Citrus Sinensis ID: 031514

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MSSREQNKAALYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEASTVENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSEQ
cHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccEEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccc
cccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEEEEccccccccHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHccccccc
MSSREQNKAALYEKLMLLRDvtnstsmnktsIVVDASKYIEELKQQVETLNQeigtseastvenslpvvtvETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDarvscsdrfqleavggdflqhieghadgiDAQVVKEAVLQAIKNVQDSEQ
MSSREQNKAALYEKLMLLrdvtnstsmnktsIVVDASKYIEELKQQVETLNQEigtseastvenslpvVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSEQ
MSSREQNKAALYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEASTVENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSEQ
**********LYEKLMLLRDVTN*****KTSIVVDASKYIEELKQQV**************VENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHIEGHADGIDAQVVKEAVLQAI********
******N***LYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQV****************************KGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGD***************VVKEAVLQ***N******
********AALYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEASTVENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSEQ
*****QNKAALYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEASTVENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDF********DGIDAQVVKEAVLQAIKN******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSREQNKAALYEKLMLLRDVTNSTSMNKTSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxTVENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q9LPW3450 Transcription factor SCRE no no 0.740 0.26 0.276 8e-06
Q9LXA9315 Transcription factor bHLH no no 0.664 0.333 0.322 1e-05
Q9LSE2494 Transcription factor ICE1 no no 0.740 0.236 0.269 0.0003
Q9LSL1351 Transcription factor bHLH no no 0.689 0.310 0.287 0.0008
>sp|Q9LPW3|SCRM2_ARATH Transcription factor SCREAM2 OS=Arabidopsis thaliana GN=SCRM2 PE=1 SV=1 Back     alignment and function desciption
 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 74/152 (48%), Gaps = 35/152 (23%)

Query: 1   MSSREQNKAALYEKLMLLRDVTNSTS-MNKTSIVVDASKYIEELKQQVETLNQEIGTSEA 59
           M+ R + K  L ++L +LR V    S M++ SI+ DA  Y++EL Q++  L+ E+ ++  
Sbjct: 270 MAERRRRKK-LNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQRINDLHTELESTPP 328

Query: 60  ST----------------------VENSLPVVTVE------TLEKGFLINVYLEKNC--- 88
           S+                        +SLP    +       L +G  +N+++   C   
Sbjct: 329 SSSSLHPLTPTPQTLSYRVKEELCPSSSLPSPKGQQPRVEVRLREGKAVNIHMF--CGRR 386

Query: 89  SGLLVSVLEAFEDLGLEVLDARVSCSDRFQLE 120
            GLL+S + A ++LGL+V  A +SC + F L+
Sbjct: 387 PGLLLSTMRALDNLGLDVQQAVISCFNGFALD 418
Mediates stomatal differentiation in the epidermis probably by controlling successive roles of SPCH, MUTE, and FAMA.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LXA9|BH061_ARATH Transcription factor bHLH61 OS=Arabidopsis thaliana GN=BHLH61 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSE2|ICE1_ARATH Transcription factor ICE1 OS=Arabidopsis thaliana GN=SCRM PE=1 SV=1 Back     alignment and function description
>sp|Q9LSL1|BH093_ARATH Transcription factor bHLH93 OS=Arabidopsis thaliana GN=BHLH93 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
359481316156 PREDICTED: transcription factor bHLH61-l 0.974 0.987 0.677 3e-53
356554638156 PREDICTED: uncharacterized protein LOC10 0.955 0.967 0.634 1e-48
351725705156 uncharacterized protein LOC100306253 [Gl 0.955 0.967 0.634 2e-48
356540030157 PREDICTED: uncharacterized protein LOC10 0.981 0.987 0.610 1e-47
224140573146 predicted protein [Populus trichocarpa] 0.886 0.958 0.692 2e-47
351721777152 uncharacterized protein LOC100527466 [Gl 0.917 0.953 0.662 3e-47
359486354158 PREDICTED: transcription factor bHLH61 [ 0.962 0.962 0.635 4e-47
388499228149 unknown [Lotus japonicus] 0.936 0.993 0.627 2e-46
388507236159 unknown [Lotus japonicus] 0.949 0.943 0.636 6e-46
297736527159 unnamed protein product [Vitis vinifera] 0.962 0.955 0.631 8e-46
>gi|359481316|ref|XP_002268100.2| PREDICTED: transcription factor bHLH61-like [Vitis vinifera] gi|297735573|emb|CBI18067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/158 (67%), Positives = 129/158 (81%), Gaps = 4/158 (2%)

Query: 1   MSSREQNKAALYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEAS 60
           MSSR + KAALYEKL LLR VTNS++ +KTSI+VDA+KYIE+LKQ+V+ LNQ++ TS+ S
Sbjct: 1   MSSRGRKKAALYEKLQLLRSVTNSSAHSKTSIIVDATKYIEDLKQKVDRLNQDVATSQFS 60

Query: 61  TVENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLE 120
             +N LPVV VETLE+GFLINV+ E+NC GLLVS+LE FE+LGL VLDARVSCSD F LE
Sbjct: 61  ADQNPLPVVKVETLERGFLINVFSERNCPGLLVSILETFEELGLNVLDARVSCSDSFHLE 120

Query: 121 AVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSEQ 158
           AVGG+     EG  D IDAQVVK+AVLQAIKN  +S +
Sbjct: 121 AVGGEN----EGQQDSIDAQVVKQAVLQAIKNWSESSE 154

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356554638|ref|XP_003545651.1| PREDICTED: uncharacterized protein LOC100797684 [Glycine max] Back     alignment and taxonomy information
>gi|351725705|ref|NP_001236078.1| uncharacterized protein LOC100306253 [Glycine max] gi|255628009|gb|ACU14349.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356540030|ref|XP_003538494.1| PREDICTED: uncharacterized protein LOC100814138 [Glycine max] Back     alignment and taxonomy information
>gi|224140573|ref|XP_002323657.1| predicted protein [Populus trichocarpa] gi|222868287|gb|EEF05418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351721777|ref|NP_001236453.1| uncharacterized protein LOC100527466 [Glycine max] gi|255632416|gb|ACU16558.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359486354|ref|XP_002278871.2| PREDICTED: transcription factor bHLH61 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388499228|gb|AFK37680.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388507236|gb|AFK41684.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297736527|emb|CBI25398.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
UNIPROTKB|Q8LII5157 OJ1167_G06.116 "Putative uncha 0.936 0.942 0.547 8.9e-38
UNIPROTKB|Q5WMQ1153 OSJNBa0053E01.1 "Putative unch 0.936 0.967 0.522 1.2e-35
TAIR|locus:2828302158 AT2G40435 [Arabidopsis thalian 0.924 0.924 0.541 2.4e-35
UNIPROTKB|Q10LR1163 Os03g0338400 "BHLH transcripti 0.930 0.901 0.528 8.3e-35
TAIR|locus:2078411156 AT3G56220 [Arabidopsis thalian 0.955 0.967 0.534 3.2e-33
UNIPROTKB|Q2QYP296 LOC_Os12g02020 "Os12g0111400 p 0.379 0.625 0.540 2.8e-15
TAIR|locus:2142419315 AT5G10570 "AT5G10570" [Arabido 0.759 0.380 0.335 1.9e-08
TAIR|locus:2155725351 bHLH093 "AT5G65640" [Arabidops 0.373 0.168 0.359 8.2e-05
TAIR|locus:2118524518 TT8 "AT4G09820" [Arabidopsis t 0.879 0.268 0.277 0.00023
TAIR|locus:2039094566 AIB "AT2G46510" [Arabidopsis t 0.715 0.199 0.260 0.00026
UNIPROTKB|Q8LII5 OJ1167_G06.116 "Putative uncharacterized protein OJ1167_G06.116" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 8.9e-38, P = 8.9e-38
 Identities = 87/159 (54%), Positives = 118/159 (74%)

Query:     1 MSSREQNKAA-LYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEA 59
             M SRE+ KAA L+EKL +LR +T+S +++ TSI+ DAS+YI+ELKQ+V  LN+EI  +EA
Sbjct:     1 MMSRERKKAAALHEKLQILRSITHSHALSNTSIITDASEYIKELKQKVVRLNKEIACAEA 60

Query:    60 STV-ENSLPVVTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQ 118
             + + +NS+P VTVETL  GFLINV+ +K+C GLLVS+LEAF++LGL VL+A  SC D F+
Sbjct:    61 AALRQNSIPTVTVETLGHGFLINVFSDKSCPGLLVSILEAFDELGLNVLEATASCDDTFR 120

Query:   119 LEAVGGDFLQHIEGHADGIDAQVVKEAVLQAIKNVQDSE 157
             LEAVGG+         + +D  V+K+ VLQAI N   SE
Sbjct:   121 LEAVGGE---------NQVDEHVIKQTVLQAISNSNCSE 150
GO:0005634 "nucleus" evidence=IC
UNIPROTKB|Q5WMQ1 OSJNBa0053E01.1 "Putative uncharacterized protein OSJNBa0053E01.1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2828302 AT2G40435 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q10LR1 Os03g0338400 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2078411 AT3G56220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QYP2 LOC_Os12g02020 "Os12g0111400 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2142419 AT5G10570 "AT5G10570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155725 bHLH093 "AT5G65640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118524 TT8 "AT4G09820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039094 AIB "AT2G46510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
smart0035353 HLH helix loop helix domain. 99.41
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.32
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.22
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.59
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.57
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.54
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.53
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.41
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.24
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.23
KOG1318411 consensus Helix loop helix transcription factor EB 98.16
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.94
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 97.94
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.94
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.87
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.63
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.62
PRK05007884 PII uridylyl-transferase; Provisional 97.6
PRK04374869 PII uridylyl-transferase; Provisional 97.55
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.47
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.44
PRK03381774 PII uridylyl-transferase; Provisional 97.42
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.34
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.33
PRK03381774 PII uridylyl-transferase; Provisional 97.3
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.3
PRK05092931 PII uridylyl-transferase; Provisional 97.25
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.21
PRK05007 884 PII uridylyl-transferase; Provisional 97.14
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 97.12
KOG0561 373 consensus bHLH transcription factor [Transcription 97.04
PRK03059856 PII uridylyl-transferase; Provisional 97.01
PRK03059856 PII uridylyl-transferase; Provisional 96.99
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.93
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 96.87
PRK00275 895 glnD PII uridylyl-transferase; Provisional 96.86
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 96.81
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.81
PRK0019490 hypothetical protein; Validated 96.72
PRK05092 931 PII uridylyl-transferase; Provisional 96.67
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 96.62
PRK04374 869 PII uridylyl-transferase; Provisional 96.51
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.47
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.46
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.43
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.17
KOG4029228 consensus Transcription factor HAND2/Transcription 96.13
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.7
PLN0321793 transcription factor ATBS1; Provisional 95.67
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 95.47
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 95.39
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 94.92
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 94.81
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 94.81
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 94.6
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 94.5
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 94.32
PRK04435147 hypothetical protein; Provisional 93.94
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 93.91
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 93.9
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 93.7
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 93.65
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.62
cd0211660 ACT ACT domains are commonly involved in specifica 93.54
PRK08577136 hypothetical protein; Provisional 93.5
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 93.32
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 93.26
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 93.22
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 92.87
COG383090 ACT domain-containing protein [Signal transduction 92.54
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 92.31
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 91.98
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 91.89
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 91.87
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 91.85
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 91.36
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 91.34
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 91.28
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 91.2
PRK11589 190 gcvR glycine cleavage system transcriptional repre 90.62
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 90.49
PRK00227693 glnD PII uridylyl-transferase; Provisional 90.46
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 90.0
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 89.01
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 88.69
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 88.58
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 87.52
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 87.48
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal 86.62
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 86.59
PRK07334403 threonine dehydratase; Provisional 86.5
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 86.32
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 85.49
PRK11589190 gcvR glycine cleavage system transcriptional repre 84.65
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 84.37
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 83.71
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 83.45
KOG4447173 consensus Transcription factor TWIST [Transcriptio 83.27
CHL00100174 ilvH acetohydroxyacid synthase small subunit 82.72
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 82.54
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 81.99
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 81.74
>smart00353 HLH helix loop helix domain Back     alignment and domain information 
Probab=99.41  E-value=2.8e-13  Score=85.43  Aligned_cols=47  Identities=19%  Similarity=0.381  Sum_probs=43.1

Q ss_pred             chhHhHHHHHHHhhHHhhcC-CC---CCCCcccchhhHHHHHHHHHHHHHH
Q 031514            2 SSREQNKAALYEKLMLLRDV-TN---STSMNKTSIVVDASKYIEELKQQVE   48 (158)
Q Consensus         2 ~sER~RR~kln~~~~~LRsl-~~---~~K~DKaSIl~dAI~YIk~Lq~~v~   48 (158)
                      ..||+||++||+.|..|+++ |+   ..|+||++||..||+||+.|+.+++
T Consensus         2 ~~Er~RR~~~n~~~~~L~~lip~~~~~~k~~k~~iL~~ai~yi~~L~~~~~   52 (53)
T smart00353        2 ARERRRRRKINEAFDELRSLLPTLPNNKKLSKAEILRLAIEYIKSLQEELQ   52 (53)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHh
Confidence            47999999999999999999 52   6789999999999999999999875

>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 49.1 bits (116), Expect = 1e-07
 Identities = 36/194 (18%), Positives = 72/194 (37%), Gaps = 49/194 (25%)

Query: 3   SREQNKAALYEKLMLLRDVTNST--SMN---KTSIVVDASK-------------YI---- 40
           SR Q    L + L+ LR   N     +    KT + +D                ++    
Sbjct: 132 SRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKN 191

Query: 41  ----EELKQQVETLNQEIGTSEASTVENS----LPVVTVETLEKGFLIN-VYLEKNCSGL 91
               E + + ++ L  +I  +  S  ++S    L + +++   +  L +  Y  +NC  L
Sbjct: 192 CNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPY--ENC--L 247

Query: 92  LV-------SVLEAFEDLGLEVLDARVSCSDRFQLEAVGGDFLQHI--EGHADGIDAQVV 142
           LV           AF +L  ++L   ++   +   + +      HI  + H+  +    V
Sbjct: 248 LVLLNVQNAKAWNAF-NLSCKIL---LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEV 303

Query: 143 KEAVLQAIK-NVQD 155
           K  +L+ +    QD
Sbjct: 304 KSLLLKYLDCRPQD 317

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.61
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.49
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.49
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.48
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.43
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.42
4ati_A118 MITF, microphthalmia-associated transcription fact 99.41
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.38
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.37
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.31
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.21
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.98
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.94
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.84
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.62
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.61
4ath_A83 MITF, microphthalmia-associated transcription fact 98.17
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.83
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.28
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.54
2nyi_A 195 Unknown protein; protein structure initiative, PSI 96.5
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.21
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 95.96
1u8s_A192 Glycine cleavage system transcriptional repressor, 95.85
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 94.8
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 94.75
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 94.28
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 93.87
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 93.54
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 92.64
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 91.77
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 91.41
2pc6_A165 Probable acetolactate synthase isozyme III (small; 90.61
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 86.46
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 84.16
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.61  E-value=4.6e-16  Score=106.72  Aligned_cols=56  Identities=21%  Similarity=0.389  Sum_probs=51.0

Q ss_pred             chhHhHHHHHHHhhHHhhcC-CC-CCCCcccchhhHHHHHHHHHHHHHHHHHHhhccC
Q 031514            2 SSREQNKAALYEKLMLLRDV-TN-STSMNKTSIVVDASKYIEELKQQVETLNQEIGTS   57 (158)
Q Consensus         2 ~sER~RR~kln~~~~~LRsl-~~-~~K~DKaSIl~dAI~YIk~Lq~~v~~Le~e~~~~   57 (158)
                      ++||+||.+||+.|..||++ |+ ..|+||++||.+||+||++|+.+++.|+.+...+
T Consensus        12 ~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L   69 (82)
T 1am9_A           12 AIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL   69 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57999999999999999999 54 4899999999999999999999999999876543
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 6e-05
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.0 bits (86), Expect = 6e-05
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 13 EKLMLLRDV--TNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEASTVENSL 66
          +K++ L+D+       M+K+ ++  A  YI+ L+Q    L QE    + +  +N L
Sbjct: 6  DKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKL 61

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.46
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.41
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.41
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.28
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.51
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.98
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.86
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 95.47
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.17
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 94.86
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 93.09
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 91.96
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 89.32
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 88.3
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 88.05
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 86.74
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 83.12
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.51  E-value=6e-15  Score=98.87  Aligned_cols=55  Identities=22%  Similarity=0.409  Sum_probs=50.2

Q ss_pred             chhHhHHHHHHHhhHHhhcC-CC-CCCCcccchhhHHHHHHHHHHHHHHHHHHhhcc
Q 031514            2 SSREQNKAALYEKLMLLRDV-TN-STSMNKTSIVVDASKYIEELKQQVETLNQEIGT   56 (158)
Q Consensus         2 ~sER~RR~kln~~~~~LRsl-~~-~~K~DKaSIl~dAI~YIk~Lq~~v~~Le~e~~~   56 (158)
                      ++||+||.+||+.|..|+++ |+ ..|+||++||..||+||+.|+.+++.|..+...
T Consensus        12 ~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~   68 (80)
T d1am9a_          12 AIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLS   68 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57999999999999999999 54 679999999999999999999999999986543
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure