Citrus Sinensis ID: 031516


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MCFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPENTVGSSRNVRAAESDQGAHRRPAPPPPNEFYRKRFLLTIAITGIAVLLGSLFFPRKTETSQVH
ccHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHcHHHHHHHHcccccccccccHHHcHHHHHHHHHHcccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccc
ccccccHHcHHcccccccHHccccccHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHcccccccccccccEEEEEcHHHcHHHccccccccccccccccccHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
mcfddfcyslhAFEQVACSQCSETMEREILAIhkgencpqrivtcdfcefplpavdlaehqevcgNRTELCHLCNRYIRLRErynhesrctgvpentvgssrnvraaesdqgahrrpappppnefyrKRFLLTIAITGIAVLLgslffprktetsqvh
MCFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRErynhesrctgvpentvgssrnvraaesdqgahrrpappppnEFYRKRFLLTIAITGIAVLLGslffprktetsqvh
MCFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPENTVGSSRNVRAAESDQGAHRRPAPPPPNEFYRKRFLLTIAITGIAVLLGSLFFPRKTETSQVH
*CFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHE***********************************************************************
*CFDD**YSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHES******************************************LLTIAITGIAVLLGSLF***********
MCFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPENTVGS******************PPPPNEFYRKRFLLTIAITGIAVLLGSLFFPRKTETSQVH
*CFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCT**************************APPPPNEFYRKRFLLTIAITGIAVLLGSLFFPRK*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCFDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPENTVGSSRNVRAAESDQGAHRRPAPPPPNEFYRKRFLLTIAITGIAVLLGSLFFPRKTETSQVH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q6GPH4 301 XIAP-associated factor 1 yes no 0.708 0.372 0.300 3e-10
Q99MM4 576 TRAF-type zinc finger dom yes no 0.506 0.138 0.382 2e-09
Q3UDK1 580 TRAF-type zinc finger dom yes no 0.506 0.137 0.382 2e-09
Q58D05 580 TRAF-type zinc finger dom yes no 0.632 0.172 0.313 3e-08
Q58DH1297 XIAP-associated factor 1 no no 0.531 0.282 0.344 2e-07
Q4R970 582 TRAF-type zinc finger dom N/A no 0.474 0.128 0.355 3e-06
O14545 582 TRAF-type zinc finger dom no no 0.474 0.128 0.355 3e-06
>sp|Q6GPH4|XAF1_HUMAN XIAP-associated factor 1 OS=Homo sapiens GN=XAF1 PE=1 SV=1 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 1/113 (0%)

Query: 14  EQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHL 73
           +QV C+ C ++M++  L  HK   C +R V C FC+  +    L  H+  CG+RTELC  
Sbjct: 55  QQVGCTMCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQG 114

Query: 74  CNRYIRLRERYNHESRCTGVPENTVGSSRNVRAAESDQGAHRRPAPPPPNEFY 126
           C ++I  R    H   C    +  +G    + A E +   H      P N+++
Sbjct: 115 CGQFIMHRMLAQHRDVCRS-EQAQLGKGERISAPEREIYCHYCNQMIPENKYF 166




Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondra, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells.
Homo sapiens (taxid: 9606)
>sp|Q99MM4|TRAD1_RAT TRAF-type zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Trafd1 PE=2 SV=2 Back     alignment and function description
>sp|Q3UDK1|TRAD1_MOUSE TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus GN=Trafd1 PE=1 SV=1 Back     alignment and function description
>sp|Q58D05|TRAD1_BOVIN TRAF-type zinc finger domain-containing protein 1 OS=Bos taurus GN=TRAFD1 PE=2 SV=1 Back     alignment and function description
>sp|Q58DH1|XAF1_BOVIN XIAP-associated factor 1 OS=Bos taurus GN=XAF1 PE=2 SV=2 Back     alignment and function description
>sp|Q4R970|TRAD1_MACFA TRAF-type zinc finger domain-containing protein 1 OS=Macaca fascicularis GN=TRAFD1 PE=2 SV=1 Back     alignment and function description
>sp|O14545|TRAD1_HUMAN TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens GN=TRAFD1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
255572838199 nucleic acid binding protein, putative [ 0.949 0.753 0.737 1e-58
224063359201 predicted protein [Populus trichocarpa] 0.917 0.721 0.761 6e-58
388499446203 unknown [Lotus japonicus] 0.968 0.753 0.690 4e-54
302142096206 unnamed protein product [Vitis vinifera] 0.930 0.713 0.664 7e-54
225459034207 PREDICTED: XIAP-associated factor 1-like 0.930 0.710 0.660 1e-52
357490121 436 TRAF-type zinc finger domain-containing 0.905 0.327 0.646 6e-52
351722506199 uncharacterized protein LOC100306673 [Gl 0.930 0.738 0.649 6e-51
388517051134 unknown [Lotus japonicus] 0.848 1.0 0.723 2e-50
302142097 261 unnamed protein product [Vitis vinifera] 0.911 0.551 0.629 3e-50
225459028212 PREDICTED: XIAP-associated factor 1-like 0.911 0.679 0.629 4e-50
>gi|255572838|ref|XP_002527351.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533270|gb|EEF35023.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/156 (73%), Positives = 129/156 (82%), Gaps = 6/156 (3%)

Query: 3   FDDFCYSLHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQE 62
           +D+   + HA   VACS CSETMERE+LAIHKGENCPQRIVTC+FCEFPLPA+DLAEHQE
Sbjct: 50  YDEHFSNTHA--PVACSLCSETMEREVLAIHKGENCPQRIVTCEFCEFPLPAIDLAEHQE 107

Query: 63  VCGNRTELCHLCNRYIRLRERYNHESRCTGVPENTVGSSRNVRAAESDQGAHRRPAPPPP 122
           VCGNRTELCHLCNRYIRLRERYNHE RCTGV  N VG+SR+VRAAE  QGA RR    PP
Sbjct: 108 VCGNRTELCHLCNRYIRLRERYNHEIRCTGVTNNIVGTSRDVRAAERPQGAPRR----PP 163

Query: 123 NEFYRKRFLLTIAITGIAVLLGSLFFPRKTETSQVH 158
            ++ R+R + TIAITGIAV+LGSL F RKTE + VH
Sbjct: 164 QDYSRRRLMFTIAITGIAVILGSLLFQRKTENNPVH 199




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224063359|ref|XP_002301111.1| predicted protein [Populus trichocarpa] gi|222842837|gb|EEE80384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388499446|gb|AFK37789.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|302142096|emb|CBI19299.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459034|ref|XP_002285623.1| PREDICTED: XIAP-associated factor 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357490121|ref|XP_003615348.1| TRAF-type zinc finger domain-containing protein [Medicago truncatula] gi|355516683|gb|AES98306.1| TRAF-type zinc finger domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|351722506|ref|NP_001238526.1| uncharacterized protein LOC100306673 [Glycine max] gi|255629243|gb|ACU14966.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388517051|gb|AFK46587.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|302142097|emb|CBI19300.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459028|ref|XP_002285617.1| PREDICTED: XIAP-associated factor 1-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2024351192 AT1G09920 [Arabidopsis thalian 0.867 0.713 0.641 5e-44
ZFIN|ZDB-GENE-060929-840273 zgc:153893 "zgc:153893" [Danio 0.563 0.326 0.361 1.8e-14
UNIPROTKB|Q6GPH4 301 XAF1 "XIAP-associated factor 1 0.759 0.398 0.292 6.2e-14
UNIPROTKB|C9J7Z8164 XAF1 "XIAP-associated factor 1 0.537 0.518 0.344 1.2e-12
UNIPROTKB|I3L3D9133 XAF1 "XIAP-associated factor 1 0.537 0.639 0.344 1.2e-12
UNIPROTKB|F8VVF3135 TRAFD1 "TRAF-type zinc finger 0.474 0.555 0.355 8.2e-12
UNIPROTKB|Q58DH1297 XAF1 "XIAP-associated factor 1 0.746 0.397 0.288 9e-12
ZFIN|ZDB-GENE-070410-43 565 zgc:162228 "zgc:162228" [Danio 0.563 0.157 0.376 1.5e-11
UNIPROTKB|F8VNX8283 TRAFD1 "TRAF-type zinc finger 0.474 0.265 0.355 1.6e-11
RGD|620171 576 Trafd1 "TRAF type zinc finger 0.506 0.138 0.382 2e-11
TAIR|locus:2024351 AT1G09920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 464 (168.4 bits), Expect = 5.0e-44, P = 5.0e-44
 Identities = 93/145 (64%), Positives = 105/145 (72%)

Query:    10 LHAFEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTE 69
             L+    +ACS C ET+EREI   HKGE CP+RIVTC+FCEFPLPAVDLAEHQEVCGNRTE
Sbjct:    55 LNTHAPIACSMCKETIEREIFDSHKGEICPKRIVTCEFCEFPLPAVDLAEHQEVCGNRTE 114

Query:    70 LCHLCNRYIRLRERYNHESRCTGVPENTVGSSRNV-RAAESDQGAHRRPAPPPPNEFYRK 128
             LC+ CN Y+RLRERYNHE++C G    TV SSR + RAAE D    RR      N    K
Sbjct:   115 LCYQCNSYVRLRERYNHETKCPG----TVESSRRIPRAAEGDGNGRRRR---DGNGVSNK 167

Query:   129 RFLLTIAITGIAVLLGSLFFPRKTE 153
             R   TIAITGIAV++GSLFF RK E
Sbjct:   168 RLFFTIAITGIAVIIGSLFFQRKPE 192




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
ZFIN|ZDB-GENE-060929-840 zgc:153893 "zgc:153893" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GPH4 XAF1 "XIAP-associated factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J7Z8 XAF1 "XIAP-associated factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L3D9 XAF1 "XIAP-associated factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VVF3 TRAFD1 "TRAF-type zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DH1 XAF1 "XIAP-associated factor 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-43 zgc:162228 "zgc:162228" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F8VNX8 TRAFD1 "TRAF-type zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|620171 Trafd1 "TRAF type zinc finger domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
PLN03086567 PLN03086, PLN03086, PRLI-interacting factor K; Pro 2e-08
>gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional Back     alignment and domain information
 Score = 51.8 bits (124), Expect = 2e-08
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 21  CSETMEREILAIHKGENCPQRIVTCDFC-------EFPLPAVD----LAEHQEVCGNRTE 69
           C   +E+E +  H+   CP R++TC FC          +   D    ++EH+ +CG+RT 
Sbjct: 483 CGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTA 542

Query: 70  LCHLCNRYIRLRE 82
            C  C R + L+E
Sbjct: 543 PCDSCGRSVMLKE 555


Length = 567

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
PLN03086567 PRLI-interacting factor K; Provisional 99.22
PLN03086567 PRLI-interacting factor K; Provisional 98.88
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 98.77
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 98.67
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.46
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.27
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 97.25
KOG3576267 consensus Ovo and related transcription factors [T 97.12
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.91
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 96.8
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 96.2
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.19
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.23
PF03145198 Sina: Seven in absentia protein family; InterPro: 94.93
PF03145198 Sina: Seven in absentia protein family; InterPro: 94.24
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.91
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.68
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 93.05
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 92.76
KOG3002299 consensus Zn finger protein [General function pred 92.51
KOG3608 467 consensus Zn finger proteins [General function pre 91.15
PHA0276855 hypothetical protein; Provisional 91.02
KOG2186 276 consensus Cell growth-regulating nucleolar protein 90.55
PHA0073279 hypothetical protein 90.22
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 89.73
KOG3002299 consensus Zn finger protein [General function pred 89.72
PHA00733128 hypothetical protein 89.44
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 88.55
PHA00733128 hypothetical protein 87.86
PHA0276855 hypothetical protein; Provisional 87.32
KOG3608467 consensus Zn finger proteins [General function pre 86.36
PHA0061644 hypothetical protein 82.95
PHA0073279 hypothetical protein 82.7
KOG3576267 consensus Ovo and related transcription factors [T 82.65
KOG2186 276 consensus Cell growth-regulating nucleolar protein 81.81
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 81.69
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
Probab=99.22  E-value=1e-11  Score=112.38  Aligned_cols=79  Identities=33%  Similarity=0.748  Sum_probs=71.8

Q ss_pred             cceecCccCChhhhhhHHhhhhhcCCCccccccccCCCCccc-----------chhhhHHhhhcCcceeccCcccccchh
Q 031516           13 FEQVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPA-----------VDLAEHQEVCGNRTELCHLCNRYIRLR   81 (158)
Q Consensus        13 y~~V~C~~C~~~i~r~~L~~H~~~~C~~R~v~C~~C~~~~~~-----------~~L~~H~~~C~~r~v~C~~C~~~i~~~   81 (158)
                      +.++.|+ |+..+.+.+|..|+..+|+.+++.|+||+..+..           ..|..|+..|+.+++.|..|++.++.+
T Consensus       476 Hkpv~Cp-Cg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrlr  554 (567)
T PLN03086        476 HEPLQCP-CGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRSVMLK  554 (567)
T ss_pred             CCCccCC-CCCCcchhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCeeeeh
Confidence            3778999 9999989999999988999999999999999863           379999999999999999999999999


Q ss_pred             HHHHHHHHCCC
Q 031516           82 ERYNHESRCTG   92 (158)
Q Consensus        82 ~l~~H~~~Cp~   92 (158)
                      +|..|+..|..
T Consensus       555 dm~~H~~~~h~  565 (567)
T PLN03086        555 EMDIHQIAVHQ  565 (567)
T ss_pred             hHHHHHHHhhc
Confidence            99999988764



>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila Back     alignment and domain information
>PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2d9k_A75 Solution Structure Of The Zf-Traf Domain Of Fln29 G 1e-06
>pdb|2D9K|A Chain A, Solution Structure Of The Zf-Traf Domain Of Fln29 Gene Product Length = 75 Back     alignment and structure

Iteration: 1

Score = 48.5 bits (114), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 31/58 (53%) Query: 33 HKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRC 90 H+ CP R+ C C+ L + L EH++ CG RTELC C R + +++ H C Sbjct: 8 HEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVC 65

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 6e-21
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 6e-04
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 9e-12
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 4e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 6e-09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 8e-05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 1e-04
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 80.4 bits (198), Expect = 6e-21
 Identities = 21/63 (33%), Positives = 32/63 (50%)

Query: 28 EILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHE 87
             + H+   CP R+  C  C+  L  + L EH++ CG RTELC  C R + +++   H 
Sbjct: 3  SGSSGHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHP 62

Query: 88 SRC 90
            C
Sbjct: 63 EVC 65


>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.5
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 99.45
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.28
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 99.28
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.86
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.86
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.71
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.58
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.56
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.46
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.45
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.38
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.36
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.36
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.28
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 98.24
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.21
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.2
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.14
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 98.12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.1
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.1
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.1
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.03
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.02
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.0
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 97.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 97.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 97.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 97.8
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 97.76
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 97.73
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 97.67
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 97.67
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 97.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 97.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 97.58
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 97.53
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 97.52
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 97.51
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 97.46
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 97.46
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 97.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 97.43
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.41
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 97.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 97.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.4
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 97.38
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 97.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 97.36
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 97.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.3
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 97.27
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.27
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.19
2lv2_A85 Insulinoma-associated protein 1; structural genomi 97.17
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 97.17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 97.17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 97.09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.07
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 97.07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 97.04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.0
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 97.0
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 96.98
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 96.97
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 96.94
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 96.86
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.84
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 96.84
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 96.83
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.83
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.79
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.78
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.77
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.77
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.76
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.75
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.72
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 96.71
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.71
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.7
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 96.7
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.69
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.69
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 96.69
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.66
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.65
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.63
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 96.62
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.62
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.6
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.6
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 96.6
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.6
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 96.59
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.58
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.58
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.57
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.57
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.55
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.54
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.53
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 96.53
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.53
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.53
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.51
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.51
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.49
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 96.48
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.47
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.46
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.45
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 96.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 96.44
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 96.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 96.4
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.4
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.38
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.37
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 96.36
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 96.33
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.32
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 96.29
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.29
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 96.28
2epa_A72 Krueppel-like factor 10; transforming growth facto 96.12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 96.12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.11
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 96.05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 96.05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 96.0
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 96.0
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.98
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 95.9
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 95.87
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.83
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.82
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 95.81
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.77
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 95.76
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 95.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 95.76
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 95.75
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.75
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.72
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 95.69
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.68
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.68
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.65
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.64
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.63
1vd4_A62 Transcription initiation factor IIE, alpha subunit 95.63
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.62
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 95.61
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 95.59
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.57
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.57
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.57
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.57
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 95.56
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.55
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.55
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.55
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 95.54
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 95.51
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.51
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.48
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 95.48
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 95.46
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 95.44
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 95.38
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.36
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 95.33
2epa_A72 Krueppel-like factor 10; transforming growth facto 95.3
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 95.29
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 95.22
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 95.22
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 95.2
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 95.13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 95.11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 95.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.1
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.05
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 95.04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 95.03
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 95.02
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.99
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.96
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.96
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 94.96
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.95
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.92
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 94.92
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 94.92
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.91
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 94.9
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 94.9
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.88
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 94.82
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.8
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 94.8
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.8
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.75
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.74
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 94.73
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.68
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.64
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.63
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.62
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.6
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.59
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.54
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.49
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.48
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.48
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.45
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.42
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.37
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.31
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.3
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 94.29
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.27
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.27
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 94.19
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.19
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 94.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 94.04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.99
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.96
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.88
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 93.58
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.55
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.53
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.53
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 93.46
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 93.44
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.24
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.93
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 92.43
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 92.4
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 92.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.93
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 91.92
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 91.7
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 91.4
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.23
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 91.11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.0
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 91.0
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.98
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.93
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 90.91
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 90.79
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.71
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 90.7
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.62
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 90.56
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 90.53
1vd4_A62 Transcription initiation factor IIE, alpha subunit 90.52
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.45
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.29
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.27
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.26
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.23
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.14
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 90.12
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 90.12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 89.89
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 89.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.87
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.68
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.58
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.58
3vhs_A29 ATPase wrnip1; zinc finger, ubiquitin-binding doma 89.57
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 89.54
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.51
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.44
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.37
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.36
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 89.33
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.26
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 89.24
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 88.97
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.95
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.95
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.7
2l7x_A77 Envelope glycoprotein; cytoplasmic tail, viral pro 88.67
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 88.65
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 88.41
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 88.34
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.28
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.24
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 88.19
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 88.16
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 88.1
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 88.0
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.8
1ard_A29 Yeast transcription factor ADR1; transcription reg 87.56
2l7x_A77 Envelope glycoprotein; cytoplasmic tail, viral pro 87.23
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 87.19
3vhs_A29 ATPase wrnip1; zinc finger, ubiquitin-binding doma 86.81
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 86.79
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 86.77
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.71
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 86.53
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 86.51
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.78
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 85.73
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 85.53
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.33
2e72_A49 POGO transposable element with ZNF domain; zinc fi 85.28
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.18
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 85.02
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.8
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.71
2lo3_A44 SAGA-associated factor 73; zinc-finger, deubiquiti 84.52
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 84.3
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.98
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 84.4
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.91
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 84.09
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 83.52
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 83.51
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 80.76
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 81.68
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 80.62
1paa_A30 Yeast transcription factor ADR1; transcription reg 80.32
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.50  E-value=2.4e-15  Score=100.94  Aligned_cols=70  Identities=30%  Similarity=0.677  Sum_probs=65.3

Q ss_pred             hhHHhhhhhcCCCccccccccCCCCcccchhhhHHhhhcCcceeccCcccccchhHHHHHHHHCCCCCCC
Q 031516           27 REILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPEN   96 (158)
Q Consensus        27 r~~L~~H~~~~C~~R~v~C~~C~~~~~~~~L~~H~~~C~~r~v~C~~C~~~i~~~~l~~H~~~Cp~~~~~   96 (158)
                      +.+|+.|+..+|++|++.|++|+..|...+|+.|+.+|+++++.|+.|++.+.+++|..|+++|+..+.+
T Consensus         2 ~~~L~~H~~~~c~~r~~~C~~C~~~~~~~~L~~H~~~c~~~~~~C~~C~~~~~~~~l~~H~~~c~~~~~~   71 (75)
T 2d9k_A            2 SSGSSGHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGSG   71 (75)
T ss_dssp             CCCCSCCCCCCCCCCCEECSSSCCEECHHHHHHHHHHHHHCEEECSSSCCEEETTGGGTHHHHBTTBSSS
T ss_pred             chHHHhhCcccCCCcccCCcccChHhhHHHHHHHHhHcCCCceEcccCCCcCcHHHHHHHHHHccCCcCC
Confidence            4678999988999999999999999999999999999999999999999999999999999999997653



>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3vhs_A ATPase wrnip1; zinc finger, ubiquitin-binding domain, ubiquitin binding, ME binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l7x_A Envelope glycoprotein; cytoplasmic tail, viral protein; NMR {Crimean-congo hemorrhagic fever virus} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2l7x_A Envelope glycoprotein; cytoplasmic tail, viral protein; NMR {Crimean-congo hemorrhagic fever virus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3vhs_A ATPase wrnip1; zinc finger, ubiquitin-binding domain, ubiquitin binding, ME binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lo3_A SAGA-associated factor 73; zinc-finger, deubiquitination, transcription factor, SAGA CO transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.65
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.12
d1k2fa_190 SIAH, seven in absentia homolog {Mouse (Mus muscul 96.09
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.56
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.06
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 94.78
d2cota238 Zinc finger and SCAN domain-containing protein 16, 94.6
d1k2fa_190 SIAH, seven in absentia homolog {Mouse (Mus muscul 94.2
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 93.83
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 93.6
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 93.49
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 93.35
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 92.86
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.13
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 91.96
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 91.83
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 91.66
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 91.54
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 91.39
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 91.2
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.07
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 91.03
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 90.31
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 89.72
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 89.55
d2cota238 Zinc finger and SCAN domain-containing protein 16, 89.45
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.31
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 89.08
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 88.86
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 88.8
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 88.69
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.55
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 88.19
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.65  E-value=1.3e-05  Score=48.29  Aligned_cols=47  Identities=17%  Similarity=0.441  Sum_probs=35.6

Q ss_pred             cccccccCCCCccc-chhhhHHh-hhcCcceeccCcccccchh-HHHHHHH
Q 031516           41 RIVTCDFCEFPLPA-VDLAEHQE-VCGNRTELCHLCNRYIRLR-ERYNHES   88 (158)
Q Consensus        41 R~v~C~~C~~~~~~-~~L~~H~~-~C~~r~v~C~~C~~~i~~~-~l~~H~~   88 (158)
                      +++.|+ |++.|.. ..|..|+. +-++++..|..|++.+... .|..|++
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r   51 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK   51 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHh
Confidence            577885 8888775 67888877 7888888888888876655 5777764



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure