Citrus Sinensis ID: 031562


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MEFGFIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQARPQMGS
ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccHHHHHHHHHHHcccEEEEEcccccEEEEEcHHHHHHHHHHcccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHccHHHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccHHHHHccccccHHHHHHHHHHcccEEEEEcccEEEEEEccHHHHHHHHHHcccEEcccccHHHHHHHEEEccccEEEccccHHHHHHHHHHHHHHHcHHHHHcHHHHHHccc
MEFGFIILISIAVAALLKAFIGVIISskyktnlppgpfnvpliGNLRWLLKSFTEIEPILRNLhsklgpvftlyvgprpaifIADRSLAHKALVqngaifadrppplptwkiissnqhditsasygTTWRVFRRNLSAEILHPLSceilqarpqmgs
MEFGFIILISIAVAALLKAFIGVIISSkyktnlppgpFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEilhplsceilqarpqmgs
MEFGFiilisiavaallkaFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQARPQMGS
**FGFIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEIL********
MEFGFIILISIAVAALLKAFIG***************FNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQARPQ***
MEFGFIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQARPQMGS
*EFGFIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQ*******
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFGFIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQARPQMGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q9SRQ1 511 Cytochrome P450 89A9 OS=A yes no 0.853 0.262 0.514 2e-34
Q42602 506 Cytochrome P450 89A2 OS=A no no 0.649 0.201 0.538 1e-29
P37123 499 Cytochrome P450 77A1 (Fra N/A no 0.738 0.232 0.444 6e-21
O48928 513 Cytochrome P450 77A3 OS=G no no 0.738 0.226 0.387 3e-19
Q9LZ31 512 Cytochrome P450 77A4 OS=A no no 0.853 0.261 0.383 2e-15
P37124 511 Cytochrome P450 77A2 OS=S N/A no 0.496 0.152 0.397 7e-13
Q0JF01 502 9-beta-pimara-7,15-diene no no 0.834 0.260 0.345 9e-13
Q7X7X4 532 Cytochrome P450 99A2 OS=O no no 0.713 0.210 0.356 2e-12
Q6YV88 518 Ent-cassadiene C2-hydroxy no no 0.802 0.243 0.341 2e-12
Q94FM7 504 5-epiaristolochene 1,3-di N/A no 0.726 0.226 0.324 5e-12
>sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 Back     alignment and function desciption
 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 102/140 (72%), Gaps = 6/140 (4%)

Query: 5   FIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKS-FTEIEPILRNL 63
           F+I+ S+  +  LK    +   S +K  LPPGP   P+IGN+ WL K+ F++ + +LR+L
Sbjct: 8   FLIISSLTFSIFLKL---IFFFSTHK--LPPGPPRFPVIGNIIWLKKNNFSDFQGVLRDL 62

Query: 64  HSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSA 123
            S+ GP+ TL+VG +P+I++ DRSLAH+ALVQNGA+F+DR   LPT K+I+SNQHDI S+
Sbjct: 63  ASRHGPIITLHVGSKPSIWVTDRSLAHQALVQNGAVFSDRSLALPTTKVITSNQHDIHSS 122

Query: 124 SYGTTWRVFRRNLSAEILHP 143
            YG+ WR  RRNL++EIL P
Sbjct: 123 VYGSLWRTLRRNLTSEILQP 142




Involved in the chlorophyll breakdown by its action in nonpolar fluorescent chlorophyll catabolite (FCC) decarbonylation.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q42602|C89A2_ARATH Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2 Back     alignment and function description
>sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 Back     alignment and function description
>sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 Back     alignment and function description
>sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 Back     alignment and function description
>sp|Q0JF01|C99A3_ORYSJ 9-beta-pimara-7,15-diene oxidase OS=Oryza sativa subsp. japonica GN=CYP99A3 PE=1 SV=1 Back     alignment and function description
>sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 Back     alignment and function description
>sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 Back     alignment and function description
>sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
225454627 521 PREDICTED: cytochrome P450 89A2-like [Vi 0.866 0.261 0.640 4e-44
224101641 509 cytochrome P450 [Populus trichocarpa] gi 0.891 0.275 0.594 1e-42
255566096 524 cytochrome P450, putative [Ricinus commu 0.904 0.270 0.580 4e-42
255557971 520 cytochrome P450, putative [Ricinus commu 0.751 0.226 0.677 1e-41
356521564 500 PREDICTED: cytochrome P450 89A2-like [Gl 0.891 0.28 0.566 3e-41
224154583177 cytochrome P450 [Populus trichocarpa] gi 0.891 0.790 0.580 7e-41
224170707150 cytochrome P450 [Populus trichocarpa] gi 0.891 0.933 0.580 1e-40
225454625 521 PREDICTED: cytochrome P450 89A2-like [Vi 0.859 0.259 0.586 5e-40
255566104 516 cytochrome P450, putative [Ricinus commu 0.904 0.275 0.545 6e-40
225454619 550 PREDICTED: cytochrome P450 89A2-like [Vi 0.866 0.247 0.582 9e-40
>gi|225454627|ref|XP_002266611.1| PREDICTED: cytochrome P450 89A2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (77%), Gaps = 3/139 (2%)

Query: 5   FIILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLH 64
           + I+IS+ VAALLK+    I     K NLPPGP  VP +GNL WLLKSF+E+EPILRNLH
Sbjct: 6   YNIVISLCVAALLKSLYDFIFP---KLNLPPGPTTVPFVGNLLWLLKSFSELEPILRNLH 62

Query: 65  SKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSAS 124
           +K GP+ TL +G RPAIF++  SLAH+ LVQ+GA+FADRP  LPT +I SSNQH+I+SA 
Sbjct: 63  AKYGPIVTLQIGSRPAIFVSANSLAHRTLVQDGAVFADRPKALPTNRIFSSNQHNISSAV 122

Query: 125 YGTTWRVFRRNLSAEILHP 143
           YG TWR  RRNL+AEILHP
Sbjct: 123 YGPTWRRLRRNLTAEILHP 141




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224101641|ref|XP_002334260.1| cytochrome P450 [Populus trichocarpa] gi|222870199|gb|EEF07330.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255566096|ref|XP_002524036.1| cytochrome P450, putative [Ricinus communis] gi|223536763|gb|EEF38404.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255557971|ref|XP_002520014.1| cytochrome P450, putative [Ricinus communis] gi|223540778|gb|EEF42338.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356521564|ref|XP_003529424.1| PREDICTED: cytochrome P450 89A2-like [Glycine max] Back     alignment and taxonomy information
>gi|224154583|ref|XP_002337495.1| cytochrome P450 [Populus trichocarpa] gi|222839469|gb|EEE77806.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224170707|ref|XP_002339408.1| cytochrome P450 [Populus trichocarpa] gi|222875039|gb|EEF12170.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225454625|ref|XP_002266528.1| PREDICTED: cytochrome P450 89A2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566104|ref|XP_002524040.1| cytochrome P450, putative [Ricinus communis] gi|223536767|gb|EEF38408.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225454619|ref|XP_002268477.1| PREDICTED: cytochrome P450 89A2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:2045859 512 AT2G12190 [Arabidopsis thalian 0.707 0.216 0.594 1.1e-32
TAIR|locus:2163223 497 CYP89A3 ""cytochrome P450, fam 0.707 0.223 0.585 1.8e-32
TAIR|locus:2010886 510 CYP89A5 ""cytochrome P450, fam 0.707 0.217 0.585 2.3e-32
TAIR|locus:2099714 511 CYP89A9 ""cytochrome P450, fam 0.707 0.217 0.580 2.9e-32
TAIR|locus:2010841 511 CYP89A6 ""cytochrome P450, fam 0.707 0.217 0.594 1.1e-31
TAIR|locus:2010781 506 CYP89A2 ""cytochrome P450, fam 0.694 0.215 0.540 1.1e-29
TAIR|locus:2010831 511 CYP89A7 ""cytochrome P450, fam 0.700 0.215 0.558 1.5e-29
TAIR|locus:2027412 510 CYP77B1 ""cytochrome P450, fam 0.738 0.227 0.422 9.1e-20
TAIR|locus:2180213 512 CYP77A4 ""cytochrome P450, fam 0.738 0.226 0.413 1.5e-19
TAIR|locus:2184412 509 CYP77A9 ""cytochrome P450, fam 0.681 0.210 0.460 5.3e-19
TAIR|locus:2045859 AT2G12190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 1.1e-32, P = 1.1e-32
 Identities = 66/111 (59%), Positives = 84/111 (75%)

Query:    33 LPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKA 92
             LPP P   P +G L+WL +    +   LR++H +LGP+ TL +  RPAIF+ADRSLAH+A
Sbjct:    32 LPPDPNFFPFLGTLQWLRQGLGGLNNYLRSVHHRLGPIITLRITSRPAIFVADRSLAHQA 91

Query:    93 LVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHP 143
             LV NGA+FADRPP  P  KIISSNQH+I+S+ YG TWR+ RRNL++EILHP
Sbjct:    92 LVLNGAVFADRPPAAPISKIISSNQHNISSSLYGATWRLLRRNLTSEILHP 142




GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2163223 CYP89A3 ""cytochrome P450, family 89, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010886 CYP89A5 ""cytochrome P450, family 89, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099714 CYP89A9 ""cytochrome P450, family 87, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010841 CYP89A6 ""cytochrome P450, family 87, subfamily A, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010781 CYP89A2 ""cytochrome P450, family 89, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010831 CYP89A7 ""cytochrome P450, family 87, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027412 CYP77B1 ""cytochrome P450, family 77, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180213 CYP77A4 ""cytochrome P450, family 77, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184412 CYP77A9 ""cytochrome P450, family 77, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-35
pfam00067 461 pfam00067, p450, Cytochrome P450 4e-16
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 4e-11
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 4e-10
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 5e-09
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 3e-08
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 6e-08
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-07
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-07
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 8e-07
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 9e-06
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-05
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-05
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
 Score =  128 bits (324), Expect = 1e-35
 Identities = 62/137 (45%), Positives = 86/137 (62%), Gaps = 2/137 (1%)

Query: 7   ILISIAVAALLKAFIGVIISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSK 66
            L+ + +  LL    G     K    LPPGP  VPL+G+L WL  S  ++EP+LR L ++
Sbjct: 11  ALLLLPLLLLLLGKHGGR-GGKKGRRLPPGPPAVPLLGSLVWLTNSSADVEPLLRRLIAR 69

Query: 67  LGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYG 126
            GPV +L VG R ++F+ADR LAH ALV+ GA  ADR P + + +++  + + IT +SYG
Sbjct: 70  YGPVVSLRVGSRLSVFVADRRLAHAALVERGAALADR-PAVASSRLLGESDNTITRSSYG 128

Query: 127 TTWRVFRRNLSAEILHP 143
             WR+ RRNL AE LHP
Sbjct: 129 PVWRLLRRNLVAETLHP 145


Length = 519

>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.92
PLN02687 517 flavonoid 3'-monooxygenase 99.89
PLN00168 519 Cytochrome P450; Provisional 99.87
PTZ00404 482 cytochrome P450; Provisional 99.86
PLN02394 503 trans-cinnamate 4-monooxygenase 99.85
PLN02971 543 tryptophan N-hydroxylase 99.85
PLN03112 514 cytochrome P450 family protein; Provisional 99.85
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.84
PLN02183 516 ferulate 5-hydroxylase 99.84
PLN03234 499 cytochrome P450 83B1; Provisional 99.84
PLN02196 463 abscisic acid 8'-hydroxylase 99.83
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.83
PLN02966 502 cytochrome P450 83A1 99.82
PLN02500 490 cytochrome P450 90B1 99.82
PLN02290 516 cytokinin trans-hydroxylase 99.81
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.79
PLN02655 466 ent-kaurene oxidase 99.79
PLN02774 463 brassinosteroid-6-oxidase 99.79
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.79
PLN02302 490 ent-kaurenoic acid oxidase 99.76
PLN03018 534 homomethionine N-hydroxylase 99.74
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.72
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.72
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.7
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.66
PLN02648 480 allene oxide synthase 99.59
PLN02936 489 epsilon-ring hydroxylase 99.57
PLN02738 633 carotene beta-ring hydroxylase 99.53
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.43
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.34
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.3
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.36
KOG3653 534 consensus Transforming growth factor beta/activin 91.17
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.92  E-value=2.6e-24  Score=161.60  Aligned_cols=118  Identities=38%  Similarity=0.560  Sum_probs=103.7

Q ss_pred             CCCCCCCccCcccccccccccccCChHHHHHHHHHhhCCeEEEecCCccEEEEeCHHHHHHHHHHcCCCCCCCCCCcchh
Q 031562           31 TNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTW  110 (157)
Q Consensus        31 ~~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~i~i~~p~~~~~i~~~~~~~~~~~~~~~~~~  110 (157)
                      .+.||||+++|++||++++.  ....|+.+.++.++|||++.+|+|..|+|+++|+|.++|++.+++..|..|+......
T Consensus        25 ~~lPPGP~~lPiIGnl~~l~--~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~  102 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQLG--SLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATL  102 (489)
T ss_pred             CCCCcCCCCCCccccHHHcC--CCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhH
Confidence            58899999999999999993  3369999999999999999999999999999999999999999999999998722244


Q ss_pred             hhhccCCcccccCCCCcchHHHhHhhhhhhcCcccccccc
Q 031562          111 KIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQ  150 (157)
Q Consensus       111 ~~~~~~~~~i~~~~~g~~W~~~R~~~~~~~f~~~~l~~~~  150 (157)
                      +.+..++.|++++.+|+.|+.+||++...+|+..+++++.
T Consensus       103 ~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~  142 (489)
T KOG0156|consen  103 KYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFM  142 (489)
T ss_pred             HHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhH
Confidence            5666566899999889999999999997889999887764



>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3pm0_A 507 Structural Characterization Of The Complex Between 1e-08
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 7e-08
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 7e-08
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 7e-08
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 7e-08
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 8e-08
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-07
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-07
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 7e-07
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 9e-07
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-06
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-06
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-06
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-06
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-06
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-06
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 3e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-06
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 9e-06
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-05
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-05
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 4e-04
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 7e-04
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 8/109 (7%) Query: 26 SSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIAD 85 SSK K PPGPF PLIGN + ++ L + G VF + +G P + + Sbjct: 6 SSKGK---PPGPFAWPLIGNAAAVGQA---AHLSFARLARRYGDVFQIRLGSCPIVVLNG 59 Query: 86 RSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRR 134 H+ALVQ G+ FADR P +++++S + + Y W+V RR Sbjct: 60 ERAIHQALVQQGSAFADR-PSFASFRVVSGGR-SMAFGHYSEHWKVQRR 106
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-26
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-24
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 9e-24
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-23
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 8e-23
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-22
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-20
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-20
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-20
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-20
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-19
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-17
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 9e-15
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-14
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-12
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-10
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 4e-09
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-08
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-08
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 5e-07
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-06
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-06
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-05
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-05
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-04
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
 Score =  101 bits (254), Expect = 4e-26
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 25  ISSKYKTNLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIA 84
           ++ K     P    ++PL+G+L   L     +      L  K GP++++ +G +  + + 
Sbjct: 1   MAKKTGAKYPKSLLSLPLVGSL-PFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVG 59

Query: 85  DRSLAHKALVQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRR 134
              LA + L++ G  F+ R P + T  I S+N+  I  A  G  W++ RR
Sbjct: 60  HHQLAKEVLIKKGKDFSGR-PQMATLDIASNNRKGIAFADSGAHWQLHRR 108


>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.85
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.84
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.84
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.83
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.81
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.8
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.8
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.78
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.78
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.77
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.76
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.75
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.74
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.74
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.73
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.73
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.73
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.7
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.68
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.68
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.68
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.68
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.66
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.57
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.55
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.51
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.49
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.47
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.47
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.46
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.45
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.44
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.4
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.4
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.36
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.35
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.35
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.33
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.31
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.31
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.3
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.29
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.28
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.27
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.26
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.25
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.25
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.23
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.21
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.19
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.18
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.17
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.17
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.17
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.16
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.15
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.15
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.15
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.14
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.13
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.09
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.06
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.05
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.05
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.02
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.0
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.96
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.92
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.92
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.91
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.9
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.83
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.72
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.55
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.51
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.24
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 96.41
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.85  E-value=2.8e-21  Score=144.37  Aligned_cols=113  Identities=31%  Similarity=0.521  Sum_probs=94.1

Q ss_pred             CCCCCCccCcccccccccccccCChHHHHHHHHHhhCCeEEEecCCccEEEEeCHHHHHHHHHHcCCCCCCCCCCcchhh
Q 031562           32 NLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIFADRPPPLPTWK  111 (157)
Q Consensus        32 ~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~i~i~~p~~~~~i~~~~~~~~~~~~~~~~~~~  111 (157)
                      +.||||+++|++||++++  ...+.+..+.+++++|||||++++++.++|+++||+++++|+.+++..|..++... ..+
T Consensus        10 kLPPGP~~lP~iGn~~~~--~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~-~~~   86 (479)
T 3tbg_A           10 KLPPGPLPLPGLGNLLHV--DFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVP-ITQ   86 (479)
T ss_dssp             CCCCCSCCBTTTBTGGGC--CTTSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCG-GGG
T ss_pred             CCCCCCCCcCcccchHhh--cCCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchH-HHH
Confidence            678999999999999887  45678889999999999999999999999999999999999998888888776654 333


Q ss_pred             hhcc--CCcccccCCCCcchHHHhHhhhhhhcCcccccc
Q 031562          112 IISS--NQHDITSASYGTTWRVFRRNLSAEILHPLSCEI  148 (157)
Q Consensus       112 ~~~~--~~~~i~~~~~g~~W~~~R~~~~~~~f~~~~l~~  148 (157)
                      .++.  ...+++++.+|+.|+++|+++. +.|+...+..
T Consensus        87 ~~~~~~~~~~~~~~~~g~~w~~~R~~~~-~~~~~~~~~~  124 (479)
T 3tbg_A           87 ILGFGPRSQGVFLARYGPAWREQRRFSV-STLRNLGLGK  124 (479)
T ss_dssp             GGTCBTTBCCSTTCCSSHHHHHHHHHHH-HHHHHTTSTT
T ss_pred             HhccCCCCCceeeCCCCHHHHHHHHHHH-HHhcchhhhH
Confidence            3321  2356667777999999999999 9998777643



>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-22
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-22
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 8e-21
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 5e-18
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 8e-17
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 6e-16
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-08
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-06
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 89.4 bits (220), Expect = 3e-22
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 2/113 (1%)

Query: 34  PPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKAL 93
           PPGP  +P IGN+  L  S       +R      G +F+L +G    + +    +  + L
Sbjct: 1   PPGPPGLPFIGNIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECL 60

Query: 94  VQNGAIFADRPPPLPTWKIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSC 146
           V    IFADR P LP +  + +    + ++ YG  W   RR       +    
Sbjct: 61  VHQSEIFADR-PCLPLFMKM-TKMGGLLNSRYGRGWVDHRRLAVNSFRYFGYG 111


>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.83
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.83
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.82
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.78
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.77
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.7
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.51
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.46
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.34
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.16
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.12
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.05
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.88
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.78
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.7
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.6
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.55
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.38
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.31
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.94
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.8
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=2.5e-21  Score=142.19  Aligned_cols=114  Identities=22%  Similarity=0.304  Sum_probs=92.9

Q ss_pred             CCCCCCccCcccccccccccccCChHHHHHHHHHhhCCeEEEecCCccEEEEeCHHHHHHHHHHcCCCC-CCCCCCcchh
Q 031562           32 NLPPGPFNVPLIGNLRWLLKSFTEIEPILRNLHSKLGPVFTLYVGPRPAIFIADRSLAHKALVQNGAIF-ADRPPPLPTW  110 (157)
Q Consensus        32 ~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~i~i~~p~~~~~i~~~~~~~~-~~~~~~~~~~  110 (157)
                      +++|||+++|++|+++.+   ..+++.++.+++++||++|++++++.++|+++||+++++|+.++...+ ..+.... ..
T Consensus         9 ~~iPGP~~~P~iG~~~~~---~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~-~~   84 (472)
T d1tqna_           9 LGIPGPTPLPFLGNILSY---HKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFG-PV   84 (472)
T ss_dssp             TTCCCCCCBTTTBTGGGG---GGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCS-CC
T ss_pred             cCCCCCCCcCceeEHHHh---hCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccc-cc
Confidence            468999999999999988   457899999999999999999999999999999999999997665433 3333322 33


Q ss_pred             hhhccCCcccccCCCCcchHHHhHhhhhhhcCcccccccccCCC
Q 031562          111 KIISSNQHDITSASYGTTWRVFRRNLSAEILHPLSCEILQARPQ  154 (157)
Q Consensus       111 ~~~~~~~~~i~~~~~g~~W~~~R~~~~~~~f~~~~l~~~~~~~~  154 (157)
                      ...+   ++++++ +|+.|+++|++++ +.|+.++++.+.+.++
T Consensus        85 ~~~~---~~i~~~-~g~~~~~~R~~~~-~~~~~~~l~~~~~~~~  123 (472)
T d1tqna_          85 GFMK---SAISIA-EDEEWKRLRSLLS-PTFTSGKLKEMVPIIA  123 (472)
T ss_dssp             GGGG---GSTTTC-CHHHHHHHHHHTT-GGGSHHHHHTTHHHHH
T ss_pred             cccC---Cceecc-CcHHHHHhhhhcC-ccccchhhhcccchhh
Confidence            3333   677555 5999999999999 9999999998877654



>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure