Citrus Sinensis ID: 031600

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MAAFLATPACPMATIPATALARGFNSQQKRFSTAGVGSSTSSGLKLVPKFQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAASA
ccccccccccccccccHHHHcccccccccccccccccccccccccccccEEEcHHHHHHHccccccHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcc
ccEEEEccccccccccHHHHHccccccccHccccccccccccccEEEccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHccccHHccccccHHHcccccHHHHHHHHHHHHHHccccccccHHHcccEHHHHHHHHcHHHHccc
maaflatpacpmatipatALARgfnsqqkrfstagvgsstssglklvpkfQFSKAAARLYKNNSRCFKTAiscsaaqpetLQTVQSTIAKQLSidlsavtpdtkfadlgadslDTVEIMMALEEQfgvsvgeegaeniATVQDAADLIEKVKAASA
maaflatpacpmATIPATALARGFNSQQKRFSTAgvgsstssglklvPKFQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAASA
MAAFLATPACPMATIPATALARGFNSQQKRFstagvgsstssgLKLVPKFQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAASA
*************************************************FQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATV***************
**************************************************************************AAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVK****
MAAFLATPACPMATIPATALARGFN*****************GLKLVPKFQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAASA
*******PACPMATIPATALARGFNSQQKRFSTA*VGSSTSSGLKL********************FKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAFLATPACPMATIPATALARGFNSQQKRFSTAGVGSSTSSGLKLVPKFQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAASA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
P93092136 Acyl carrier protein 1, c N/A no 0.519 0.595 0.634 5e-22
P52411140 Acyl carrier protein 1, c N/A no 0.583 0.65 0.548 1e-18
P08971134 Acyl carrier protein, chl N/A no 0.583 0.679 0.542 1e-18
P10352134 Acyl carrier protein, chl N/A no 0.576 0.671 0.532 2e-18
P52412137 Acyl carrier protein 2, c N/A no 0.538 0.613 0.569 2e-18
P52414139 Acyl carrier protein 4, c N/A no 0.512 0.575 0.597 4e-18
O04652139 Acyl carrier protein 5, c yes no 0.532 0.597 0.552 8e-18
P11829137 Acyl carrier protein 1, c no no 0.5 0.569 0.522 3e-17
Q9SW21137 Acyl carrier protein 4, c no no 0.583 0.664 0.483 3e-17
P25701136 Acyl carrier protein 2, c no no 0.679 0.779 0.448 5e-17
>sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplastic OS=Casuarina glauca GN=ACP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 69/82 (84%), Gaps = 1/82 (1%)

Query: 71  ISCSAAQPETLQTVQSTIAKQLSI-DLSAVTPDTKFADLGADSLDTVEIMMALEEQFGVS 129
           + C AA+PET++ V + + KQL++ D SAVT ++KFA LGADSLDTVEI+M LEE+FG++
Sbjct: 49  VVCCAAKPETVEKVCAIVKKQLALPDDSAVTGESKFATLGADSLDTVEIVMGLEEEFGIN 108

Query: 130 VGEEGAENIATVQDAADLIEKV 151
           V EE A++IATVQDAADLIEK+
Sbjct: 109 VEEESAQSIATVQDAADLIEKL 130
Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Casuarina glauca (taxid: 3522)
>sp|P52411|ACP1_CUPLA Acyl carrier protein 1, chloroplastic OS=Cuphea lanceolata GN=ACL1.1 PE=2 SV=1 Back     alignment and function description
>sp|P08971|ACP5_BRANA Acyl carrier protein, chloroplastic OS=Brassica napus GN=ACL1.C1 PE=2 SV=1 Back     alignment and function description
>sp|P10352|ACP1_BRANA Acyl carrier protein, chloroplastic OS=Brassica napus GN=ACL1.A1 PE=2 SV=2 Back     alignment and function description
>sp|P52412|ACP2_CUPLA Acyl carrier protein 2, chloroplastic OS=Cuphea lanceolata GN=ACL1.2 PE=2 SV=1 Back     alignment and function description
>sp|P52414|ACP4_CUPLA Acyl carrier protein 4, chloroplastic OS=Cuphea lanceolata GN=ACL1 PE=3 SV=1 Back     alignment and function description
>sp|O04652|ACP5_ARATH Acyl carrier protein 5, chloroplastic OS=Arabidopsis thaliana GN=ACP5 PE=3 SV=1 Back     alignment and function description
>sp|P11829|ACP1_ARATH Acyl carrier protein 1, chloroplastic OS=Arabidopsis thaliana GN=ACP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SW21|ACP4_ARATH Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana GN=ACP4 PE=1 SV=1 Back     alignment and function description
>sp|P25701|ACP2_ARATH Acyl carrier protein 2, chloroplastic OS=Arabidopsis thaliana GN=ACP2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
255550241120 acyl carrier protein, putative [Ricinus 0.717 0.933 0.745 3e-39
356522428154 PREDICTED: acyl carrier protein 1, chlor 0.942 0.954 0.565 4e-36
225442034156 PREDICTED: acyl carrier protein 1, chlor 0.897 0.897 0.576 7e-35
449447934156 PREDICTED: acyl carrier protein 1, chlor 0.724 0.724 0.657 2e-33
22409203980 predicted protein [Populus trichocarpa] 0.512 1.0 0.887 1e-32
356560188122 PREDICTED: LOW QUALITY PROTEIN: acyl car 0.756 0.967 0.647 4e-31
302785303130 hypothetical protein SELMODRAFT_414590 [ 0.653 0.784 0.632 2e-25
30278207580 hypothetical protein SELMODRAFT_98284 [S 0.487 0.95 0.75 4e-23
30280805379 hypothetical protein SELMODRAFT_122804 [ 0.493 0.974 0.740 7e-23
224141707181 predicted protein [Populus trichocarpa] 0.628 0.541 0.564 6e-22
>gi|255550241|ref|XP_002516171.1| acyl carrier protein, putative [Ricinus communis] gi|223544657|gb|EEF46173.1| acyl carrier protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/114 (74%), Positives = 97/114 (85%), Gaps = 2/114 (1%)

Query: 43  GLKLVPKFQFSKAAARLYKNNSRCFKTAISCSAAQPETLQTVQSTIAKQLSIDLSAVTPD 102
           GLK +PK Q  KAA  +    SRCF+T ISCSA +PETL+ VQSTIA QLSI++S VTP+
Sbjct: 9   GLKHIPKIQLPKAA-NISSTRSRCFRTTISCSA-EPETLKVVQSTIANQLSIEVSTVTPE 66

Query: 103 TKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAASA 156
           TKFADLGADSLDTVEIMMALEEQF VS+GE+GAENI TVQDAADLI+KV+AASA
Sbjct: 67  TKFADLGADSLDTVEIMMALEEQFDVSIGEKGAENIVTVQDAADLIQKVQAASA 120

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356522428|ref|XP_003529848.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225442034|ref|XP_002271901.1| PREDICTED: acyl carrier protein 1, chloroplastic [Vitis vinifera] gi|297742956|emb|CBI35823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449447934|ref|XP_004141721.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Cucumis sativus] gi|449480466|ref|XP_004155901.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224092039|ref|XP_002309450.1| predicted protein [Populus trichocarpa] gi|222855426|gb|EEE92973.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356560188|ref|XP_003548376.1| PREDICTED: LOW QUALITY PROTEIN: acyl carrier protein 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|302785303|ref|XP_002974423.1| hypothetical protein SELMODRAFT_414590 [Selaginella moellendorffii] gi|300158021|gb|EFJ24645.1| hypothetical protein SELMODRAFT_414590 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302782075|ref|XP_002972811.1| hypothetical protein SELMODRAFT_98284 [Selaginella moellendorffii] gi|302805272|ref|XP_002984387.1| hypothetical protein SELMODRAFT_120204 [Selaginella moellendorffii] gi|300147775|gb|EFJ14437.1| hypothetical protein SELMODRAFT_120204 [Selaginella moellendorffii] gi|300159412|gb|EFJ26032.1| hypothetical protein SELMODRAFT_98284 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302808053|ref|XP_002985721.1| hypothetical protein SELMODRAFT_122804 [Selaginella moellendorffii] gi|300146630|gb|EFJ13299.1| hypothetical protein SELMODRAFT_122804 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|224141707|ref|XP_002324206.1| predicted protein [Populus trichocarpa] gi|222865640|gb|EEF02771.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
TAIR|locus:2181216139 ACP5 "AT5G27200" [Arabidopsis 0.532 0.597 0.552 2.2e-18
TAIR|locus:2199461136 ACP2 "AT1G54580" [Arabidopsis 0.532 0.610 0.541 7.5e-18
TAIR|locus:2114820137 ACP1 "acyl carrier protein 1" 0.532 0.605 0.529 9.5e-18
TAIR|locus:2199517136 ACP3 "acyl carrier protein 3" 0.679 0.779 0.444 2e-17
TIGR_CMR|GSU_160477 GSU_1604 "acyl carrier protein 0.416 0.844 0.545 2.7e-13
GENEDB_PFALCIPARUM|PFB0385w137 PFB0385w "acyl carrier protein 0.570 0.649 0.428 4.4e-13
UNIPROTKB|Q7KWJ1137 PFB0385w "Apicoplast ACP" [Pla 0.570 0.649 0.428 4.4e-13
TIGR_CMR|CJE_049377 CJE_0493 "acyl carrier protein 0.467 0.948 0.418 2.2e-11
UNIPROTKB|Q9KQH878 acpP "Acyl carrier protein" [V 0.429 0.858 0.485 2.8e-11
TIGR_CMR|SO_277577 SO_2775 "acyl carrier protein" 0.442 0.896 0.485 2.8e-11
TAIR|locus:2181216 ACP5 "AT5G27200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 2.2e-18, P = 2.2e-18
 Identities = 47/85 (55%), Positives = 64/85 (75%)

Query:    68 KTAISCSAAQPETLQTVQSTIAKQLSI-DLSAVTPDTKFADLGADSLDTVEIMMALEEQF 126
             + A+SC+  Q ET++ V   + KQLS+ D   VT  TKF +LGADSLDTVEI+M LEE+F
Sbjct:    50 RLAVSCAVKQ-ETVEKVSEIVKKQLSLTDDQKVTAGTKFTELGADSLDTVEIVMGLEEEF 108

Query:   127 GVSVGEEGAENIATVQDAADLIEKV 151
             G+++ EE A+ IATVQ AA+LIE++
Sbjct:   109 GITMAEERAKEIATVQQAAELIEEL 133
GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=ISS
GO:0006633 "fatty acid biosynthetic process" evidence=IEA;ISS;TAS
GO:0009507 "chloroplast" evidence=ISM
GO:0031177 "phosphopantetheine binding" evidence=IEA
GO:0000038 "very long-chain fatty acid metabolic process" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0042335 "cuticle development" evidence=RCA
TAIR|locus:2199461 ACP2 "AT1G54580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114820 ACP1 "acyl carrier protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199517 ACP3 "acyl carrier protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1604 GSU_1604 "acyl carrier protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFB0385w PFB0385w "acyl carrier protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q7KWJ1 PFB0385w "Apicoplast ACP" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0493 CJE_0493 "acyl carrier protein" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQH8 acpP "Acyl carrier protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2775 SO_2775 "acyl carrier protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034029001
RecName- Full=Acyl carrier protein;; Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity) (156 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00007299001
SubName- Full=Chromosome chr2 scaffold_187, whole genome shotgun sequence; (431 aa)
•    •• 0.929
GSVIVG00024012001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (392 aa)
•    •• 0.887
GSVIVG00003432001
SubName- Full=Chromosome undetermined scaffold_143, whole genome shotgun sequence; (463 aa)
•    •• 0.760
GSVIVG00016391001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa)
•    •• 0.759
GSVIVG00025980001
SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (418 aa)
•    •• 0.744
GSVIVG00034037001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (502 aa)
•    •• 0.651
GSVIVG00006723001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (335 aa)
•    •• 0.624
GSVIVG00009555001
SubName- Full=Chromosome chr12 scaffold_238, whole genome shotgun sequence; (211 aa)
•     • 0.590
GSVIVG00017183001
RecName- Full=Translation initiation factor IF-3;; IF-3 binds to the 30S ribosomal subunit and [...] (272 aa)
•  •  • 0.500
GSVIVG00034687001
RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (392 aa)
      • 0.483

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
PRK0098278 PRK00982, acpP, acyl carrier protein; Provisional 1e-27
TIGR0051777 TIGR00517, acyl_carrier, acyl carrier protein 1e-24
CHL0012482 CHL00124, acpP, acyl carrier protein; Validated 6e-24
COG023680 COG0236, AcpP, Acyl carrier protein [Lipid metabol 1e-22
PTZ00171148 PTZ00171, PTZ00171, acyl carrier protein; Provisio 1e-19
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 2e-10
PRK0817282 PRK08172, PRK08172, putative acyl carrier protein 9e-09
PRK1244980 PRK12449, PRK12449, acyl carrier protein; Provisio 3e-07
PRK0535082 PRK05350, PRK05350, acyl carrier protein; Provisio 2e-06
PRK0650893 PRK06508, PRK06508, acyl carrier protein; Provisio 2e-05
PRK0582884 PRK05828, PRK05828, acyl carrier protein; Validate 2e-05
smart0082386 smart00823, PKS_PP, Phosphopantetheine attachment 3e-05
PRK0588391 PRK05883, PRK05883, acyl carrier protein; Validate 3e-04
>gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional Back     alignment and domain information 
 Score = 97.5 bits (244), Expect = 1e-27
 Identities = 40/76 (52%), Positives = 52/76 (68%), Gaps = 1/76 (1%)

Query: 79  ETLQTVQSTIAKQLSIDLSAVTPDTKFA-DLGADSLDTVEIMMALEEQFGVSVGEEGAEN 137
           E  + V+  I +QL +D   VTP+  F  DLGADSLDTVE++MALEE+FG+ + +E AE 
Sbjct: 3   EIFEKVKKIIVEQLGVDEEEVTPEASFVDDLGADSLDTVELVMALEEEFGIEIPDEDAEK 62

Query: 138 IATVQDAADLIEKVKA 153
           I TV DA D IEK + 
Sbjct: 63  IKTVGDAVDYIEKHQK 78

Length = 78
>gnl|CDD|213536 TIGR00517, acyl_carrier, acyl carrier protein Back     alignment and domain information
>gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|223314 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|240304 PTZ00171, PTZ00171, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|181266 PRK08172, PRK08172, putative acyl carrier protein IacP; Validated Back     alignment and domain information
>gnl|CDD|183533 PRK12449, PRK12449, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|180033 PRK05350, PRK05350, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|180597 PRK06508, PRK06508, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|180278 PRK05828, PRK05828, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|180304 PRK05883, PRK05883, acyl carrier protein; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
KOG1748131 consensus Acyl carrier protein/NADH-ubiquinone oxi 99.72
PRK0711779 acyl carrier protein; Validated 99.72
PRK0588391 acyl carrier protein; Validated 99.71
PRK0817282 putative acyl carrier protein IacP; Validated 99.71
PRK0582884 acyl carrier protein; Validated 99.7
PRK0535082 acyl carrier protein; Provisional 99.7
CHL0012482 acpP acyl carrier protein; Validated 99.67
PRK1244980 acyl carrier protein; Provisional 99.67
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 99.64
PRK0763986 acyl carrier protein; Provisional 99.64
PTZ00171148 acyl carrier protein; Provisional 99.64
PRK0098278 acpP acyl carrier protein; Provisional 99.62
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 99.59
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.58
PRK0918489 acyl carrier protein; Provisional 99.58
PRK0650893 acyl carrier protein; Provisional 99.54
PRK0708183 acyl carrier protein; Provisional 99.53
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 99.41
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 99.2
PF1457396 PP-binding_2: Acyl-carrier; PDB: 3CE7_A. 98.96
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 98.89
PRK06060705 acyl-CoA synthetase; Validated 98.67
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.67
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.52
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 98.47
PRK12467 3956 peptide synthase; Provisional 98.39
PRK056914334 peptide synthase; Validated 98.37
COG343374 Aryl carrier domain [Secondary metabolites biosynt 98.32
PRK12467 3956 peptide synthase; Provisional 98.26
PRK123165163 peptide synthase; Provisional 98.24
PRK05691 4334 peptide synthase; Validated 98.22
PRK12316 5163 peptide synthase; Provisional 98.1
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.0
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 97.29
PF07377111 DUF1493: Protein of unknown function (DUF1493); In 96.84
PF10501112 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IP 96.47
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 94.42
KOG2452 881 consensus Formyltetrahydrofolate dehydrogenase [Nu 92.53
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 91.87
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.72  E-value=3.8e-18  Score=125.40  Aligned_cols=80  Identities=48%  Similarity=0.651  Sum_probs=76.0

Q ss_pred             CChHHHHHHHHHHHHHHhCCCCCCCCCCCCcc-ccCCChHHHHHHHHHHHHHhCCccCcccccCCCCHHHHHHHHHHHhh
Q 031600           75 AAQPETLQTVQSTIAKQLSIDLSAVTPDTKFA-DLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKA  153 (156)
Q Consensus        75 ~~~~ei~~~I~~ii~~~l~~~~~~i~~d~~f~-dLGlDSL~~veii~~iee~f~i~I~~~~l~~~~Tv~~l~~~I~~~~~  153 (156)
                      ..+.++.++|..++..+..++++.++.+++|. |||+|||+.|||+|.||++||++||+++.+++.|+++.++||..+..
T Consensus        49 l~k~~v~~RVl~VVk~~dki~~~k~~~~s~f~~DLGlDSLD~VEiVMAlEEEFgiEIpd~dAdki~t~~da~~yI~~~~d  128 (131)
T KOG1748|consen   49 LAKKEVVDRVLDVVKKFDKIDPSKLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIEIPDEDADKIKTVRDAADYIADKPD  128 (131)
T ss_pred             hhHHHHHHHHHHHHHHhhcCCccccchhhHHHHhcCCcccccchhhhhhHHHhCCccCcchhhhhCCHHHHHHHHHhccc
Confidence            45889999999999999999999999999998 99999999999999999999999999999999999999999998765


Q ss_pred             c
Q 031600          154 A  154 (156)
Q Consensus       154 ~  154 (156)
                      .
T Consensus       129 ~  129 (131)
T KOG1748|consen  129 V  129 (131)
T ss_pred             c
Confidence            4

>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length Back     alignment and domain information
>PF10501 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IPR018305 This entry represents the L50 protein from the mitochondrial 39S ribosomal subunit Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
2qnw_A82 Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier 1e-14
2ava_A82 Solution Structure Of Stearoyl-Acyl Carrier Protein 3e-14
2xz0_D82 The Structure Of The 2:1 (Partially Occupied) Compl 1e-13
3gzl_A81 Crystal Structure Of Holo Pfacp Disulfide-Linked Di 5e-13
2fq0_A79 Solution Structure Of Major Conformation Of Holo-Ac 6e-13
2ehs_A77 Crystal Structure Of Acyl Carrier Protein From Aqui 4e-12
1x3o_A80 Crystal Structure Of The Acyl Carrier Protein From 6e-12
2l3v_A79 Nmr Structure Of Acyl Carrier Protein From Brucella 2e-11
2k92_A77 Structural Modification Of Acyl Carrier Protein By 3e-10
1l0h_A78 Crystal Structure Of Butyryl-Acp From E.Coli Length 3e-10
3ejb_A97 Crystal Structure Of P450bioi In Complex With Tetra 3e-10
1t8k_A77 Crystal Structure Of Apo Acyl Carrier Protein From 3e-10
2l0q_A80 Nmr Solution Structure Of Vibrio Harveyi Acyl Carri 3e-10
1l0i_A78 Crystal Structure Of Butyryl-Acp I62m Mutant Length 8e-10
4dxe_H101 2.52 Angstrom Resolution Crystal Structure Of The A 1e-09
2x2b_A78 Crystal Structure Of Malonyl-Acp (Acyl Carrier Prot 1e-09
1hy8_A76 Solution Structure Of B. Subtilis Acyl Carrier Prot 1e-09
1f80_D81 Holo-(Acyl Carrier Protein) Synthase In Complex Wit 5e-09
2lol_A81 Nmr Structure Of An Acyl-Carrier Protein From Ricke 1e-08
2kwl_A84 Solution Structure Of Acyl Carrier Protein From Bor 9e-07
2dnw_A99 Solution Structure Of Rsgi Ruh-059, An Acp Domain O 3e-06
3ce7_A107 Crystal Structure Of Toxoplasma Specific Mitochodri 2e-04
>pdb|2QNW|A Chain A, Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier Protein Length = 82 Back     alignment and structure 
Iteration: 1

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (71%), Gaps = 1/74 (1%)
Query: 81  LQTVQSTIAKQLSIDLSAVTPDTKF-ADLGADSLDTVEIMMALEEQFGVSVGEEGAENIA 139
           L+ V+  +A QL +D + + P++ F  DL ADSLD+VE++MA EE+FGVS+ +E A  IA
Sbjct: 9   LERVKDVVADQLGVDRARINPESNFIKDLDADSLDSVELVMAFEEKFGVSIPDEEASKIA 68
Query: 140 TVQDAADLIEKVKA 153
           TVQDA   IEK K+
Sbjct: 69  TVQDALSYIEKAKS 82
>pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 Back     alignment and structure
>pdb|2XZ0|D Chain D, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. Length = 82 Back     alignment and structure
>pdb|3GZL|A Chain A, Crystal Structure Of Holo Pfacp Disulfide-Linked Dimer Length = 81 Back     alignment and structure
>pdb|2FQ0|A Chain A, Solution Structure Of Major Conformation Of Holo-Acyl Carrier Protein From Malaria Parasite Plasmodium Falciparum Length = 79 Back     alignment and structure
>pdb|2EHS|A Chain A, Crystal Structure Of Acyl Carrier Protein From Aquifex Aeolicus (Form 1) Length = 77 Back     alignment and structure
>pdb|1X3O|A Chain A, Crystal Structure Of The Acyl Carrier Protein From Thermus Thermophilus Hb8 Length = 80 Back     alignment and structure
>pdb|2L3V|A Chain A, Nmr Structure Of Acyl Carrier Protein From Brucella Melitensis Length = 79 Back     alignment and structure
>pdb|2K92|A Chain A, Structural Modification Of Acyl Carrier Protein By Butyryl Group Length = 77 Back     alignment and structure
>pdb|1L0H|A Chain A, Crystal Structure Of Butyryl-Acp From E.Coli Length = 78 Back     alignment and structure
>pdb|3EJB|A Chain A, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 97 Back     alignment and structure
>pdb|1T8K|A Chain A, Crystal Structure Of Apo Acyl Carrier Protein From E. Coli Length = 77 Back     alignment and structure
>pdb|2L0Q|A Chain A, Nmr Solution Structure Of Vibrio Harveyi Acyl Carrier Protein (Acp) Length = 80 Back     alignment and structure
>pdb|1L0I|A Chain A, Crystal Structure Of Butyryl-Acp I62m Mutant Length = 78 Back     alignment and structure
>pdb|4DXE|H Chain H, 2.52 Angstrom Resolution Crystal Structure Of The Acyl-Carrier-Protein Synthase (Acps)-Acyl Carrier Protein (Acp) Protein-Protein Complex From Staphylococcus Aureus Subsp. Aureus Col Length = 101 Back     alignment and structure
>pdb|2X2B|A Chain A, Crystal Structure Of Malonyl-Acp (Acyl Carrier Protein) From Bacillus Subtilis Length = 78 Back     alignment and structure
>pdb|1HY8|A Chain A, Solution Structure Of B. Subtilis Acyl Carrier Protein Length = 76 Back     alignment and structure
>pdb|1F80|D Chain D, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) Length = 81 Back     alignment and structure
>pdb|2LOL|A Chain A, Nmr Structure Of An Acyl-Carrier Protein From Rickettsia Prowazekii, Seattle Structural Genomics Center For Infectious Disease (Ssgcid) Length = 81 Back     alignment and structure
>pdb|2KWL|A Chain A, Solution Structure Of Acyl Carrier Protein From Borrelia Burgdorferi Length = 84 Back     alignment and structure
>pdb|2DNW|A Chain A, Solution Structure Of Rsgi Ruh-059, An Acp Domain Of Acyl Carrier Protein, Mitochondrial [precursor] From Human Cdna Length = 99 Back     alignment and structure
>pdb|3CE7|A Chain A, Crystal Structure Of Toxoplasma Specific Mitochodrial Acyl Carrier Protein, 59.M03510 Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 1e-31
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 1e-30
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 1e-27
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 2e-27
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 2e-27
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 2e-27
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 3e-27
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 3e-27
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 3e-27
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 4e-27
1x3o_A80 Acyl carrier protein; structural genomics, riken s 7e-27
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 8e-27
2kw2_A101 Specialized acyl carrier protein; structural genom 1e-26
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 2e-26
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 2e-24
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 5e-24
2l4b_A88 Acyl carrier protein; infectious disease, human gr 3e-23
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 3e-23
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 5e-23
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 2e-22
2lte_A103 Specialized acyl carrier protein; APO protein, tra 4e-17
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 4e-16
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 5e-15
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 1e-13
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 1e-13
2lki_A105 Putative uncharacterized protein; helical bundle, 3e-11
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 2e-10
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 3e-10
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 5e-10
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 5e-08
2amw_A83 Hypothetical protein NE2163; all helical protein, 6e-08
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 8e-08
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 1e-07
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 2e-07
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 4e-07
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 3e-05
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 4e-04
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 6e-04
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 Back     alignment and structure
 Score =  107 bits (270), Expect = 1e-31
 Identities = 35/82 (42%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 76  AQPETLQTVQSTIAKQLSIDLSAVTPDTKFA-DLGADSLDTVEIMMALEEQFGVSVGEEG 134
           A+ ET+  V   + ++L++    V         LGADSLDTVEI+M LEE+FG++V E+ 
Sbjct: 1   AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDK 60

Query: 135 AENIATVQDAADLIEKVKAASA 156
           A++I+T+Q AAD+IE +    A
Sbjct: 61  AQDISTIQQAADVIEGLLEKKA 82
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Length = 78 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Length = 101 Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Length = 82 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Length = 81 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Length = 80 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Length = 77 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Length = 101 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Length = 82 Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Length = 115 Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Length = 113 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Length = 107 Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Length = 81 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Length = 103 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Length = 86 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Length = 105 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Length = 83 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Length = 92 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Length = 80 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Length = 91 Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Length = 99 Back     alignment and structure
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Length = 102 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.72
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.72
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 99.72
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.71
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 99.71
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.69
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 99.68
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.68
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.68
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 99.68
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.67
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 99.67
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.67
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.66
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.66
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.65
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.65
2l4b_A88 Acyl carrier protein; infectious disease, human gr 99.65
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.65
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 99.64
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 99.63
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.61
2kw2_A101 Specialized acyl carrier protein; structural genom 99.61
2lki_A105 Putative uncharacterized protein; helical bundle, 99.6
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.6
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 99.6
2amw_A83 Hypothetical protein NE2163; all helical protein, 99.59
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.58
2lte_A103 Specialized acyl carrier protein; APO protein, tra 99.36
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.58
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 99.57
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 99.56
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.54
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 99.52
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 99.51
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 99.51
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 99.5
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 99.49
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 99.41
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.4
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 99.37
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 99.31
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 99.14
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 98.98
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.73
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 98.68
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 98.62
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 98.56
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 98.42
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.71
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 84.91
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
Probab=99.72  E-value=4.2e-17  Score=109.12  Aligned_cols=79  Identities=46%  Similarity=0.734  Sum_probs=74.6

Q ss_pred             hHHHHHHHHHHHHHHhCCCCC-CCCCCCCccccCCChHHHHHHHHHHHHHhCCccCcccccCCCCHHHHHHHHHHHhhcc
Q 031600           77 QPETLQTVQSTIAKQLSIDLS-AVTPDTKFADLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKAAS  155 (156)
Q Consensus        77 ~~ei~~~I~~ii~~~l~~~~~-~i~~d~~f~dLGlDSL~~veii~~iee~f~i~I~~~~l~~~~Tv~~l~~~I~~~~~~~  155 (156)
                      ++++.++|++++++.++++.+ +++++++|.|||+|||+.++++..||++||+++|..++.++.|++++++||.++++..
T Consensus         2 ~~~i~~~l~~i~~~~l~~~~~~~i~~~~~l~dlG~DSl~~vel~~~le~~fgi~i~~~~~~~~~Tv~~l~~~i~~~~~~~   81 (82)
T 2ava_A            2 KKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKK   81 (82)
T ss_dssp             CHHHHHHHHHHHHHHTTCSSSSCCCSSCCSCCCTTCCSCHHHHHHHHHHHTTCCCCGGGSSSCCSHHHHHHHHHHHHHHC
T ss_pred             hHHHHHHHHHHHHHHhCCCcccccCCCCchhhcCCCHHHHHHHHHHHHHHHCCccCHHHHHhCCCHHHHHHHHHHHHhcC
Confidence            578999999999999999876 8999999999999999999999999999999999999999999999999999887654
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 1e-20
d1t8ka_77 a.28.1.1 (A:) Acyl carrier protein {Escherichia co 1e-19
d1vkua_85 a.28.1.1 (A:) Acyl carrier protein {Thermotoga mar 3e-15
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob 5e-15
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl 5e-12
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium 2e-10
d2af8a_86 a.28.1.1 (A:) Actinorhodin polyketide synthase acy 3e-10
d1nq4a_95 a.28.1.1 (A:) Oxytetracycline polyketide synthase 5e-10
d2jq4a183 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Ag 5e-07
d2pnga176 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP d 1e-05
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]

 Score = 77.9 bits (192), Expect = 1e-20
 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 79  ETLQTVQSTIAKQLSIDLSAVTPDTKFA-DLGADSLDTVEIMMALEEQFGVSVGEEGAEN 137
           +TL+ V   I  +L +D + V  +  F  DLGAD LD VE++M LE++F + + +E AE 
Sbjct: 3   DTLERVTKIIVDRLGVDEADVKLEASFKEDLGADXLDVVELVMELEDEFDMEISDEDAEK 62

Query: 138 IATVQDAADLIE 149
           IATV DA + I+
Sbjct: 63  IATVGDAVNYIQ 74
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Length = 85 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Length = 95 Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Length = 83 Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 99.76
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.74
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.72
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 99.67
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.67
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.64
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.63
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 99.58
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.58
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.51
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.37
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-termin 82.26
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]

Probab=99.76  E-value=5.5e-19  Score=116.95  Aligned_cols=75  Identities=47%  Similarity=0.646  Sum_probs=71.6

Q ss_pred             HHHHHHHHHHHHHhCCCCCCCCCCCCcc-ccCCChHHHHHHHHHHHHHhCCccCcccccCCCCHHHHHHHHHHHhh
Q 031600           79 ETLQTVQSTIAKQLSIDLSAVTPDTKFA-DLGADSLDTVEIMMALEEQFGVSVGEEGAENIATVQDAADLIEKVKA  153 (156)
Q Consensus        79 ei~~~I~~ii~~~l~~~~~~i~~d~~f~-dLGlDSL~~veii~~iee~f~i~I~~~~l~~~~Tv~~l~~~I~~~~~  153 (156)
                      +|+++|++++++.+|++.++++++++|. |||+|||+.++++..+|++||++||++++.++.||+++++||.++++
T Consensus         2 ~I~~~v~~iia~~l~i~~~~i~~~~~l~~dLg~DSl~~~el~~~iE~~f~i~i~~~~~~~~~Tv~dlv~~i~~~~A   77 (77)
T d1t8ka_           2 TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA   77 (77)
T ss_dssp             CHHHHHHHHHHHHHTCCGGGCCTTCBTTTTTCCCHHHHHHHHHHHHHHHTCCCCHHHHTTCCBHHHHHHHHHHTCC
T ss_pred             cHHHHHHHHHHHHHCCCHHHcCCCCcchhccccchhHHHHHHHHHHHHhCCCCCHHHHHhCCCHHHHHHHHHHccC
Confidence            4889999999999999999999999996 89999999999999999999999999999999999999999998753
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure