Citrus Sinensis ID: 031544

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
cccHHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccEEEEEEEEccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHcccccccccccccccHHHHHHHHHcccc
ccHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccHHHHcccHHHHHccccccccccccccHHHHHHHHHHcccc
MDCCKFLLVISLHSFLISHAFSQSVIQIFpgriefagdrkiragdelycdswrfsvetndagewdsvpsRCVEFVQKYMtgehylsdseivsgyslkhaksanvsagdgkdawvfdidetllsnlpyyaahGFGYWAYLALNLDQKSSMKMLLTSGWI
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETndagewdsvpSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSAnvsagdgkdAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
**CCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLD**************
*DCCKFLLVISLHSFLISHAFSQSVI*********************YCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKI*AGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCCKFLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMKMLLTSGWI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
P27061 255 Acid phosphatase 1 OS=Sol N/A no 0.759 0.470 0.392 1e-22
P10742 291 Stem 31 kDa glycoprotein no no 0.734 0.398 0.356 6e-15
P15490 254 Stem 28 kDa glycoprotein no no 0.734 0.456 0.356 8e-15
P10743 254 Stem 31 kDa glycoprotein no no 0.639 0.397 0.357 4e-13
O49195270 Vegetative storage protei no no 0.569 0.333 0.37 1e-12
O82122265 Vegetative storage protei no no 0.575 0.343 0.366 1e-12
>sp|P27061|PPA1_SOLLC Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 10/130 (7%)

Query: 16  LISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFV 75
           L SH F + +I  +P       ++++R  DEL C +WRF VETN+   W ++P  C ++V
Sbjct: 19  LNSHVFPRPLIIEYP-------EKQLR--DELKCTTWRFVVETNNLSPWKTIPEECADYV 69

Query: 76  QKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGY 135
           ++YM G  Y  + + VS  + ++AKS ++   DG+D W+FD+DETLLSNLPYY+ H +G 
Sbjct: 70  KEYMVGPGYKMEIDRVSDEAGEYAKSVDL-GDDGRDVWIFDVDETLLSNLPYYSDHRYGL 128

Query: 136 WAYLALNLDQ 145
             +  +  D+
Sbjct: 129 EVFDDVEFDK 138

Solanum lycopersicum (taxid: 4081)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|P10742|S25K_SOYBN Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2 Back     alignment and function description
>sp|P15490|VSPA_SOYBN Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1 Back     alignment and function description
>sp|P10743|VSPB_SOYBN Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1 Back     alignment and function description
>sp|O49195|VSP1_ARATH Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2 Back     alignment and function description
>sp|O82122|VSP2_ARATH Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
225445051257 PREDICTED: acid phosphatase 1-like [Viti 0.778 0.478 0.590 3e-33
255546271251 Acid phosphatase 1 precursor, putative [ 0.797 0.501 0.547 1e-31
118481785247 unknown [Populus trichocarpa] 0.626 0.400 0.64 2e-31
224091359214 predicted protein [Populus trichocarpa] 0.613 0.453 0.653 7e-31
357500937252 Acid phosphatase-like protein [Medicago 0.544 0.341 0.609 7e-25
449446542257 PREDICTED: acid phosphatase 1-like [Cucu 0.765 0.470 0.437 9e-25
388492444252 unknown [Medicago truncatula] 0.544 0.341 0.609 1e-24
15241412257 HAD superfamily, subfamily IIIB acid pho 0.778 0.478 0.457 2e-24
413944719 272 stem glycoprotein [Zea mays] 0.563 0.327 0.566 4e-24
226533351 272 stem 28 kDa glycoprotein precursor [Zea 0.563 0.327 0.566 4e-24
>gi|225445051|ref|XP_002283385.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 89/127 (70%), Gaps = 4/127 (3%)

Query: 19  HAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKY 78
            AFS S+I+I P R       K+   D L+CDSWRF+VETNDAG W SVP RCV++V+ Y
Sbjct: 18  RAFSDSLIRITPDR---RSSTKLSRDDVLFCDSWRFTVETNDAGVWVSVPDRCVQWVKDY 74

Query: 79  MTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAY 138
           MTG+ Y SDSE  +  SL  AK+  + AGDGKD WVFDIDETLLSNLPYYAAHGFG  A+
Sbjct: 75  MTGDRYRSDSEFAADDSLSFAKTVQI-AGDGKDVWVFDIDETLLSNLPYYAAHGFGSEAF 133

Query: 139 LALNLDQ 145
                D+
Sbjct: 134 DDSTFDE 140

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546271|ref|XP_002514195.1| Acid phosphatase 1 precursor, putative [Ricinus communis] gi|223546651|gb|EEF48149.1| Acid phosphatase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118481785|gb|ABK92831.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224091359|ref|XP_002309231.1| predicted protein [Populus trichocarpa] gi|222855207|gb|EEE92754.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357500937|ref|XP_003620757.1| Acid phosphatase-like protein [Medicago truncatula] gi|355495772|gb|AES76975.1| Acid phosphatase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446542|ref|XP_004141030.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus] gi|449487983|ref|XP_004157898.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388492444|gb|AFK34288.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|15241412|ref|NP_199939.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis thaliana] gi|8843863|dbj|BAA97389.1| acid phosphatase [Arabidopsis thaliana] gi|62320502|dbj|BAD95053.1| acid phosphatase [Arabidopsis thaliana] gi|87116594|gb|ABD19661.1| At5g51260 [Arabidopsis thaliana] gi|332008676|gb|AED96059.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413944719|gb|AFW77368.1| stem glycoprotein [Zea mays] Back     alignment and taxonomy information
>gi|226533351|ref|NP_001148296.1| stem 28 kDa glycoprotein precursor [Zea mays] gi|195617212|gb|ACG30436.1| stem 28 kDa glycoprotein precursor [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2176267 257 AT5G51260 [Arabidopsis thalian 0.778 0.478 0.457 2.5e-26
TAIR|locus:2118314 255 AT4G29260 [Arabidopsis thalian 0.569 0.352 0.549 3.2e-26
TAIR|locus:2118329 256 AT4G29270 [Arabidopsis thalian 0.613 0.378 0.459 8.7e-24
TAIR|locus:2117338 260 AT4G25150 [Arabidopsis thalian 0.797 0.484 0.437 7.8e-23
TAIR|locus:2172447 272 AT5G44020 [Arabidopsis thalian 0.550 0.319 0.477 1.8e-16
TAIR|locus:2024102 271 AT1G04040 [Arabidopsis thalian 0.544 0.317 0.420 1.6e-15
TAIR|locus:2184585270 VSP1 "AT5G24780" [Arabidopsis 0.835 0.488 0.312 5.4e-15
TAIR|locus:2184580 265 VSP2 "AT5G24770" [Arabidopsis 0.537 0.320 0.390 1.1e-14
TAIR|locus:2064128 251 AT2G38600 [Arabidopsis thalian 0.544 0.342 0.379 1.6e-13
TAIR|locus:2176267 AT5G51260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 59/129 (45%), Positives = 82/129 (63%)

Query:     6 FLLVISLHSFLISHAFSQSVIQIFPGRIEFAGDRKIRAGDELYCDSWRFSVETNDAGEWD 65
             FL+V+SL     + AFS S+++ +P  IE    +       L+C +WRF+ E N+   W 
Sbjct:     7 FLVVVSL----FTSAFSDSILE-YPSEIESRHKKAAEEDVNLHCTTWRFAAEMNNLAPWK 61

Query:    66 SVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNL 125
             ++P  C ++V+ Y+ G+ YL+D E VS  +L  A+S   S GDGKD W+FDIDETLLSNL
Sbjct:    62 TIPVECADYVKDYVMGKGYLTDLERVSEEALIFARSIEFS-GDGKDIWIFDIDETLLSNL 120

Query:   126 PYYAAHGFG 134
             PYY  HGFG
Sbjct:   121 PYYIDHGFG 129
GO:0003993 "acid phosphatase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2118314 AT4G29260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118329 AT4G29270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117338 AT4G25150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172447 AT5G44020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024102 AT1G04040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184585 VSP1 "AT5G24780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184580 VSP2 "AT5G24770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064128 AT2G38600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
TIGR01675 229 TIGR01675, plant-AP, plant acid phosphatase 1e-34
pfam03767 213 pfam03767, Acid_phosphat_B, HAD superfamily, subfa 3e-31
TIGR01680 275 TIGR01680, Veg_Stor_Prot, vegetative storage prote 3e-18
>gnl|CDD|130736 TIGR01675, plant-AP, plant acid phosphatase Back     alignment and domain information 
 Score =  120 bits (303), Expect = 1e-34
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 1/92 (1%)

Query: 44  GDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSAN 103
            D  YC SWR  VETN+  +WD+VP+ C ++V+ YMT + Y  D + V   +  +AKS  
Sbjct: 12  IDYAYCRSWRLGVETNNIRDWDTVPAECKDYVEDYMTSKQYKRDVKRVVDEAYFYAKSLA 71

Query: 104 VSAGDGKDAWVFDIDETLLSNLPYYAAHGFGY 135
           +S GDG DAW+FD+D+TLLSN+PYY  HG+G 
Sbjct: 72  LS-GDGMDAWIFDVDDTLLSNIPYYKKHGYGT 102

This model represents a family of acid phosphatase from plants which are most closely related to the (so called) class B non-specific acid phosphatase OlpA (TIGR01533, which is believed to be a 5'-nucleotide phosphatase) and somewhat more distantly to another class B phosphatase, AphA (TIGR01672). Together these three clades define a subfamily (pfam03767) which corresponds to the IIIB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate nucleophile hydrolases. It has been reported that the best substrate for this enzyme that could be found was purine 5'-nucleoside phosphates. This is in concordance with the assignment of the H. influenzae hel protein (from TIGR01533) as a 5'-nucleotidase, however there is presently no other evidence to support this specific function for these plant phosphatases. Many genes from this family have been annotated as vegetative storage proteins due to their close homology with these earlier-characterized gene products which are highly expressed in leaves. There are significant differences however, including expression levels and distribution. The most important difference is the lack in authentic VSPs of the nucleophilic aspartate residue, which is instead replaced by serine, glycine or asparagine. Thus these proteins can not be expected to be active phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP. In 1994 this assertion was refuted by the separation of the activity from the VSP. This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases. Length = 229
>gnl|CDD|217719 pfam03767, Acid_phosphat_B, HAD superfamily, subfamily IIIB (Acid phosphatase) Back     alignment and domain information
>gnl|CDD|130741 TIGR01680, Veg_Stor_Prot, vegetative storage protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
TIGR01675 229 plant-AP plant acid phosphatase. This model explic 100.0
TIGR01680 275 Veg_Stor_Prot vegetative storage protein. The prot 100.0
PF03767 229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 99.93
TIGR01533 266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 99.46
COG2503 274 Predicted secreted acid phosphatase [General funct 98.58
PRK11009 237 aphA acid phosphatase/phosphotransferase; Provisio 98.24
TIGR01672 237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.54
COG3700 237 AphA Acid phosphatase (class B) [General function 91.85
PRK10725 188 fructose-1-P/6-phosphogluconate phosphatase; Provi 90.66
PRK13226 229 phosphoglycolate phosphatase; Provisional 90.22
PRK13223 272 phosphoglycolate phosphatase; Provisional 89.35
PRK10748 238 flavin mononucleotide phosphatase; Provisional 88.24
PRK13222 226 phosphoglycolate phosphatase; Provisional 87.88
PRK13225 273 phosphoglycolate phosphatase; Provisional 84.64
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 84.51
PLN02779 286 haloacid dehalogenase-like hydrolase family protei 83.64
PLN02770 248 haloacid dehalogenase-like hydrolase family protei 83.6
PRK06698 459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 82.28
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 81.2
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information 
Probab=100.00  E-value=1.3e-46  Score=313.41  Aligned_cols=108  Identities=43%  Similarity=0.753  Sum_probs=104.7

Q ss_pred             cCCCCCCcccchhhhhccccCCCccccchhHHHHHHhhcCCCCcchHHHHHHHHHHHHhhccccCCCCCceEEEEccccc
Q 031544           42 RAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETL  121 (158)
Q Consensus        42 ~~~~~~yC~Swrl~vE~nNl~~w~~vP~~C~~yV~~Ym~ggqY~~Dl~~v~~~A~~Ya~s~~~~~~dgkdAwVfDIDET~  121 (158)
                      .+.+++||+||||+||+||+++|+|||++|++||++||+||||++|+++|+++|.+|++++.++ +|||||||||||||+
T Consensus        10 ~~~~~~~c~swr~~ve~~n~~~~~~vp~~c~~~v~~Y~~~~~Y~~D~~~v~~~a~~y~~~~~~~-~dg~~A~V~DIDET~   88 (229)
T TIGR01675        10 LSIDYAYCRSWRLGVETNNIRDWDTVPAECKDYVEDYMTSKQYKRDVKRVVDEAYFYAKSLALS-GDGMDAWIFDVDDTL   88 (229)
T ss_pred             ccCCcCcchhhhhhhhhccccccccCcHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHhhcc-CCCCcEEEEcccccc
Confidence            4567999999999999999999999999999999999999999999999999999999999999 899999999999999


Q ss_pred             ccChhHHhhhCCCcccCCchhHHHHHHhh
Q 031544          122 LSNLPYYAAHGFGYWAYLALNLDQKSSMK  150 (158)
Q Consensus       122 LSN~pYy~~~~FG~~~yn~~~f~~wv~~~  150 (158)
                      |||+|||++|+||+++||+++|++||++.
T Consensus        89 LsN~py~~~~~~g~~~~~~~~~~~wv~~~  117 (229)
T TIGR01675        89 LSNIPYYKKHGYGTEKTDPTAFWLWLGKG  117 (229)
T ss_pred             ccCHHHHHHhccCCCcCCHHHHHHHHHcC
Confidence            99999999999999999999999999864

This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases.
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 2e-05
3pct_A 260 Class C acid phosphatase; hydrolase, outer membran 4e-05
3ocu_A 262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 6e-05
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Length = 258 Back     alignment and structure
 Score = 42.3 bits (98), Expect = 2e-05
 Identities = 15/61 (24%), Positives = 21/61 (34%)

Query: 78  YMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWA 137
           Y T     +              +A     + K A V D+DET+L N P+ A        
Sbjct: 27  YQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKG 86

Query: 138 Y 138
           Y
Sbjct: 87  Y 87
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Length = 260 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Length = 262 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
3pct_A 260 Class C acid phosphatase; hydrolase, outer membran 99.52
3ocu_A 262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 99.49
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.12
4gib_A 250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 92.05
3nuq_A 282 Protein SSM1, putative nucleotide phosphatase; sup 91.61
3dv9_A 247 Beta-phosphoglucomutase; structural genomics, APC6 91.44
3e58_A 214 Putative beta-phosphoglucomutase; structu genomics 91.28
2hsz_A 243 Novel predicted phosphatase; structural genomics, 90.93
1l7m_A 211 Phosphoserine phosphatase; rossmann fold, four-hel 90.58
2fi1_A 190 Hydrolase, haloacid dehalogenase-like family; stru 90.34
3ddh_A 234 Putative haloacid dehalogenase-like family hydrol; 90.12
2pke_A 251 Haloacid delahogenase-like family hydrolase; NP_63 90.11
2b82_A 211 APHA, class B acid phosphatase; DDDD acid phosphat 90.09
4g9b_A 243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 90.08
3um9_A 230 Haloacid dehalogenase, type II; haloacid dehalogen 89.77
1te2_A 226 Putative phosphatase; structural genomics, phospha 89.41
2no4_A 240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 89.38
4ex6_A 237 ALNB; modified rossman fold, phosphatase, magnesiu 89.28
3s6j_A 233 Hydrolase, haloacid dehalogenase-like family; stru 89.11
3d6j_A 225 Putative haloacid dehalogenase-like hydrolase; str 88.87
3qxg_A 243 Inorganic pyrophosphatase; hydrolase, magnesium bi 88.66
3qnm_A 240 Haloacid dehalogenase-like hydrolase; structural g 88.65
3ed5_A 238 YFNB; APC60080, bacillus subtilis subsp. subtilis 88.43
2p11_A 231 Hypothetical protein; putative haloacid dehalogena 88.37
3l5k_A 250 Protein GS1, haloacid dehalogenase-like hydrolase 88.25
3sd7_A 240 Putative phosphatase; structural genomics, haloaci 88.19
2gfh_A 260 Haloacid dehalogenase-like hydrolase domain conta; 87.95
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 87.68
3m9l_A 205 Hydrolase, haloacid dehalogenase-like family; HAD 87.57
3smv_A 240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 87.52
3umc_A 254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 87.33
2b0c_A 206 Putative phosphatase; alpha-D-glucose-1-phosphate, 87.29
3umg_A 254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 87.25
3kzx_A 231 HAD-superfamily hydrolase, subfamily IA, variant; 87.08
4eek_A 259 Beta-phosphoglucomutase-related protein; hydrolase 86.84
4ap9_A 201 Phosphoserine phosphatase; hydrolase, haloacid deh 86.65
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 86.36
1nnl_A 225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 86.08
2i6x_A 211 Hydrolase, haloacid dehalogenase-like family; HAD 85.78
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 84.94
4dcc_A 229 Putative haloacid dehalogenase-like hydrolase; mag 84.83
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 84.62
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 84.5
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 83.96
2qlt_A 275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 83.82
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 83.44
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 83.41
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 83.39
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 83.05
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 82.81
2fea_A 236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 82.75
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 82.74
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 82.67
3mmz_A 176 Putative HAD family hydrolase; structural genomics 82.59
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 82.31
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 82.3
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 82.19
3dao_A 283 Putative phosphatse; structural genomics, joint ce 81.77
3mn1_A 189 Probable YRBI family phosphatase; structural genom 81.48
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 81.39
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 81.12
1yns_A 261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 81.11
3ij5_A 211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 80.82
2p9j_A 162 Hypothetical protein AQ2171; secsg, riken, PSI, st 80.38
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 80.25
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 80.21
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
Probab=99.52  E-value=2.9e-15  Score=125.54  Aligned_cols=77  Identities=14%  Similarity=0.035  Sum_probs=66.0

Q ss_pred             HHHHHhhcCCCCcchHHHHHHHHHHHHhhccccCCCCCceEEEEcccccccChhHHhhhCCCcccCCchhHHHHHHhh
Q 031544           73 EFVQKYMTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAHGFGYWAYLALNLDQKSSMK  150 (158)
Q Consensus        73 ~yV~~Ym~ggqY~~Dl~~v~~~A~~Ya~s~~~~~~dgkdAwVfDIDET~LSN~pYy~~~~FG~~~yn~~~f~~wv~~~  150 (158)
                      .-+.=|.++|+|+.|+..+.+.|+.|++..... .+.+||||||||||+|+|.|||..++++..+||++.|++|+.+.
T Consensus        22 ~a~~w~q~S~ey~a~~~q~~~~A~~~l~~~~~~-~g~~~avVfDIDgTlldn~~y~~~~~~~~~~f~~~~w~~wv~~g   98 (260)
T 3pct_A           22 MGLIWTQQSGEYAALAHQAFNSAKMAFDHAKAK-KGKKKAVVVDLDETMIDNSAYAGWQVQSGQGFSPKTWTKWVDAR   98 (260)
T ss_dssp             HHHHHHHHCHHHHHHHHHHHHHHHHHHHHCC------CEEEEECCBTTTEECHHHHHHHHHHTCCCCHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc-CCCCCEEEEECCccCcCChhHHHhhcccCCCCCHHHHHHHHHcC
Confidence            345557799999999999999999999987544 34567999999999999999999999999999999999999864
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d2b82a1 209 c.108.1.12 (A:4-212) Class B acid phosphatase, Aph 2e-05
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Class B acid phosphatase, AphA
domain: Class B acid phosphatase, AphA
species: Escherichia coli [TaxId: 562]

 Score = 40.7 bits (95), Expect = 2e-05
 Identities = 9/29 (31%), Positives = 14/29 (48%)

Query: 107 GDGKDAWVFDIDETLLSNLPYYAAHGFGY 135
           G    A  FDID+T+L + P +      +
Sbjct: 32  GRPPMAVGFDIDDTVLFSSPGFWRGKKTF 60

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d2b82a1 209 Class B acid phosphatase, AphA {Escherichia coli [ 98.57
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 93.81
d1zs9a1 253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 93.15
d1nnla_ 217 Phosphoserine phosphatase {Human (Homo sapiens) [T 90.21
d2gfha1 247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 85.37
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 81.56
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 80.92
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Class B acid phosphatase, AphA
domain: Class B acid phosphatase, AphA
species: Escherichia coli [TaxId: 562]

Probab=98.57  E-value=1e-08  Score=81.99  Aligned_cols=40  Identities=23%  Similarity=0.217  Sum_probs=30.5

Q ss_pred             CceEEEEcccccccChhHHhh--hCCCc----ccCCchhHHHHHHh
Q 031544          110 KDAWVFDIDETLLSNLPYYAA--HGFGY----WAYLALNLDQKSSM  149 (158)
Q Consensus       110 kdAwVfDIDET~LSN~pYy~~--~~FG~----~~yn~~~f~~wv~~  149 (158)
                      +.|||||||||+|+|.||+..  ++|..    -.++++.|+.|++.
T Consensus        35 P~AIifDIDETvLdnspy~~~~~~~~~~~~~~y~~~~~~W~~~~~~   80 (209)
T d2b82a1          35 PMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNG   80 (209)
T ss_dssp             CCEEEECCBTTTEECHHHHHHHHHHHCTTSSGGGGCHHHHHHHHTT
T ss_pred             CceEEEcchhhhhcCcHHHHhhhhhcCcCcccccCCCcchHHHhcc
Confidence            349999999999999999665  33321    13689999998864
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure