain information

>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B	Back alignment and domain information

>COG5496 Predicted thioesterase [General function prediction only]	Back alignment and domain information

>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family	Back alignment and domain information

>PF12119 DUF3581: Protein of unknown function (DUF3581); InterPro: IPR021974 This family consists of uncharacterised bacterial proteins	Back alignment and domain information

>PRK10694 acyl-CoA esterase; Provisional	Back alignment and domain information

>TIGR02447 yiiD_Cterm thioesterase domain, putative	Back alignment and domain information

>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A	Back alignment and domain information

>TIGR00189 tesB acyl-CoA thioesterase II	Back alignment and domain information

>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only]	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>PRK10526 acyl-CoA thioesterase II; Provisional	Back alignment and domain information

>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B	Back alignment and domain information

>PLN02647 acyl-CoA thioesterase	Back alignment and domain information

>PLN02370 acyl-ACP thioesterase	Back alignment and domain information

>PLN02868 acyl-CoA thioesterase family protein	Back alignment and domain information

>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid []	Back alignment and domain information

>PF03756 AfsA: A-factor biosynthesis hotdog domain; InterPro: IPR005509 The AfsA family are key enzymes in A-factor biosynthesis, which is essential for streptomycin production and resistance	Back alignment and domain information

>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism]	Back alignment and domain information

>PLN02647 acyl-CoA thioesterase	Back alignment and domain information

>PF14765 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_D 3KG9_A 3KG8_B 3HRR_A 3HRQ_A 3EL6_A 3KG6_B 2VZ8_A 2VZ9_A	Back alignment and domain information

>PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein	Back alignment and domain information

>COG3777 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively	Back alignment and domain information

>KOG4781 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH)	Back alignment and domain information

>KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism]	Back alignment and domain information

>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism]	Back alignment and domain information

>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid []	Back alignment and domain information

>PRK10526 acyl-CoA thioesterase II; Provisional	Back alignment and domain information

>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B	Back alignment and domain information

>PF14765 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_D 3KG9_A 3KG8_B 3HRR_A 3HRQ_A 3EL6_A 3KG6_B 2VZ8_A 2VZ9_A	Back alignment and domain information

>TIGR00189 tesB acyl-CoA thioesterase II	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		158
1iq6_A		134	(R)-Hydratase From A. Caviae Involved In Pha Biosyn		3e-18
3ir3_A		148	Crystal Structure Of Human 3-Hydroxyacyl-Thioester		2e-14
2b3m_A		159	Crystal Structure Of Protein Af1124 From Archaeoglo		3e-09

>pdb|1IQ6|A Chain A, (R)-Hydratase From A. Caviae Involved In Pha Biosynthesis Length = 134

Back alignment and structure

Iteration: 1

Score = 87.4 bits (215), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 4/131 (3%) Query: 25 LKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQI 84 L+ G R ++ F + +V ++ +S D NPLH + A F+ +VHGML+AS+F + Sbjct: 6 LEVGQKARLSKRFGAAEVAAFAALSEDFNPLHLDPAFAATTAFERPIVHGMLLASLFSGL 65 Query: 85 ISSHFP--GAVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELL 142 + P G++Y+ QSL F+LPV++GDEV +++ +RE K + +T+ G L Sbjct: 66 LGQQLPGKGSIYLGQSLSFKLPVFVGDEVTAEVEVTALREDKP--IATLTTRIFTQGGAL 123 Query: 143 VLDGEAMAFLP 153 + GEA+ LP Sbjct: 124 AVTGEAVVKLP 134

PyMOL of 1iq6

>pdb|3IR3|A Chain A, Crystal Structure Of Human 3-Hydroxyacyl-Thioester Dehydratase 2 (Htd2) Length = 148

Back alignment and structure

>pdb|2B3M|A Chain A, Crystal Structure Of Protein Af1124 From Archaeoglobus Fulgidus Length = 159

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		158
3ir3_A		148	HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc	6e-38
1iq6_A		134	(R)-hydratase, (R)-specific enoyl-COA hydratase; p	1e-37
2b3n_A		159	Hypothetical protein AF1124; structural genomics,	2e-35
4ffu_A		176	Oxidase; structural genomics, protein structure in	6e-23
1q6w_A		161	Monoamine oxidase regulatory protein, putative; st	3e-21
3exz_A		154	MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A	2e-19
4e3e_A		352	MAOC domain protein dehydratase; structural genomi	5e-15
4e3e_A		352	MAOC domain protein dehydratase; structural genomi	2e-14
2c2i_A		151	RV0130; hotdog, hydratase, lyase, structural prote	9e-15
1pn2_A		280	Peroxisomal hydratase-dehydrogenase-epimerase; hot	3e-14
1s9c_A		298	Peroxisomal multifunctional enzyme type 2; hot-DOG	7e-14
3kh8_A		332	MAOC-like dehydratase; hot DOG domain, lyase; 2.00	2e-13
2bi0_A		337	Hypothetical protein RV0216; conserved hypothetica	6e-13
2bi0_A		337	Hypothetical protein RV0216; conserved hypothetica	2e-04
2uva_G		2060	Fatty acid synthase beta subunits; fungal, dehydra	5e-11
2uv8_G		2051	Fatty acid synthase subunit beta (FAS1); fatty aci	2e-09
3khp_A		311	MAOC family protein; dehydrogenase, oxidoreductase	2e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-05

>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Length = 148	Back alignment and structure

 Score =  125 bits (317), Expect = 6e-38
 Identities = 39/143 (27%), Positives = 74/143 (51%), Gaps = 8/143 (5%)

Query: 14  LRYFSSLEPRILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVH 73
           L++F  +    +K GD     R F+  DV  +S+++ D NPLH N + A++  F + +VH
Sbjct: 8   LQHFQHMH---IKVGDRAELRRAFTQTDVATFSELTGDVNPLHLNEDFAKHTKFGNTIVH 64

Query: 74  GMLVASMFPQIISSHFPG--AVYVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKF 131
           G+L+  +   ++ +  PG   V++SQ + F  P+YIG+ VL   +   ++       +  
Sbjct: 65  GVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKLKRFIAI--IAV 122

Query: 132 STKCIKNGELLVLDGEAMAFLPS 154
           S   I++ +  V++G     +P 
Sbjct: 123 SCSVIESKK-TVMEGWVKVMVPE 144

PyMOL of 3ir3

>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Length = 134	Back alignment and structure

>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} SCOP: d.38.1.4 PDB: 2b3m_A 3k67_A Length = 159	Back alignment and structure

>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Length = 176	Back alignment and structure

>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Length = 161	Back alignment and structure

>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Length = 154	Back alignment and structure

>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Length = 352	Back alignment and structure

>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Length = 352	Back alignment and structure

>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Length = 151	Back alignment and structure

>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280	Back alignment and structure

>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Length = 298	Back alignment and structure

>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332	Back alignment and structure

>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Length = 337	Back alignment and structure

>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Length = 337	Back alignment and structure

>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Length = 2060	Back alignment and structure

>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Length = 2051	Back alignment and structure

>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Length = 311	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		158
3exz_A		154	MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A	100.0
4ffu_A		176	Oxidase; structural genomics, protein structure in	100.0
3k67_A		159	Putative dehydratase AF1124; hypothetical protein	100.0
3ir3_A		148	HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc	100.0
1iq6_A		134	(R)-hydratase, (R)-specific enoyl-COA hydratase; p	100.0
2b3n_A		159	Hypothetical protein AF1124; structural genomics,	100.0
1q6w_A		161	Monoamine oxidase regulatory protein, putative; st	100.0
2c2i_A		151	RV0130; hotdog, hydratase, lyase, structural prote	99.97
4e3e_A		352	MAOC domain protein dehydratase; structural genomi	99.97
2bi0_A		337	Hypothetical protein RV0216; conserved hypothetica	99.96
4e3e_A		352	MAOC domain protein dehydratase; structural genomi	99.96
3khp_A		311	MAOC family protein; dehydrogenase, oxidoreductase	99.9
3kh8_A		332	MAOC-like dehydratase; hot DOG domain, lyase; 2.00	99.89
1s9c_A		298	Peroxisomal multifunctional enzyme type 2; hot-DOG	99.88
1pn2_A		280	Peroxisomal hydratase-dehydrogenase-epimerase; hot	99.87
2bi0_A		337	Hypothetical protein RV0216; conserved hypothetica	99.85
3oml_A		613	GH14720P, peroxisomal multifunctional enzyme type	99.84
3zen_D		3089	Fatty acid synthase; transferase, mycolic acid bio	99.77
2uv8_G		2051	Fatty acid synthase subunit beta (FAS1); fatty aci	99.74
2uva_G		2060	Fatty acid synthase beta subunits; fungal, dehydra	99.66
1s9c_A		298	Peroxisomal multifunctional enzyme type 2; hot-DOG	99.47
2f41_A		121	Transcription factor FAPR; 'HOT-DOG' fold, gene re	99.47
3khp_A		311	MAOC family protein; dehydrogenase, oxidoreductase	99.42
2cwz_A		141	Thioesterase family protein; structural genomics,	99.41
1z6b_A		154	Pffabz, fatty acid synthesis protein; malaria, bet	99.4
2ov9_A		216	Hypothetical protein; rhodococcus SP. RHA1, RHA085	99.3
2f3x_A		157	Transcription factor FAPR; 'HOT-DOG' fold / malony	99.3
3d6x_A		146	(3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY;	99.28
1ixl_A		131	Hypothetical protein PH1136; alpha+beta, hot-DOG-f	99.26
3bnv_A		152	CJ0977; virulence factor, hot-DOG fold, flagel unk	99.22
1u1z_A		168	(3R)-hydroxymyristoyl-[acyl carrier protein] dehyd	99.21
1pn2_A		280	Peroxisomal hydratase-dehydrogenase-epimerase; hot	99.2
3lw3_A		145	HP0420 homologue; hotdog-fold, structural genomics	99.16
2gll_A		171	FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d	99.16
3kh8_A		332	MAOC-like dehydratase; hot DOG domain, lyase; 2.00	99.15
2fs2_A		151	Phenylacetic acid degradation protein PAAI; operon	99.07
2uv8_G		2051	Fatty acid synthase subunit beta (FAS1); fatty aci	99.01
3qoo_A		138	Uncharacterized protein; structural genomics, PSI-	99.01
3lbe_A		163	Putative uncharacterized protein SMU.793; hypothet	98.95
4i82_A		137	Putative uncharacterized protein; PAAI/YDII-like,	98.94
2uva_G		2060	Fatty acid synthase beta subunits; fungal, dehydra	98.93
2hbo_A		158	Hypothetical protein (NP_422103.1); thioesterase/t	98.9
2qwz_A		159	Phenylacetic acid degradation-related protein; put	98.89
4h4g_A		160	(3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY;	98.87
2h4u_A		145	Thioesterase superfamily member 2; structural geno	98.87
1vh5_A		148	Hypothetical protein YDII; PSI, protein structure	98.84
3f5o_A		148	Thioesterase superfamily member 2; hotdog fold, hy	98.84
3dkz_A		142	Thioesterase superfamily protein; Q7W9W5, borpa, P	98.82
4i83_A		152	3-hydroxyacyl-[acyl-carrier-protein] dehydratase;	98.78
1wlu_A		136	PAAI protein, phenylacetic acid degradation protei	98.77
1q4t_A		151	Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A	98.77
4ae7_A		220	Thioesterase superfamily member 5; hydrolase, hotd	98.76
3nwz_A		176	BH2602 protein; structural genomics, PSI-biology,	98.74
2pim_A		141	Phenylacetic acid degradation-related protein; thi	98.74
2prx_A		160	Thioesterase superfamily protein; ZP_00837258.1, s	98.74
1vh9_A		149	P15, hypothetical protein YBDB; structural genomic	98.73
4a0z_A		190	Transcription factor FAPR; lipid homeostasis; HET:	98.73
3f1t_A		148	Uncharacterized protein Q9I3C8_pseae; PAR319A, NES	98.72
3e29_A		144	Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG,	98.72
1o0i_A		138	Hypothetical protein HI1161; structural genomics,	98.66
3kuv_A		139	Fluoroacetyl coenzyme A thioesterase; fluoroacetyl	98.66
3s4k_A		144	Putative esterase RV1847/MT1895; seattle structura	98.65
4ae8_A		211	Thioesterase superfamily member 4; hydrolase, hotd	98.64
3oml_A		613	GH14720P, peroxisomal multifunctional enzyme type	98.63
3e8p_A		164	Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG	98.59
1sc0_A		138	Hypothetical protein HI1161; structural genomics,	98.58
3zen_D		3089	Fatty acid synthase; transferase, mycolic acid bio	98.58
3gek_A		146	Putative thioesterase YHDA; structure genomics, NE	98.57
1sh8_A		154	Hypothetical protein PA5026; structural genomics,	98.53
3e1e_A		141	Thioesterase family protein; structural genomics,	98.52
3hdu_A		157	Putative thioesterase; structural genomics, joint	98.49
1zki_A		133	Hypothetical protein PA5202; structural genomics,	98.47
3esi_A		129	Uncharacterized protein; protein from erwinia caro	98.27
3d6l_A		137	Putative hydrolase; hot DOG fold, thioesterase, ac	98.27
2cf2_C		342	Fatty acid synthase, DH domain; transferase, fatty	98.25
3bjk_A		153	Acyl-COA thioester hydrolase HI0827; hotdog fold,	98.24
4b0b_A		171	3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat;	98.24
3q62_A		175	3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat;	98.18
1yoc_A		147	Hypothetical protein PA1835; structural genomics,	98.11
2eis_A		133	Hypothetical protein TTHB207; COA binding motif, N	98.1
4b8u_A		171	3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat;	98.01
2q2b_A		179	Cytosolic acyl coenzyme A thioester hydrolase; ACO	97.95
4ien_A		163	Putative acyl-COA hydrolase; hot DOG fold; HET: CO	97.93
3bbj_A		272	Putative thioesterase II; structural genomics, joi	97.91
2cye_A		133	TTHA1846, putative thioesterase; structural genomi	97.9
2qq2_A		193	Cytosolic acyl coenzyme A thioester hydrolase; ACO	97.89
2q78_A		153	Uncharacterized protein; structural genomics, join	97.89
2egj_A		128	Hypothetical protein AQ_1494; structural genomics;	97.88
2oiw_A		136	Putative 4-hydroxybenzoyl-COA thioesterase; struct	97.87
1y7u_A		174	Acyl-COA hydrolase; structural genomics, coenzyme	97.78
2fuj_A		137	Conserved hypothetical protein; structural genomic	97.76
2hlj_A		157	Hypothetical protein; putative thioesterase, struc	97.76
3ck1_A		150	Putative thioesterase; structural genomics, joint	97.75
2v1o_A		151	Cytosolic acyl coenzyme A thioester hydrolase; acy	97.73
3r87_A		135	Putative uncharacterized protein; unknown function	97.73
1vpm_A		169	Acyl-COA hydrolase; NP_241664.1, structural genomi	97.72
2xem_A		150	DYNE7, TEBC; biosynthetic protein, polyketide bios	97.71
2w3x_A		147	CALE7; hydrolase, hotdog fold, thioesterase, enedi	97.71
1njk_A		156	Hypothetical protein YBAW; structural genomics, th	97.69
1lo7_A		141	4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c	97.69
1t82_A		155	Hypothetical acetyltransferase; structural genomic	97.68
1s5u_A		138	Protein YBGC; structural genomics, hypothetical pr	97.62
2hx5_A		152	Hypothetical protein; thioesterase/thiol ester deh	97.6
2nuj_A		163	Thioesterase superfamily; YP_509914.1, structural	97.6
2gvh_A		288	AGR_L_2016P; 15159470, acyl-COA hydrolase, structu	97.58
1z54_A		132	Probable thioesterase; hypothetical protein, struc	97.57
4i4j_A		159	ACP-polyene thioesterase; structural genomics, PSI	97.56
2pzh_A		135	Hypothetical protein HP_0496; lipid, acyl-COA, bac	97.53
2cf2_C		342	Fatty acid synthase, DH domain; transferase, fatty	97.51
2ali_A		158	Hypothetical protein PA2801; structural genomics,	97.5
3cjy_A		259	Putative thioesterase; YP_496845.1, structural gen	97.49
3hm0_A		167	Probable thioesterase; niaid, ssgcid, decode, UW,	97.49
2o5u_A		148	Thioesterase; putative thioesterese,, hydrolase; 1	97.48
3b7k_A		333	Acyl-coenzyme A thioesterase 12; hotdog fold, stru	97.46
2oaf_A		151	Thioesterase superfamily; YP_508616.1, structural	97.45
2gf6_A		135	Conserved hypothetical protein; putative thioester	97.43
1tbu_A		118	Peroxisomal acyl-coenzyme A thioester hydrolase 1;	97.37
3rqb_A		275	Uncharacterized protein; structural genomics, PSI-	97.35
1c8u_A		285	Acyl-COA thioesterase II; internal repeats, hydrol	97.31
2ess_A		248	Acyl-ACP thioesterase; NP_810988.1, structural gen	97.21
3u0a_A		285	Acyl-COA thioesterase II TESB2; structural genomic	97.18
2own_A		262	Putative oleoyl-[acyl-carrier protein] thioestera;	97.15
2gvh_A		288	AGR_L_2016P; 15159470, acyl-COA hydrolase, structu	97.14
3b7k_A		333	Acyl-coenzyme A thioesterase 12; hotdog fold, stru	96.98
4gak_A		250	Acyl-ACP thioesterase; MCSG, PSI-biology, structur	96.97
3rd7_A		286	Acyl-COA thioesterase; seattle structur genomics c	96.86
2own_A		262	Putative oleoyl-[acyl-carrier protein] thioestera;	96.37
3lmb_A		165	Uncharacterized protein; protein OLEI01261, unknow	96.03
2ess_A		248	Acyl-ACP thioesterase; NP_810988.1, structural gen	94.63
4gak_A		250	Acyl-ACP thioesterase; MCSG, PSI-biology, structur	91.81
1c8u_A		285	Acyl-COA thioesterase II; internal repeats, hydrol	91.04
3rd7_A		286	Acyl-COA thioesterase; seattle structur genomics c	89.56
3u0a_A		285	Acyl-COA thioesterase II TESB2; structural genomic	89.47
3cjy_A		259	Putative thioesterase; YP_496845.1, structural gen	80.84
3rqb_A		275	Uncharacterized protein; structural genomics, PSI-	80.46
3bbj_A		272	Putative thioesterase II; structural genomics, joi	80.2

>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

Probab=100.00  E-value=4.7e-35  Score=209.87  Aligned_cols=134  Identities=19%  Similarity=0.294  Sum_probs=123.2

Q ss_pred             cccCCcEEe-eeEeeCHHHHHHHHhhcCCCCCcCCCHHHHhhCCCCCceechhhHHHHHH-HHhhccCC--CeeEEE-EE
Q 031503           24 ILKTGDILR-QTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFP-QIISSHFP--GAVYVS-QS   98 (158)
Q Consensus        24 dl~vG~~~~-~~~~vt~~~~~~fa~~sgD~npiH~D~~~A~~~g~~~~i~~G~~~~a~~~-~~~~~~~~--g~~~~~-~~   98 (158)
                      |+++|++++ ..+++|++++..||. +||+||+|+|++||+++||+++|+||+++++++. +++..+++  +.+++. ++
T Consensus         7 d~~vG~~~~~~~~~vt~~~i~~fA~-sgD~npiH~D~~~A~~~gf~~~iahG~~~~~l~~~~~~~~~~~~~~~~~~~~~~   85 (154)
T 3exz_A            7 DLAVGDRFDSARHRVEAAAIKAFAG-EFDPQPFHLDEEAARHSLFGGLAASGWHTAAITMRLLVTSGLPLAQGIIGAGTE   85 (154)
T ss_dssp             GCCTTCEEECCCEECCHHHHHHHHH-HHCCCHHHHCHHHHHTSTTCSCCCCHHHHHHHHHHHHHHTTSCBTTCCCEEEEE
T ss_pred             hcCCCCEEeeCCEEECHHHHHHHHH-cCCCCceEECHHHHhhCCCCCeecChHHHHHHHHhhhhhccccccceEecceeE
Confidence            699999999 699999999999999 9999999999999999999999999999999999 99988886  345554 49


Q ss_pred             EEEcCCcccCCEEEEEEEEEEEEecC---CeeEEEEEEEEEecCCcEEEEEEEEEEeecCCCC
Q 031503           99 LHFRLPVYIGDEVLGQLQAVNVREMK---KRYLVKFSTKCIKNGELLVLDGEAMAFLPSLAME  158 (158)
Q Consensus        99 ~rf~~Pv~~Gd~l~~~~~v~~~~~~~---~~~~v~~~~~~~n~~g~~v~~g~~~~~~~~~~~~  158 (158)
                      ++|.+||++||+|+++++|+++++++   ++++++++++++||+|++|+++++++++++|++|
T Consensus        86 ~rF~~PV~~GD~L~~~~~v~~~~~~~s~~~~~~v~~~~~~~nq~Ge~V~~~~~~~~~~~r~~~  148 (154)
T 3exz_A           86 LSWPNPTRPGDELHVETTVLAITPSKSRPDRAIVTCQSDTLNQRGEVVQRSTAKVVVFRRPLE  148 (154)
T ss_dssp             EECSSCCCTTCEEEEEEEEEEEEECSSCTTEEEEEEEEEEECTTSCEEEEEEEEEEEECCCC-
T ss_pred             EEEcCCCCCCCEEEEEEEEEEEEecccCCCceEEEEEEEEEeCCCCEEEEEEEEEEEEccccc
Confidence            99999999999999999999998753   3678999999999999999999999999999876

PyMOL of 3exz

>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti}	Back alignment and structure

>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A	Back alignment and structure

>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens}	Back alignment and structure

>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4	Back alignment and structure

>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A	Back alignment and structure

>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4	Back alignment and structure

>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4	Back alignment and structure

>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus}	Back alignment and structure

>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4	Back alignment and structure

>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus}	Back alignment and structure

>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV}	Back alignment and structure

>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici}	Back alignment and structure

>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S	Back alignment and structure

>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A*	Back alignment and structure

>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4	Back alignment and structure

>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster}	Back alignment and structure

>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A*	Back alignment and structure

>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*	Back alignment and structure

>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*	Back alignment and structure

>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S	Back alignment and structure

>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5	Back alignment and structure

>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV}	Back alignment and structure

>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7	Back alignment and structure

>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A	Back alignment and structure

>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5	Back alignment and structure

>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5	Back alignment and structure

>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp}	Back alignment and structure

>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5	Back alignment and structure

>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni}	Back alignment and structure

>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6	Back alignment and structure

>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A*	Back alignment and structure

>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A	Back alignment and structure

>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A*	Back alignment and structure

>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici}	Back alignment and structure

>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A	Back alignment and structure

>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*	Back alignment and structure

>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans}	Back alignment and structure

>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A*	Back alignment and structure

>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae}	Back alignment and structure

>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*	Back alignment and structure

>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5	Back alignment and structure

>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP}	Back alignment and structure

>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis}	Back alignment and structure

>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5	Back alignment and structure

>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A	Back alignment and structure

>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A	Back alignment and structure

>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis}	Back alignment and structure

>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis}	Back alignment and structure

>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A	Back alignment and structure

>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A*	Back alignment and structure

>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens}	Back alignment and structure

>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans}	Back alignment and structure

>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134}	Back alignment and structure

>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica}	Back alignment and structure

>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5	Back alignment and structure

>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A	Back alignment and structure

>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa}	Back alignment and structure

>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0	Back alignment and structure

>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A	Back alignment and structure

>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A	Back alignment and structure

>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0	Back alignment and structure

>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A*	Back alignment and structure

>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster}	Back alignment and structure

>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis}	Back alignment and structure

>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A	Back alignment and structure

>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A*	Back alignment and structure

>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp}	Back alignment and structure

>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi}	Back alignment and structure

>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB}	Back alignment and structure

>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum}	Back alignment and structure

>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni}	Back alignment and structure

>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2	Back alignment and structure

>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A*	Back alignment and structure

>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A*	Back alignment and structure

>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A	Back alignment and structure

>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus}	Back alignment and structure

>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa}	Back alignment and structure

>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus}	Back alignment and structure

>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis}	Back alignment and structure

>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca}	Back alignment and structure

>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1	Back alignment and structure

>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens}	Back alignment and structure

>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7	Back alignment and structure

>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A	Back alignment and structure

>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1	Back alignment and structure

>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1	Back alignment and structure

>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1	Back alignment and structure

>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1	Back alignment and structure

>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha}	Back alignment and structure

>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus}	Back alignment and structure

>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum}	Back alignment and structure

>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A	Back alignment and structure

>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A	Back alignment and structure

>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora}	Back alignment and structure

>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1	Back alignment and structure

>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A*	Back alignment and structure

>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5	Back alignment and structure

>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1	Back alignment and structure

>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1	Back alignment and structure

>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1	Back alignment and structure

>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1	Back alignment and structure

>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1	Back alignment and structure

>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus}	Back alignment and structure

>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori}	Back alignment and structure

>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2	Back alignment and structure

>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A	Back alignment and structure

>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans}	Back alignment and structure

>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae}	Back alignment and structure

>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A	Back alignment and structure

>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens}	Back alignment and structure

>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1	Back alignment and structure

>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1	Back alignment and structure

>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3	Back alignment and structure

>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3	Back alignment and structure

>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum}	Back alignment and structure

>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1	Back alignment and structure

>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens}	Back alignment and structure

>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale}	Back alignment and structure

>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium}	Back alignment and structure

>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0	Back alignment and structure

>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale}	Back alignment and structure

>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3	Back alignment and structure

>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium}	Back alignment and structure

>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum}	Back alignment and structure

>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans}	Back alignment and structure

>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		158
d1iq6a_		132	d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Ae	1e-24
d2b3na1		154	d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Ar	5e-21
d1q6wa_		151	d.38.1.4 (A:) Monoamine oxidase regulatory protein	2e-18
d1s9ca1		126	d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain	1e-16
d2bi0a1		178	d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0	1e-15
d2c2ia1		149	d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {My	3e-15
d1pn2a2		124	d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain	1e-13
d2bi0a2		152	d.38.1.4 (A:186-337) Hypothetical protein Rv0216/M	1e-12
d1s9ca2		154	d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain o	7e-11

>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Length = 132	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: MaoC-like
domain: (R)-specific enoyl-CoA hydratase
species: Aeromonas caviae [TaxId: 648]

 Score = 90.2 bits (223), Expect = 1e-24
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 4/131 (3%)

Query: 25  LKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQI 84
           L+ G   R ++ F + +V  ++ +S D NPLH +   A    F+  +VHGML+AS+F  +
Sbjct: 4   LEVGQKARLSKRFGAAEVAAFAALSEDFNPLHLDPAFAATTAFERPIVHGMLLASLFSGL 63

Query: 85  ISSHFPGAV--YVSQSLHFRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELL 142
           +    PG    Y+ QSL F+LPV++GDEV  +++   +RE K       +T+    G  L
Sbjct: 64  LGQQLPGKGSIYLGQSLSFKLPVFVGDEVTAEVEVTALREDKPI--ATLTTRIFTQGGAL 121

Query: 143 VLDGEAMAFLP 153
            + GEA+  LP
Sbjct: 122 AVTGEAVVKLP 132

PyMOL of d1iq6a_

>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 154	Back information, alignment and structure

>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 151	Back information, alignment and structure

>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 126	Back information, alignment and structure

>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 178	Back information, alignment and structure

>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 149	Back information, alignment and structure

>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 124	Back information, alignment and structure

>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 152	Back information, alignment and structure

>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 154	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		158
d1iq6a_		132	(R)-specific enoyl-CoA hydratase {Aeromonas caviae	100.0
d1q6wa_		151	Monoamine oxidase regulatory protein {Archaeon Arc	100.0
d2b3na1		154	Hypothetical protein AF1124 {Archaeon Archaeoglobu	100.0
d2bi0a1		178	Hypothetical protein Rv0216/MT0226 {Mycobacterium	100.0
d2c2ia1		149	Hypothetical protein Rv0130 {Mycobacterium tubercu	99.97
d2bi0a2		152	Hypothetical protein Rv0216/MT0226 {Mycobacterium	99.94
d1s9ca1		126	2-enoyl-coa hydratase domain of multifunctional pe	99.93
d1pn2a2		124	2-enoyl-coa hydratase domain of multifunctional pe	99.93
d1s9ca2		154	2-enoyl-coa hydratase domain of multifunctional pe	99.66
d2cwza1		138	Hypothetical protein TTHA0967 {Thermus thermophilu	99.65
d1ixla_		130	Hypothetical protein PH1136 {Archaeon Pyrococcus h	99.07
d2f41a1		111	Transcription factor FapR, C-terminal domain {Baci	99.02
d1pn2a1		148	2-enoyl-coa hydratase domain of multifunctional pe	98.91
d1z6ba1		146	(3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria	98.72
d2fs2a1		131	Phenylacetic acid degradation protein PaaI {Escher	98.7
d1u1za_		145	(3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo	98.66
d2ov9a1		203	Hypothetical protein RHA1_ro05818 {Rhodococcus sp.	98.64
d2f0xa1		136	Hypothetical protein Them2 {Human (Homo sapiens) [	98.63
d1wlua1		116	Phenylacetic acid degradation protein PaaI {Thermu	98.62
d2hboa1		142	Hypothetical protein CC3309 {Caulobacter crescentu	98.55
d1sc0a_		137	Hypothetical protein HI1161 {Haemophilus influenza	98.5
d1vh9a_		138	Hypothetical protein YbdB {Escherichia coli [TaxId	98.48
d1q4ua_		140	4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp	98.37
d1vh5a_		138	Hypothetical protein YdiI {Escherichia coli [TaxId	98.32
d1zkia1		126	Hypothetical protein PA5202 {Pseudomonas aeruginos	98.29
d1s5ua_		129	Hypothetical protein YbgC {Escherichia coli [TaxId	97.98
d1mkaa_		171	beta-Hydroxydecanol thiol ester dehydrase {Escheri	97.86
d2essa1		149	Acyl-ACP thioesterase {Bacteroides thetaiotaomicro	97.82
d2owna1		147	Putative oleoyl-ACP thioesterase LP0708 {Lactobaci	97.68
d2gvha2		116	Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter	97.67
d1ylia1		142	Putative acyl-coa thioester hydrolase HI0827 {Haem	97.67
d1njka_		133	Hypothetical protein YbaW {Escherichia coli [TaxId	97.61
d2gvha1		135	Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter	97.55
d2fuja1		118	Hypothetical protein XCC1147 {Xanthomonas campestr	97.53
d1z54a1		132	Probable thioesterase TTHA0908 {Thermus thermophil	97.52
d2cyea1		132	Probable thioesterase TTHA1846 {Thermus thermophil	97.51
d2q78a1		130	Uncharacterized protein TM0581 {Thermotoga maritim	97.51
d2hx5a1		144	Hypothetical protein PMT2055 {Prochlorococcus mari	97.51
d1tbua1		104	Peroxisomal long-chain acyl-CoA thioesterase 1, TE	97.49
d2oafa1		143	Hypothetical protein Jann0674 {Jannaschia sp. ccs1	97.48
d2oiwa1		131	GK1870 orthologue {Bacillus stearothermophilus [Ta	97.46
d1sh8a_		153	Hypothetical protein PA5026 {Pseudomonas aeruginos	97.45
d1vpma_		155	Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta	97.43
d1lo7a_		140	4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp.	97.41
d2nuja1		159	Hypothetical protein Jann_1972 {Jannaschia sp. CCS	97.39
d1t82a_		143	Putative thioesterase SO4397 {Shewanella oneidensi	97.29
d2o5ua1		139	Hypothetical thioesterase PA5185 {Pseudomonas aeru	97.27
d1y7ua1		164	Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId:	97.27
d2hlja1		156	Hypothetical protein PP0301 {Pseudomonas putida [T	97.17
d2alia1		130	Hypothetical protein PA2801 {Pseudomonas aeruginos	97.11
d2owna2		109	Putative oleoyl-ACP thioesterase LP0708 {Lactobaci	97.11
d1c8ua1		114	Thioesterase II (TesB) {Escherichia coli [TaxId: 5	97.03
d1yoca1		145	Hypothetical protein PA1835 {Pseudomonas aeruginos	96.92
d2gf6a1		134	Hypothetical protein SSO2295 {Archaeon Sulfolobus	96.88
d2essa2		98	Acyl-ACP thioesterase {Bacteroides thetaiotaomicro	96.4
d1c8ua2		171	Thioesterase II (TesB) {Escherichia coli [TaxId: 5	95.45

>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: MaoC-like
domain: (R)-specific enoyl-CoA hydratase
species: Aeromonas caviae [TaxId: 648]

Probab=100.00  E-value=6.1e-36  Score=207.65  Aligned_cols=129  Identities=35%  Similarity=0.705  Sum_probs=121.3

Q ss_pred             CcccCCcEEeeeEeeCHHHHHHHHhhcCCCCCcCCCHHHHhhCCCCCceechhhHHHHHHHHhhccCC--CeeEEEEEEE
Q 031503           23 RILKTGDILRQTRIFSSEDVVEYSKVSHDSNPLHFNSESARNAGFDDRLVHGMLVASMFPQIISSHFP--GAVYVSQSLH  100 (158)
Q Consensus        23 ~dl~vG~~~~~~~~vt~~~~~~fa~~sgD~npiH~D~~~A~~~g~~~~i~~G~~~~a~~~~~~~~~~~--g~~~~~~~~r  100 (158)
                      +||++||++...+++|++++..||.++||+||+|+|++||+..||+++|+||+++++++.+++..+++  +..+.++++|
T Consensus         2 e~l~vG~~~~~~~~it~~di~~fa~~sgD~nPiH~D~~~A~~~g~~~~ia~g~~~~~~~~~~~~~~~~~~~~~~~~~~~r   81 (132)
T d1iq6a_           2 QSLEVGQKARLSKRFGAAEVAAFAALSEDFNPLHLDPAFAATTAFERPIVHGMLLASLFSGLLGQQLPGKGSIYLGQSLS   81 (132)
T ss_dssp             CSCCTTCEEEEEEECCHHHHHHHHHHHTCCCHHHHCHHHHTTSTTCSCBCCHHHHHHHHHHHHHHTSSCTTCEEEEEEEE
T ss_pred             CCCCCCCEEEEEEEECHHHHHHHHHHHCCCCCcEEcHHHHhhcCCCceeeehhhhhhHHhhcchhhcCCCcceeehhhce
Confidence            58999999998899999999999999999999999999999999999999999999999999999886  4667889999


Q ss_pred             EcCCcccCCEEEEEEEEEEEEecCCeeEEEEEEEEEecCCcEEEEEEEEEEee
Q 031503          101 FRLPVYIGDEVLGQLQAVNVREMKKRYLVKFSTKCIKNGELLVLDGEAMAFLP  153 (158)
Q Consensus       101 f~~Pv~~Gd~l~~~~~v~~~~~~~~~~~v~~~~~~~n~~g~~v~~g~~~~~~~  153 (158)
                      |++||++||+|+++++|+++++.  +++++++++++||+|++|++|++++++|
T Consensus        82 f~~Pv~~GDtl~~~~~v~~~~~~--~~~v~~~~~~~nq~g~~V~~g~a~v~~P  132 (132)
T d1iq6a_          82 FKLPVFVGDEVTAEVEVTALRED--KPIATLTTRIFTQGGALAVTGEAVVKLP  132 (132)
T ss_dssp             ECSCCBTTCEEEEEEEEEEECSS--SSEEEEEEEEECTTSCEEEEEEEEEECC
T ss_pred             ecccCCCcCEEEEEEEEEEEEcC--CCEEEEEEEEEECCCCEEEEEEEEEEcC
Confidence            99999999999999999998754  4689999999999999999999999987

PyMOL of d1iq6a_

>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}	Back information, alignment and structure

>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}	Back information, alignment and structure

>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]}	Back information, alignment and structure

>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]}	Back information, alignment and structure

>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]}	Back information, alignment and structure

>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]}	Back information, alignment and structure

>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]}	Back information, alignment and structure

>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]}	Back information, alignment and structure

>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]}	Back information, alignment and structure

>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure