Citrus Sinensis ID: 031617

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGSDSEAERTPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELASSLF
ccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEccccccccEEcHHHHHHHccccEEEEccHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccc
ccccccccccccccHHHHHHHHcHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHEEEEcccEcccccccEEEEccHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccc
mgsdseaertphkdekkkivslapiakplagkklSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCViagnispidvithvpilceesdipyiyVASKEdlanagatkrptccvlvltkptkgelgqeeQDKLKADYTLVVEDVKELASSLF
mgsdseaertphkdekkkivslapiakplagkklskrtLKLVRRaaehkclkrgvkevvksirrghkglcviagnispidVITHVPILCEESDIPYIYVASKEDLAnagatkrptcCVLVLTkptkgelgqeeqdklkadytLVVEDVKELASSLF
MGSDSEAERTPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELASSLF
***********************************KRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTK****************DYTLVV***********
****************KKIVSLAPIAKPLAGKKLSKRT*************KRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPT*******EQDKLKADYTLVVEDVKELAS*L*
****************KKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELASSLF
************KDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELAS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSDSEAERTPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELASSLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q9LEY9156 H/ACA ribonucleoprotein c yes no 1.0 1.0 0.724 4e-61
P32495156 H/ACA ribonucleoprotein c yes no 0.858 0.858 0.5 1e-34
Q9P7H0154 H/ACA ribonucleoprotein c yes no 0.826 0.837 0.480 2e-31
Q6P8C4149 H/ACA ribonucleoprotein c yes no 0.737 0.771 0.495 4e-27
Q6NTV9149 H/ACA ribonucleoprotein c N/A no 0.737 0.771 0.486 1e-26
Q60YI3163 Putative H/ACA ribonucleo N/A no 0.75 0.717 0.454 1e-25
Q9XXD4163 Putative H/ACA ribonucleo yes no 0.730 0.699 0.466 1e-25
Q9CRB2153 H/ACA ribonucleoprotein c yes no 0.910 0.928 0.402 2e-25
Q5E950153 H/ACA ribonucleoprotein c yes no 0.705 0.718 0.447 5e-25
Q8I7X7159 H/ACA ribonucleoprotein c N/A no 0.75 0.735 0.446 6e-25
>sp|Q9LEY9|NHP2_ARATH H/ACA ribonucleoprotein complex subunit 2-like protein OS=Arabidopsis thaliana GN=At5g08180 PE=1 SV=1 Back     alignment and function desciption
 Score =  233 bits (594), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 133/156 (85%)

Query: 1   MGSDSEAERTPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVK 60
           MGSD+EAE++  K++KK  ++LAPIAKPLAGKKL KRT KL+++AA  KCLKRGVKEVVK
Sbjct: 1   MGSDTEAEKSIQKEKKKYAITLAPIAKPLAGKKLQKRTFKLIQKAAGKKCLKRGVKEVVK 60

Query: 61  SIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLV 120
           SIRRG KGLCVIAGNISPIDVITH+PILCEE+ +PY+YV SKEDLA AGATKRPTCCVLV
Sbjct: 61  SIRRGQKGLCVIAGNISPIDVITHLPILCEEAGVPYVYVPSKEDLAQAGATKRPTCCVLV 120

Query: 121 LTKPTKGELGQEEQDKLKADYTLVVEDVKELASSLF 156
           + KP KG+L  EE  KLK DY  V +D+KELA+S+ 
Sbjct: 121 MLKPAKGDLTAEELAKLKTDYEQVSDDIKELATSVI 156
Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs.
Arabidopsis thaliana (taxid: 3702)
>sp|P32495|NHP2_YEAST H/ACA ribonucleoprotein complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9P7H0|NHP2_SCHPO H/ACA ribonucleoprotein complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhp2 PE=1 SV=1 Back     alignment and function description
>sp|Q6P8C4|NHP2_XENTR H/ACA ribonucleoprotein complex subunit 2-like protein OS=Xenopus tropicalis GN=nhp2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NTV9|NHP2_XENLA H/ACA ribonucleoprotein complex subunit 2-like protein OS=Xenopus laevis GN=nhp2 PE=2 SV=1 Back     alignment and function description
>sp|Q60YI3|NHP2_CAEBR Putative H/ACA ribonucleoprotein complex subunit 2-like protein OS=Caenorhabditis briggsae GN=CBG18231 PE=3 SV=1 Back     alignment and function description
>sp|Q9XXD4|NHP2_CAEEL Putative H/ACA ribonucleoprotein complex subunit 2-like protein OS=Caenorhabditis elegans GN=Y48A6B.3 PE=3 SV=1 Back     alignment and function description
>sp|Q9CRB2|NHP2_MOUSE H/ACA ribonucleoprotein complex subunit 2 OS=Mus musculus GN=Nhp2 PE=2 SV=1 Back     alignment and function description
>sp|Q5E950|NHP2_BOVIN H/ACA ribonucleoprotein complex subunit 2 OS=Bos taurus GN=NHP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8I7X7|NHP2_BRABE H/ACA ribonucleoprotein complex subunit 2-like protein OS=Branchiostoma belcheri PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
225455760157 PREDICTED: H/ACA ribonucleoprotein compl 1.0 0.993 0.840 2e-69
224099217155 predicted protein [Populus trichocarpa] 0.993 1.0 0.852 9e-69
351721974157 uncharacterized protein LOC100305515 [Gl 1.0 0.993 0.834 5e-67
388520375157 unknown [Lotus japonicus] 1.0 0.993 0.796 3e-66
388502198157 unknown [Lotus japonicus] 1.0 0.993 0.789 8e-66
356511577166 PREDICTED: LOW QUALITY PROTEIN: H/ACA ri 0.967 0.909 0.820 4e-65
255541902157 H/ACA ribonucleoprotein complex subunit, 1.0 0.993 0.821 7e-65
351726206151 uncharacterized protein LOC100499993 [Gl 0.967 1.0 0.807 1e-63
449439363158 PREDICTED: H/ACA ribonucleoprotein compl 1.0 0.987 0.791 6e-61
317106656155 JHL10I11.6 [Jatropha curcas] 0.993 1.0 0.858 7e-61
>gi|225455760|ref|XP_002269703.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein [Vitis vinifera] gi|147867156|emb|CAN80504.1| hypothetical protein VITISV_035185 [Vitis vinifera] gi|297734127|emb|CBI15374.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 144/157 (91%), Gaps = 1/157 (0%)

Query: 1   MGSDSEAERTPHKD-EKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVV 59
           MGSDSEAER+ HK+ EKKK+ +LAPIAKPLAGKKL KRTLKL+RRAAEHKCLKRGVKEVV
Sbjct: 1   MGSDSEAERSAHKEKEKKKLSALAPIAKPLAGKKLCKRTLKLIRRAAEHKCLKRGVKEVV 60

Query: 60  KSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVL 119
           K IRRG KG CVIAGNI+PIDVITHVPILCEE+DIPY+YV SKEDLANAG+TKRPTCCVL
Sbjct: 61  KGIRRGDKGFCVIAGNITPIDVITHVPILCEEADIPYVYVPSKEDLANAGSTKRPTCCVL 120

Query: 120 VLTKPTKGELGQEEQDKLKADYTLVVEDVKELASSLF 156
           VLTKPTKGELGQEEQ+KLKA+YT VV DV  L S+LF
Sbjct: 121 VLTKPTKGELGQEEQEKLKAEYTQVVSDVSGLTSTLF 157

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099217|ref|XP_002311407.1| predicted protein [Populus trichocarpa] gi|118483385|gb|ABK93593.1| unknown [Populus trichocarpa] gi|118485555|gb|ABK94629.1| unknown [Populus trichocarpa] gi|222851227|gb|EEE88774.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351721974|ref|NP_001236460.1| uncharacterized protein LOC100305515 [Glycine max] gi|356562662|ref|XP_003549588.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein-like [Glycine max] gi|255625761|gb|ACU13225.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388520375|gb|AFK48249.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388502198|gb|AFK39165.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356511577|ref|XP_003524501.1| PREDICTED: LOW QUALITY PROTEIN: H/ACA ribonucleoprotein complex subunit 2-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|255541902|ref|XP_002512015.1| H/ACA ribonucleoprotein complex subunit, putative [Ricinus communis] gi|223549195|gb|EEF50684.1| H/ACA ribonucleoprotein complex subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351726206|ref|NP_001235327.1| uncharacterized protein LOC100499993 [Glycine max] gi|255628377|gb|ACU14533.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449439363|ref|XP_004137455.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein-like [Cucumis sativus] gi|449486884|ref|XP_004157431.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|317106656|dbj|BAJ53160.1| JHL10I11.6 [Jatropha curcas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
TAIR|locus:2181514156 AT5G08180 [Arabidopsis thalian 0.993 0.993 0.729 2.2e-57
CGD|CAL0000123159 NHP2 [Candida albicans (taxid: 0.948 0.930 0.451 7.4e-34
SGD|S000002367156 NHP2 "Protein related to mamma 0.961 0.961 0.464 1.2e-33
POMBASE|SPAC1782.10c154 nhp2 "box H/ACA snoRNP complex 0.826 0.837 0.480 3.3e-31
UNIPROTKB|F1NNP9158 NHP2 "Uncharacterized protein" 0.807 0.797 0.476 6.4e-28
UNIPROTKB|Q6P8C4149 nhp2 "H/ACA ribonucleoprotein 0.839 0.879 0.466 1.7e-27
UNIPROTKB|Q6NTV9149 nhp2 "H/ACA ribonucleoprotein 0.839 0.879 0.459 3.5e-27
UNIPROTKB|Q60YI3163 CBG18231 "Putative H/ACA ribon 0.775 0.742 0.44 1.2e-26
WB|WBGene00012964163 Y48A6B.3 [Caenorhabditis elega 0.858 0.822 0.431 1.5e-26
UNIPROTKB|Q9XXD4163 Y48A6B.3 "Putative H/ACA ribon 0.858 0.822 0.431 1.5e-26
TAIR|locus:2181514 AT5G08180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 590 (212.7 bits), Expect = 2.2e-57, P = 2.2e-57
 Identities = 113/155 (72%), Positives = 133/155 (85%)

Query:     1 MGSDSEAERTPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVK 60
             MGSD+EAE++  K++KK  ++LAPIAKPLAGKKL KRT KL+++AA  KCLKRGVKEVVK
Sbjct:     1 MGSDTEAEKSIQKEKKKYAITLAPIAKPLAGKKLQKRTFKLIQKAAGKKCLKRGVKEVVK 60

Query:    61 SIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLV 120
             SIRRG KGLCVIAGNISPIDVITH+PILCEE+ +PY+YV SKEDLA AGATKRPTCCVLV
Sbjct:    61 SIRRGQKGLCVIAGNISPIDVITHLPILCEEAGVPYVYVPSKEDLAQAGATKRPTCCVLV 120

Query:   121 LTKPTKGELGQEEQDKLKADYTLVVEDVKELASSL 155
             + KP KG+L  EE  KLK DY  V +D+KELA+S+
Sbjct:   121 MLKPAKGDLTAEELAKLKTDYEQVSDDIKELATSV 155
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0005730 "nucleolus" evidence=IEA;IDA
GO:0001510 "RNA methylation" evidence=RCA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
CGD|CAL0000123 NHP2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000002367 NHP2 "Protein related to mammalian high mobility group (HMG) proteins" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPAC1782.10c nhp2 "box H/ACA snoRNP complex subunit Nhp2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNP9 NHP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P8C4 nhp2 "H/ACA ribonucleoprotein complex subunit 2-like protein" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NTV9 nhp2 "H/ACA ribonucleoprotein complex subunit 2-like protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q60YI3 CBG18231 "Putative H/ACA ribonucleoprotein complex subunit 2-like protein" [Caenorhabditis briggsae (taxid:6238)] Back     alignment and assigned GO terms
WB|WBGene00012964 Y48A6B.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XXD4 Y48A6B.3 "Putative H/ACA ribonucleoprotein complex subunit 2-like protein" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RC65NHP2_PONABNo assigned EC number0.36120.91660.9346yesno
P32495NHP2_YEASTNo assigned EC number0.50.85890.8589yesno
Q9P7H0NHP2_SCHPONo assigned EC number0.48090.82690.8376yesno
Q9LEY9NHP2_ARATHNo assigned EC number0.72431.01.0yesno
Q6PBV6NHP2_DANRENo assigned EC number0.43880.82050.8533yesno
Q9CRB2NHP2_MOUSENo assigned EC number0.40250.91020.9281yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017572001
SubName- Full=Putative uncharacterized protein (Chromosome chr17 scaffold_16, whole genome shotgun sequence); (157 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00021307001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (586 aa)
  ••••• 0.930
GSVIVG00037695001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (245 aa)
   •• • 0.881
GSVIVG00021667001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (168 aa)
•  •  • 0.837
GSVIVG00025456001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (65 aa)
• ••  • 0.827
GSVIVG00025475001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (188 aa)
   •• • 0.804
GSVIVG00038765001
SubName- Full=Chromosome chr2 scaffold_97, whole genome shotgun sequence; (65 aa)
• ••  • 0.804
GSVIVG00038090001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (182 aa)
  ••    0.775
GSVIVG00031075001
SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (573 aa)
  ••• • 0.758
GSVIVG00026600001
SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (229 aa)
   •  • 0.735
GSVIVG00021672001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (315 aa)
   ••   0.728

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 3e-21
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 9e-21
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 1e-16
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 2e-16
PTZ00222263 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Pro 7e-07
PTZ00365266 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-lik 3e-04
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 82.7 bits (205), Expect = 3e-21
 Identities = 45/115 (39%), Positives = 69/115 (60%), Gaps = 1/115 (0%)

Query: 25  IAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITH 84
            AKPLA + L ++ L L+ +A+    LK+G  EV K+I RG   L VIA ++SP +++ H
Sbjct: 2   YAKPLAPEMLEQKALSLLGKASRAGKLKKGTNEVTKAIERGKAKLVVIAEDVSPEELVKH 61

Query: 85  VPILCEESDIPYIYVASKEDLANA-GATKRPTCCVLVLTKPTKGELGQEEQDKLK 138
           +P LCEE ++PY+YV SK++L  A G   R    ++      K E   E+ ++LK
Sbjct: 62  LPALCEEKNVPYVYVGSKKELGKAVGKEVRKVVAIVDKGFAKKLEDLVEKVEELK 116

Length = 116
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information
>gnl|CDD|140249 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>gnl|CDD|240382 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
KOG3167153 consensus Box H/ACA snoRNP component, involved in 100.0
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.97
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.97
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.94
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.9
PRK0101899 50S ribosomal protein L30e; Reviewed 99.89
PRK07714100 hypothetical protein; Provisional 99.89
PTZ00106108 60S ribosomal protein L30; Provisional 99.89
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.88
PRK0728398 hypothetical protein; Provisional 99.88
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.88
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.87
PRK0668382 hypothetical protein; Provisional 99.87
KOG3387131 consensus 60S ribosomal protein 15.5kD/SNU13, NHP2 99.85
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.84
PTZ00222263 60S ribosomal protein L7a; Provisional 99.82
PRK09190220 hypothetical protein; Provisional 99.79
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 99.78
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.68
KOG3406134 consensus 40S ribosomal protein S12 [Translation, 99.68
KOG2988112 consensus 60S ribosomal protein L30 [Translation, 98.89
KOG3166209 consensus 60S ribosomal protein L7A [Translation, 98.36
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 98.18
PF0803276 SpoU_sub_bind: RNA 2'-O ribose methyltransferase s 96.7
PF03465113 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This do 96.46
PF15608100 PELOTA_1: PELOTA RNA binding domain 95.58
PRK04011411 peptide chain release factor 1; Provisional 94.49
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal 94.48
TIGR00108409 eRF peptide chain release factor eRF/aRF, subunit 93.98
TIGR00111351 pelota probable translation factor pelota. This mo 93.93
PF1008797 DUF2325: Uncharacterized protein conserved in bact 93.0
PRK10864 346 putative methyltransferase; Provisional 91.62
PRK11181 244 23S rRNA (guanosine-2'-O-)-methyltransferase; Prov 91.42
TIGR00186 237 rRNA_methyl_3 rRNA methylase, putative, group 3. t 89.76
cd01422115 MGS Methylglyoxal synthase catalyzes the enolizati 87.26
PRK05562223 precorrin-2 dehydrogenase; Provisional 86.25
PF07997120 DUF1694: Protein of unknown function (DUF1694); In 84.66
PRK05234142 mgsA methylglyoxal synthase; Validated 82.43
PF0214295 MGS: MGS-like domain This is a subfamily of this f 82.27
>KOG3167 consensus Box H/ACA snoRNP component, involved in ribosomal RNA pseudouridinylation [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-34  Score=216.75  Aligned_cols=142  Identities=54%  Similarity=0.929  Sum_probs=133.4

Q ss_pred             CCCcccccc-CCChhhhhhhhccCcccCCCCChHHHHHHHHHHHHHHhcCCccccHHHHHHHHHcCCccEEEEeCCCCch
Q 031617            1 MGSDSEAER-TPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPI   79 (156)
Q Consensus         1 ~~~~~~~~~-~~~~~~~~~~~~~~~~a~Pl~~~~l~~ki~~lL~~A~kag~lv~G~~~v~kaI~k~kakLVIIA~D~~p~   79 (156)
                      ||+|..++- +++.+|+..+..++|||.|||++++++++++++++|.+.++|..|+++|.|.+++|+-++||||+|++|.
T Consensus         9 ~~~~a~~~~~s~e~~Y~~~l~~~~PIAkPLA~kkl~kk~~KlvkKa~k~k~lrrGvKevqK~vrkGeKGl~VlAgd~sPi   88 (153)
T KOG3167|consen    9 MGSDAKGEKTSGEDEYQALLIAVNPIAKPLASKKLAKKVYKLVKKAAKQKGLRRGVKEVQKRVRKGEKGLCVLAGDTSPI   88 (153)
T ss_pred             cccccccccccchhHHHHHHHhhcccccccccHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHhcCCcceEEEecCCccH
Confidence            677777766 5568899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHhhHHHHhHhcCCCceeeCCHHHHHhhcCCcCceEEEEEecCCCCCCcchHHHHhhHHHHHHHHHHHHhhhc
Q 031617           80 DVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELAS  153 (156)
Q Consensus        80 ~~~~~l~~lc~~~nIP~i~v~sk~eLG~a~G~~~~~svvaI~d~~~~~~~~~~~~~~~~~~y~e~~~~i~~~~~  153 (156)
                      +++.|||.+|+++||||+|++++.+||.|.|.+|+.+|+.|.-++           +|++.|+|+.+.++.|.-
T Consensus        89 Dvi~HlP~lCEd~~vPYvy~psk~dlg~A~~~krpt~~v~v~p~~-----------eyke~ydev~eel~~l~~  151 (153)
T KOG3167|consen   89 DVITHLPALCEDRGVPYVYTPSKEDLGAAGGTKRPTCCVFVKPGG-----------EYKELYDEVLEELEALAV  151 (153)
T ss_pred             HHHhccchhhhccCCCccccccHHHHHHhcCCCCCceEEEEeeCh-----------hHHHHHHHHHHHHHhhcc
Confidence            999999999999999999999999999999999999999998544           799999999999998753

>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>KOG3387 consensus 60S ribosomal protein 15 Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3406 consensus 40S ribosomal protein S12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3166 consensus 60S ribosomal protein L7A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>PF08032 SpoU_sub_bind: RNA 2'-O ribose methyltransferase substrate binding; InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications Back     alignment and domain information
>PF03465 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre Back     alignment and domain information
>PF15608 PELOTA_1: PELOTA RNA binding domain Back     alignment and domain information
>PRK04011 peptide chain release factor 1; Provisional Back     alignment and domain information
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms Back     alignment and domain information
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1 Back     alignment and domain information
>TIGR00111 pelota probable translation factor pelota Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK10864 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11181 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00186 rRNA_methyl_3 rRNA methylase, putative, group 3 Back     alignment and domain information
>cd01422 MGS Methylglyoxal synthase catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PF07997 DUF1694: Protein of unknown function (DUF1694); InterPro: IPR012543 This family contains many hypothetical proteins Back     alignment and domain information
>PRK05234 mgsA methylglyoxal synthase; Validated Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
2lbx_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 8e-32
2lbw_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 3e-31
1e7k_A128 Crystal Structure Of The Spliceosomal 15.5kd Protei 2e-16
2ozb_A130 Structure Of A Human Prp31-15.5k-U4 Snrna Complex L 2e-16
2jnb_A144 Solution Structure Of Rna-Binding Protein 15.5k Len 3e-16
2ale_A134 Crystal Structure Of Yeast Rna Splicing Factor Snu1 3e-15
1zwz_A126 Structural Comparison Of Yeast Snornp And Splicesom 4e-15
3paf_A117 M. Jannaschii L7ae Mutant Length = 117 5e-15
2aif_A135 Crystal Structure Of High Mobility Like Protein, Nh 6e-15
3id5_C130 Crystal Structure Of Sulfolobus Solfataricus CD RNP 7e-14
1sds_A117 Structure Of Protein L7ae Bound To A K-Turn Derived 6e-13
1ra4_A120 Crystal Structure Of The Methanococcus Jannaschii L 6e-13
1rlg_A119 Molecular Basis Of Box CD RNA-Protein Interaction: 7e-13
2fc3_A124 Crystal Structure Of The Extremely Thermostable Aer 2e-12
2hvy_D130 Crystal Structure Of An HACA BOX RNP FROM PYROCOCCU 4e-12
1pxw_A128 Crystal Structure Of L7ae Srnp Core Protein From Py 4e-12
3lwo_C123 Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONT 5e-12
3nmu_C129 Crystal Structure Of Substrate-Bound Halfmer Box CD 5e-12
3hjw_C120 Structure Of A Functional Ribonucleoprotein Pseudou 5e-12
2czw_A124 Crystal Structure Analysis Of Protein Component Ph1 5e-12
3o85_A122 Giardia Lamblia 15.5kd Rna Binding Protein Length = 9e-12
1s72_F120 Refined Crystal Structure Of The Haloarcula Marismo 1e-09
3g4s_F119 Co-Crystal Structure Of Tiamulin Bound To The Large 1e-09
1ffk_E119 Crystal Structure Of The Large Ribosomal Subunit Fr 2e-09
3zf7_x276 High-resolution Cryo-electron Microscopy Structure 3e-08
4a17_F255 T.Thermophila 60s Ribosomal Subunit In Complex With 1e-05
3izr_H258 Localization Of The Large Subunit Ribosomal Protein 2e-04
2zkr_f266 Structure Of A Mammalian Ribosomal 60s Subunit With 2e-04
3izs_H256 Localization Of The Large Subunit Ribosomal Protein 6e-04
1s1i_G119 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 7e-04
3jyw_G113 Structure Of The 60s Proteins For Eukaryotic Riboso 9e-04
>pdb|2LBX|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P Length = 121 Back     alignment and structure 
Iteration: 1

 Score =  132 bits (332), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 92/120 (76%)
Query: 32  KKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEE 91
           KKL+K+ LK V++A++ K +KRGVKEVVK++R+G KGL VIAG+ISP DVI+H+P+LCE+
Sbjct: 2   KKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCED 61
Query: 92  SDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKEL 151
             +PYI++ SK+DL  AGATKRPT  V ++    K + G+ ++++ K  +  VV++V+ L
Sbjct: 62  HSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL 121
>pdb|2LBW|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P-S82w Mutant Length = 121 Back     alignment and structure
>pdb|1E7K|A Chain A, Crystal Structure Of The Spliceosomal 15.5kd Protein Bound To A U4 Snrna Fragment Length = 128 Back     alignment and structure
>pdb|2OZB|A Chain A, Structure Of A Human Prp31-15.5k-U4 Snrna Complex Length = 130 Back     alignment and structure
>pdb|2JNB|A Chain A, Solution Structure Of Rna-Binding Protein 15.5k Length = 144 Back     alignment and structure
>pdb|2ALE|A Chain A, Crystal Structure Of Yeast Rna Splicing Factor Snu13p Length = 134 Back     alignment and structure
>pdb|1ZWZ|A Chain A, Structural Comparison Of Yeast Snornp And Splicesomal Protein Snu13p With Its Homologs Length = 126 Back     alignment and structure
>pdb|3PAF|A Chain A, M. Jannaschii L7ae Mutant Length = 117 Back     alignment and structure
>pdb|2AIF|A Chain A, Crystal Structure Of High Mobility Like Protein, Nhp2, Putative From Cryptosporidium Parvum Length = 135 Back     alignment and structure
>pdb|3ID5|C Chain C, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 130 Back     alignment and structure
>pdb|1SDS|A Chain A, Structure Of Protein L7ae Bound To A K-Turn Derived From An Archaeal Box HACA SRNA Length = 117 Back     alignment and structure
>pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein Length = 120 Back     alignment and structure
>pdb|1RLG|A Chain A, Molecular Basis Of Box CD RNA-Protein Interaction: Co- Crystal Structure Of The Archaeal Srnp Intiation Complex Length = 119 Back     alignment and structure
>pdb|2FC3|A Chain A, Crystal Structure Of The Extremely Thermostable Aeropyrum Pernix L7ae Multifunctional Protein Length = 124 Back     alignment and structure
>pdb|2HVY|D Chain D, Crystal Structure Of An HACA BOX RNP FROM PYROCOCCUS FURIOSUS Length = 130 Back     alignment and structure
>pdb|1PXW|A Chain A, Crystal Structure Of L7ae Srnp Core Protein From Pyrococcus Abyssii Length = 128 Back     alignment and structure
>pdb|3LWO|C Chain C, Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONTAINING 5BRU Length = 123 Back     alignment and structure
>pdb|3NMU|C Chain C, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 129 Back     alignment and structure
>pdb|3HJW|C Chain C, Structure Of A Functional Ribonucleoprotein Pseudouridine Synthase Bound To A Substrate Rna Length = 120 Back     alignment and structure
>pdb|2CZW|A Chain A, Crystal Structure Analysis Of Protein Component Ph1496p Of P.Horikoshii Ribonuclease P Length = 124 Back     alignment and structure
>pdb|3O85|A Chain A, Giardia Lamblia 15.5kd Rna Binding Protein Length = 122 Back     alignment and structure
>pdb|1S72|F Chain F, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 120 Back     alignment and structure
>pdb|3G4S|F Chain F, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 119 Back     alignment and structure
>pdb|1FFK|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 119 Back     alignment and structure
>pdb|3ZF7|XX Chain x, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 276 Back     alignment and structure
>pdb|4A17|F Chain F, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 255 Back     alignment and structure
>pdb|3IZR|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 258 Back     alignment and structure
>pdb|2ZKR|FF Chain f, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 266 Back     alignment and structure
>pdb|3IZS|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 256 Back     alignment and structure
>pdb|1S1I|G Chain G, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 119 Back     alignment and structure
>pdb|3JYW|G Chain G, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 113 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 1e-37
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 1e-35
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 9e-35
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 2e-34
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 7e-31
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 1e-27
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 8e-27
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 1e-26
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 5e-26
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 8e-22
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 1e-21
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 1e-20
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 3e-20
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 6e-20
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 1e-19
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 3e-19
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 8e-13
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 8e-10
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 3e-08
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 2e-06
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 2e-06
1w41_A101 50S ribosomal protein L30E; electrostatic interact 6e-06
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 9e-06
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 1e-05
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 2e-05
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 1e-04
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
 Score =  125 bits (314), Expect = 1e-37
 Identities = 43/151 (28%), Positives = 76/151 (50%), Gaps = 9/151 (5%)

Query: 1   MGSDSEAERTPHKDEKKKIVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVK 60
           MG       +  ++ +     + P A PLA   L+K+ L LV+++  +K L++G  E  K
Sbjct: 1   MGHHHHHHSSGIEEGRMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATK 60

Query: 61  SIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLV 120
           ++ RG     V+A +  P+++I H+P+LCE+ ++PY++V SK+ L  A    RP     V
Sbjct: 61  TLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSV 120

Query: 121 LTKPTKGELGQEEQDKLKADYTLVVEDVKEL 151
             K         E  +LK     + + ++ L
Sbjct: 121 TIK---------EGSQLKQQIQSIQQSIERL 142
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 266 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Length = 255 Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Length = 143 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Length = 167 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 100.0
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 100.0
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 100.0
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 100.0
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 99.97
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.96
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.95
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.95
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.94
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.94
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.93
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.92
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.92
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.92
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.91
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.91
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.91
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.91
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.9
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.89
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.87
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.86
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.86
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.85
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 99.84
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.82
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 99.81
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 99.61
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 99.5
3ir9_A166 Peptide chain release factor subunit 1; structural 96.29
1x52_A124 Pelota homolog, CGI-17; ERF1_3 domain, structural 95.08
3nk6_A 277 23S rRNA methyltransferase; nosiheptide, nosihepti 94.15
3e20_C441 Eukaryotic peptide chain release factor subunit 1; 92.36
3agk_A373 Peptide chain release factor subunit 1; translatio 92.32
3oby_A352 Protein pelota homolog; SM fold, hydrolase; 2.90A 92.24
2qi2_A347 Pelota, cell division protein pelota related prote 92.11
3j15_A357 Protein pelota; ribosome recycling, ribosome, arch 91.74
1gz0_A 253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 91.58
1dt9_A437 ERF1, protein (eukaryotic peptide chain release fa 91.0
3obw_A364 Protein pelota homolog; SM fold, hydrolase; 2.60A 90.92
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 90.5
3agj_B358 Protein pelota homolog; GTP binding, translation-h 89.85
2vgn_A386 DOM34; translation termination factor, protein bio 89.78
3mca_B390 Protein DOM34, elongation factor 1 alpha-like prot 89.47
1ipa_A 274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 88.94
2ohw_A133 YUEI protein; structural genomics, PSI-2, protein 88.74
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural ge 88.74
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 88.29
1x7o_A 287 Avirb, rRNA methyltransferase; SPOU, C-terminal kn 81.53
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 80.46
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
Probab=100.00  E-value=2.2e-33  Score=208.84  Aligned_cols=119  Identities=32%  Similarity=0.597  Sum_probs=111.4

Q ss_pred             cCcccCCCCChHHHHHHHHHHHHHHhcCCccccHHHHHHHHHcCCccEEEEeCCCCchhHHhhHHHHhHhcCCCceeeCC
Q 031617           22 LAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVAS  101 (156)
Q Consensus        22 ~~~~a~Pl~~~~l~~ki~~lL~~A~kag~lv~G~~~v~kaI~k~kakLVIIA~D~~p~~~~~~l~~lc~~~nIP~i~v~s  101 (156)
                      ++|||+|||+++++++++++|++|+++|+++.|.++|+++|++|+++|||||+|++|.+++.+|+.+|+++||||++++|
T Consensus         3 ~~~~a~p~a~~~l~~kil~~L~lA~kagklv~G~~~v~kai~~gka~lViiA~D~~p~~~~~~l~~lc~~~~VP~~~v~s   82 (122)
T 3o85_A            3 IDPRAIPFANEELSLELLNLVKHGASLQAIKRGANEALKQVNRGKAELVIIAADADPIEIVLHLPLACEDKGVPYVFIGS   82 (122)
T ss_dssp             CCTTSCSBCCHHHHHHHHHHHHHHHHTTCEEESHHHHHHHHHTTCCSEEEEETTCSSGGGGTTHHHHHHTTTCCEEEESC
T ss_pred             CCCccCCCCCHHHHHHHHHHHHHHHHhCCEeEcHHHHHHHHHcCCceEEEEeCCCChHHHHHHHHHHHHHhCCCEEEECC
Confidence            68999999999999999999999999999999999999999999999999999999977789999999999999999999


Q ss_pred             HHHHHhhcCCcCceEEEEEecCCCCCCcchHHHHhhHHHHHHHHHHHHhh
Q 031617          102 KEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKEL  151 (156)
Q Consensus       102 k~eLG~a~G~~~~~svvaI~d~~~~~~~~~~~~~~~~~~y~e~~~~i~~~  151 (156)
                      +.+||++||+++++++++|+|+++           |++.|+++...|+++
T Consensus        83 k~eLG~a~Gk~~~vs~vaI~d~~~-----------~~~~~~~~~~~i~~~  121 (122)
T 3o85_A           83 KNALGRACNVSVPTIVASIGKHDA-----------LGNVVAEIVGKVEAL  121 (122)
T ss_dssp             HHHHHHHTTCSSCCSEEEECCCTT-----------THHHHHHHHHHHHTT
T ss_pred             HHHHHHHhCCCCCEEEEEEEcccc-----------hHHHHHHHHHHHHhh
Confidence            999999999999999999999874           566777777777654
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 Back     alignment and structure
>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Back     alignment and structure
>3e20_C Eukaryotic peptide chain release factor subunit 1; SUP35, SUP45, translation termination, peptide release, GTP- nucleotide-binding; 3.50A {Schizosaccharomyces pombe} Back     alignment and structure
>3agk_A Peptide chain release factor subunit 1; translation; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Back     alignment and structure
>3j15_A Protein pelota; ribosome recycling, ribosome, archaea, translation-transport complex; HET: ADP; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>1dt9_A ERF1, protein (eukaryotic peptide chain release factor subunit 1); tRNA mimicry, protein sythesis, STOP codon recognition, peptidyl-tRNA hydrolysis; 2.70A {Homo sapiens} SCOP: c.55.4.2 d.79.3.2 d.91.1.1 PDB: 3e1y_A* 2ktu_A 2ktv_A 2lgt_A 2hst_A Back     alignment and structure
>3obw_A Protein pelota homolog; SM fold, hydrolase; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>3agj_B Protein pelota homolog; GTP binding, translation-hydrolase complex; HET: GTP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2vgn_A DOM34; translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation; 2.5A {Saccharomyces cerevisiae} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 PDB: 2vgm_A 3izq_0 3j16_A* Back     alignment and structure
>3mca_B Protein DOM34, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>2ohw_A YUEI protein; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.40A {Bacillus subtilis} SCOP: d.79.8.1 Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, P structure initiative, PSI, joint center for structural GENO lyase; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure
>1x7o_A Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 5e-30
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 7e-30
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 9e-26
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 2e-23
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 2e-23
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 6e-23
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 1e-21
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 7e-16
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 4e-15
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 6e-15
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

 Score =  103 bits (259), Expect = 5e-30
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 24  PIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVIT 83
           P A PLA   L+++ L +V++AA  + LK+G  E  K++ RG     ++A +  PI+++ 
Sbjct: 6   PKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILL 65

Query: 84  HVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTL 143
           H+P+LCE+ ++PY++V S+  L  A    RP     +            +   +K     
Sbjct: 66  HLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASIT---------TNDASAIKTQIYA 116

Query: 144 VVEDVKEL 151
           V + ++ L
Sbjct: 117 VKDKIETL 124
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d2alea1126 Small nuclear ribonucleoprotein-associated protein 100.0
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 100.0
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 99.97
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.96
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.96
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.96
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.94
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.91
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.9
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.89
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 97.52
d1dt9a2146 C-terminal domain of eukaryotic peptide chain rele 96.1
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 95.44
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 95.11
d2qi2a395 Cell division protein pelota {Thermoplasma acidoph 94.91
d1ipaa2105 RrmA (RrmH), N-terminal domain {Thermus thermophil 94.08
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus 86.56
d1b93a_148 Methylglyoxal synthase, MgsA {Escherichia coli [Ta 86.23
d1vmda_156 Methylglyoxal synthase, MgsA {Thermotoga maritima 85.2
d2qy9a2211 GTPase domain of the signal recognition particle r 80.19
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

Probab=100.00  E-value=3.3e-34  Score=212.74  Aligned_cols=125  Identities=30%  Similarity=0.589  Sum_probs=114.9

Q ss_pred             hhccCcccCCCCChHHHHHHHHHHHHHHhcCCccccHHHHHHHHHcCCccEEEEeCCCCchhHHhhHHHHhHhcCCCcee
Q 031617           19 IVSLAPIAKPLAGKKLSKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIY   98 (156)
Q Consensus        19 ~~~~~~~a~Pl~~~~l~~ki~~lL~~A~kag~lv~G~~~v~kaI~k~kakLVIIA~D~~p~~~~~~l~~lc~~~nIP~i~   98 (156)
                      |++++|+|+||++++++++++++|++|+++|+++.|.++|+|+|++|+++|||||+|++|.+++.|++.+|++++|||++
T Consensus         1 ~~~~~~~a~P~a~~~l~~~i~~ll~~a~~~~~l~~G~~ev~K~i~~g~a~lVviA~D~~p~~~~~~l~~lc~~~~Ip~~~   80 (126)
T d2alea1           1 MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVF   80 (126)
T ss_dssp             CCCCCTTCCSBCCHHHHHHHHHHHHHHHHTTCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTCCEEE
T ss_pred             CCCCCCccCCCCCHHHHHHHHHHHHHHHHcCCcccCHHHHHHHHHcCCCeEEEEeCCCChHHHHHHHHHHHhccCCCEEE
Confidence            57899999999999999999999999999999999999999999999999999999999988999999999999999999


Q ss_pred             eCCHHHHHhhcCCcCceEEEEEecCCCCCCcchHHHHhhHHHHHHHHHHHHhhh
Q 031617           99 VASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELA  152 (156)
Q Consensus        99 v~sk~eLG~a~G~~~~~svvaI~d~~~~~~~~~~~~~~~~~~y~e~~~~i~~~~  152 (156)
                      ++++.+||++||+++++++++|.+++.+         .+.+.|+++.+.|++|.
T Consensus        81 v~sk~~LG~a~G~~~~~~~~~i~~~~~~---------~~~~~~~~i~~~i~~L~  125 (126)
T d2alea1          81 VPSRVALGRACGVSRPVIAASITTNDAS---------AIKTQIYAVKDKIETLL  125 (126)
T ss_dssp             ESCHHHHHHHTTCSSCCSEEEEECCTTC---------TTHHHHHHHHHHHHHHH
T ss_pred             ECchhHHHHHhCCCCCeEEEEEeccchH---------HHHHHHHHHHHHHHhhc
Confidence            9999999999999998888888776543         34667788888887763
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b93a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure