Citrus Sinensis ID: 031654
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 155 | ||||||
| 255580688 | 585 | dead box ATP-dependent RNA helicase, put | 0.896 | 0.237 | 0.427 | 1e-27 | |
| 356530675 | 611 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.896 | 0.227 | 0.427 | 3e-27 | |
| 224139932 | 611 | predicted protein [Populus trichocarpa] | 0.896 | 0.227 | 0.432 | 4e-27 | |
| 224088162 | 509 | predicted protein [Populus trichocarpa] | 0.896 | 0.273 | 0.427 | 6e-27 | |
| 356500387 | 611 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.896 | 0.227 | 0.421 | 2e-26 | |
| 356525235 | 619 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.896 | 0.224 | 0.430 | 4e-26 | |
| 225435708 | 612 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.896 | 0.227 | 0.414 | 8e-26 | |
| 225441549 | 622 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.896 | 0.223 | 0.411 | 8e-26 | |
| 356512483 | 614 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.896 | 0.226 | 0.424 | 8e-26 | |
| 356540089 | 604 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.677 | 0.173 | 0.490 | 2e-25 |
| >gi|255580688|ref|XP_002531166.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223529236|gb|EEF31209.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 127 bits (319), Expect = 1e-27, Method: Compositional matrix adjust.
Identities = 82/192 (42%), Positives = 98/192 (51%), Gaps = 53/192 (27%)
Query: 11 FASENAAPASSSTNTLSSPAARFAYVP--QHLRNKPRTYKYVKPTPVQRHATSILVAGRD 68
F + P +S + + P FA + + L R KYVKPTPVQR+A I++AGRD
Sbjct: 108 FDAYEDIPVETSGDNVPPPVNTFAEIDLGEALNQNIRRCKYVKPTPVQRNAIPIILAGRD 167
Query: 69 LMACAQTGSRKTTPFCFPIINGIMREYYSAR----------------------------- 99
LMACAQTGS KT FCFPII+GIMRE Y R
Sbjct: 168 LMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGPRTVYPLALILSPTRELSCQIHDEAK 227
Query: 100 --------------------KELRELARWVDNLMATLRRLVNLLERGRVSLQMIIRYLAL 139
++LREL R VD L+AT RLV+LLER R+SLQM IRYLAL
Sbjct: 228 KFSYQTGVKVVVAYGGAPINQQLRELERGVDILVATPGRLVDLLERARISLQM-IRYLAL 286
Query: 140 KEAADQTLDMAL 151
E AD+ LDM
Sbjct: 287 DE-ADRMLDMGF 297
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356530675|ref|XP_003533906.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224139932|ref|XP_002323346.1| predicted protein [Populus trichocarpa] gi|222867976|gb|EEF05107.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224088162|ref|XP_002308349.1| predicted protein [Populus trichocarpa] gi|222854325|gb|EEE91872.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356500387|ref|XP_003519013.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356525235|ref|XP_003531232.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225435708|ref|XP_002283489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37 [Vitis vinifera] gi|147854540|emb|CAN78578.1| hypothetical protein VITISV_013679 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225441549|ref|XP_002281113.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356512483|ref|XP_003524948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540089|ref|XP_003538523.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 155 | ||||||
| DICTYBASE|DDB_G0283661 | 712 | ddx3 "DEAD/DEAH box helicase" | 0.290 | 0.063 | 0.666 | 2.4e-21 | |
| RGD|1564771 | 662 | Ddx3x "DEAD (Asp-Glu-Ala-Asp) | 0.393 | 0.092 | 0.467 | 1.2e-19 | |
| FB|FBgn0263231 | 798 | bel "belle" [Drosophila melano | 0.322 | 0.062 | 0.6 | 2.1e-19 | |
| UNIPROTKB|G5E631 | 661 | DDX3X "Uncharacterized protein | 0.393 | 0.092 | 0.467 | 3e-19 | |
| UNIPROTKB|F1RX16 | 661 | DDX3X "Uncharacterized protein | 0.393 | 0.092 | 0.467 | 3e-19 | |
| UNIPROTKB|J9P0V9 | 662 | DDX3X "Uncharacterized protein | 0.393 | 0.092 | 0.467 | 3e-19 | |
| UNIPROTKB|O00571 | 662 | DDX3X "ATP-dependent RNA helic | 0.393 | 0.092 | 0.467 | 3e-19 | |
| MGI|MGI:103064 | 662 | Ddx3x "DEAD/H (Asp-Glu-Ala-Asp | 0.393 | 0.092 | 0.467 | 3e-19 | |
| UNIPROTKB|E2RRQ7 | 706 | DDX3X "Uncharacterized protein | 0.393 | 0.086 | 0.467 | 3.9e-19 | |
| ASPGD|ASPL0000077157 | 668 | AN10557 [Emericella nidulans ( | 0.509 | 0.118 | 0.419 | 4.4e-19 |
| DICTYBASE|DDB_G0283661 ddx3 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 157 (60.3 bits), Expect = 2.4e-21, Sum P(3) = 2.4e-21
Identities = 30/45 (66%), Positives = 35/45 (77%)
Query: 48 KYVKPTPVQRHATSILVAGRDLMACAQTGSRKTTPFCFPIINGIM 92
KY KPTPVQ+ A I++ RDLMACAQTGS KT F FPII+GI+
Sbjct: 266 KYTKPTPVQKSALPIILKNRDLMACAQTGSGKTAAFLFPIISGIL 310
|
|
| RGD|1564771 Ddx3x "DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0263231 bel "belle" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E631 DDX3X "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RX16 DDX3X "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P0V9 DDX3X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00571 DDX3X "ATP-dependent RNA helicase DDX3X" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:103064 Ddx3x "DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRQ7 DDX3X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000077157 AN10557 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00160548 | hypothetical protein (611 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 155 | |||
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 2e-14 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 2e-12 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 5e-10 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 7e-08 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 2e-07 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 4e-07 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 4e-07 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 7e-07 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-05 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 1e-05 |
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
Score = 66.7 bits (164), Expect = 2e-14
Identities = 44/144 (30%), Positives = 64/144 (44%), Gaps = 43/144 (29%)
Query: 47 YKYVKPTPVQRHATSILVAGRDLMACAQTGSRKTTPFCFPIINGIMREYY---------- 96
+ KPTP+Q A L++GRD++ AQTGS KT F PI+ +
Sbjct: 17 LGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEKLDPSPKKDGPQALILA 76
Query: 97 -------------------------------SARKELRELARWVDNLMATLRRLVNLLER 125
S K++R+L R ++AT RL++LLER
Sbjct: 77 PTRELALQIAEVARKLGKHTNLKVVVIYGGTSIDKQIRKLKRGPHIVVATPGRLLDLLER 136
Query: 126 GRVSLQMIIRYLALKEAADQTLDM 149
G++ L ++YL L E AD+ LDM
Sbjct: 137 GKLDLSK-VKYLVLDE-ADRMLDM 158
|
A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 155 | |||
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| PTZ00110 | 545 | helicase; Provisional | 100.0 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 100.0 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.98 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.98 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.97 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.97 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.97 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.96 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.96 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 99.96 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.96 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 99.96 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.96 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.96 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.96 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.96 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.95 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.95 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.94 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.93 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.92 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.92 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.92 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.91 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.91 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.9 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.89 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.87 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.87 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.86 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.86 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.86 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.85 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.85 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.84 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 99.84 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.81 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.79 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.79 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.78 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.77 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.77 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.77 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.77 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.76 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.75 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.72 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.63 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.62 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.61 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.56 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.55 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.53 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.52 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.5 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.5 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 99.49 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.44 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.42 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.42 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.42 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.41 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.4 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.34 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.32 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.32 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.28 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.27 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.26 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.25 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.24 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.23 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.2 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 99.2 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.16 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.12 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.11 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.09 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.07 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.02 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 98.99 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.95 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 98.91 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 98.88 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.88 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.87 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 98.82 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.81 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.77 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.66 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.66 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 98.61 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.52 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 98.52 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 98.5 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 98.49 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.43 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 98.42 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 98.41 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 98.34 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.34 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.3 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 98.27 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 98.26 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 98.24 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.16 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 98.13 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.13 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.1 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 98.07 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 98.06 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 98.06 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.01 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.01 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 97.88 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 97.86 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 97.85 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 97.82 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.81 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.76 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 97.65 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.65 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.63 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.63 | |
| PRK08181 | 269 | transposase; Validated | 97.63 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 97.63 | |
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 97.56 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 97.55 | |
| PRK06526 | 254 | transposase; Provisional | 97.53 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 97.48 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 97.48 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 97.42 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 97.36 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 97.36 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 97.32 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 97.31 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 97.29 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 97.23 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.2 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 97.12 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.1 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 97.08 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.08 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 97.03 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 96.98 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 96.97 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 96.94 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.9 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.89 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.88 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.85 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 96.85 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.83 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 96.8 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 96.8 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.79 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.78 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.77 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.77 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.76 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 96.74 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.73 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.7 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 96.67 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.57 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 96.53 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 96.51 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.49 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.49 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 96.46 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 96.44 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 96.4 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.38 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.34 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 96.28 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 96.27 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 96.22 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 96.2 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 96.17 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.15 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.14 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.11 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 96.09 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.08 | |
| KOG1133 | 821 | consensus Helicase of the DEAD superfamily [Replic | 96.05 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.04 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.03 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 95.99 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 95.98 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.93 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.88 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 95.84 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.83 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.82 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 95.75 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.74 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.74 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.73 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 95.73 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.73 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 95.69 | |
| KOG1131 | 755 | consensus RNA polymerase II transcription initiati | 95.68 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.64 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.63 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 95.61 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.56 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 95.55 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 95.54 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 95.48 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.44 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.44 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 95.43 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.41 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 95.41 | |
| PHA02244 | 383 | ATPase-like protein | 95.38 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.37 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.34 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.34 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.32 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.3 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.26 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 95.22 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 95.21 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 95.2 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 95.18 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.15 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 95.09 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 95.07 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.07 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 95.02 | |
| KOG2340 | 698 | consensus Uncharacterized conserved protein [Funct | 95.0 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 94.98 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 94.98 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 94.97 | |
| KOG3089 | 271 | consensus Predicted DEAD-box-containing helicase [ | 94.9 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 94.79 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 94.78 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.78 | |
| PF13479 | 213 | AAA_24: AAA domain | 94.73 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 94.66 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 94.6 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 94.59 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 94.48 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.46 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 94.46 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 94.42 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 94.4 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 94.35 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 94.27 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.25 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 94.23 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 94.2 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 94.19 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 94.17 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 94.16 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 94.13 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 94.1 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 94.08 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 94.06 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 94.06 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.04 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 94.02 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 94.01 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 93.99 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 93.98 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 93.96 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 93.86 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 93.82 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 93.81 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 93.8 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.76 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 93.73 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 93.73 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 93.71 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 93.67 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 93.66 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 93.6 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 93.49 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 93.42 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.4 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 93.32 | |
| PRK13880 | 636 | conjugal transfer coupling protein TraG; Provision | 93.26 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 93.22 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 93.17 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 93.15 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 93.14 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.11 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 93.06 | |
| PRK13876 | 663 | conjugal transfer coupling protein TraG; Provision | 92.99 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 92.98 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 92.91 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 92.87 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 92.87 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 92.85 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.7 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 92.69 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 92.67 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 92.65 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 92.63 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 92.63 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 92.56 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 92.56 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 92.55 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 92.55 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 92.55 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 92.52 | |
| COG1674 | 858 | FtsK DNA segregation ATPase FtsK/SpoIIIE and relat | 92.49 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 92.41 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 92.41 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 92.36 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 92.35 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 92.32 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 92.18 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 92.16 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 92.1 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 92.07 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 92.01 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 91.98 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 91.97 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 91.96 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 91.77 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 91.74 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 91.72 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 91.7 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 91.68 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 91.68 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 91.64 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 91.62 | |
| TIGR02767 | 623 | TraG-Ti Ti-type conjugative transfer system protie | 91.61 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 91.56 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 91.53 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 91.5 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 91.49 | |
| COG3421 | 812 | Uncharacterized protein conserved in bacteria [Fun | 91.46 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 91.4 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 91.4 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 91.31 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 91.29 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 91.29 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 91.29 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 91.28 | |
| PRK13764 | 602 | ATPase; Provisional | 91.26 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 91.24 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 91.23 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 91.19 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 91.12 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 91.1 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 91.1 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 91.1 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 91.06 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 90.96 | |
| PF13337 | 457 | Lon_2: Putative ATP-dependent Lon protease | 90.95 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 90.91 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 90.9 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 90.88 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 90.88 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 90.88 | |
| PRK13822 | 641 | conjugal transfer coupling protein TraG; Provision | 90.87 | |
| PHA01747 | 425 | putative ATP-dependent protease | 90.81 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 90.79 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 90.78 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 90.75 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 90.72 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 90.71 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 90.56 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 90.5 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 90.41 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 90.39 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 90.38 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 90.36 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 90.27 | |
| KOG2373 | 514 | consensus Predicted mitochondrial DNA helicase twi | 90.17 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 90.16 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 90.16 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 90.11 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 90.07 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 90.03 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 90.02 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 89.97 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 89.92 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 89.92 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 89.9 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 89.85 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 89.8 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 89.75 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 89.75 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.74 | |
| PHA00012 | 361 | I assembly protein | 89.73 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 89.67 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 89.61 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 89.56 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 89.49 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 89.38 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 89.35 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 89.25 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 89.24 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 89.23 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 89.22 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 89.19 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 89.18 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 89.1 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 89.07 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 89.05 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 88.9 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 88.84 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 88.68 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 88.65 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 88.61 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 88.58 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 88.55 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 88.45 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 88.43 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 88.32 | |
| PHA00350 | 399 | putative assembly protein | 88.21 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 88.18 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 88.17 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 88.13 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 88.1 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 88.06 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 88.06 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 87.97 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 87.91 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 87.9 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 87.83 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 87.56 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 87.47 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 87.47 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 87.46 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 87.4 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 87.38 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 87.13 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 87.09 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 86.96 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 86.95 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 86.83 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 86.8 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 86.79 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 86.78 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 86.71 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 86.61 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 86.59 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 86.55 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 86.51 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 86.48 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 86.42 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 86.38 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 86.36 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 86.33 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 86.33 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 86.27 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 86.26 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 86.25 | |
| TIGR02759 | 566 | TraD_Ftype type IV conjugative transfer system cou | 86.21 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 86.18 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 86.16 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 86.05 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 86.01 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 85.97 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 85.96 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 85.95 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 85.9 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 85.9 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 85.77 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 85.77 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 85.66 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 85.66 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 85.49 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 85.47 | |
| PF05729 | 166 | NACHT: NACHT domain | 85.46 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 85.38 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 85.37 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 85.31 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 85.28 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 85.27 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 85.15 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 85.14 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 85.12 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 85.05 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 85.02 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 84.99 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 84.94 | |
| TIGR02653 | 675 | Lon_rel_chp conserved hypothetical protein. This m | 84.65 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 84.6 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 84.56 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 84.5 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 84.43 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 84.43 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 84.4 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 84.28 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 84.19 | |
| PRK06620 | 214 | hypothetical protein; Validated | 84.1 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 84.06 |
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.2e-36 Score=245.52 Aligned_cols=148 Identities=38% Similarity=0.547 Sum_probs=138.1
Q ss_pred cccCccccccCCcCcccCCCCCCCCCcccccCC--HHHHHhHHhCCCCCCCHHHHHHHHHHhcCCcEEEEccCCCCcchh
Q 031654 5 WAADSVFASENAAPASSSTNTLSSPAARFAYVP--QHLRNKPRTYKYVKPTPVQRHATSILVAGRDLMACAQTGSRKTTP 82 (155)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~p~~~~~f~~l~--~~l~~~l~~~g~~~pt~iQ~~~i~~~l~g~dvl~~a~TGsGKT~~ 82 (155)
.+..+||.+++++.+.+.|.+.|.++.+|.+.. +.+..+++..||..|||+|+.+||.+..|+|+++||+||||||.|
T Consensus 48 ~~~~~nfd~~~~i~v~~~G~~~p~~i~~f~~~~l~~~l~~ni~~~~~~~ptpvQk~sip~i~~Grdl~acAqTGsGKT~a 127 (482)
T KOG0335|consen 48 ISTGINFDKYNDIPVKVSGRDVPPHIPTFDEAILGEALAGNIKRSGYTKPTPVQKYSIPIISGGRDLMACAQTGSGKTAA 127 (482)
T ss_pred cchhhccCCccceeeeccCCccCCCcccccccchhHHHhhccccccccCCCcceeeccceeecCCceEEEccCCCcchHH
Confidence 567889999999999999999999999999765 888899999999999999999999999999999999999999999
Q ss_pred hhhHHHHHHHHhhhch-------------------------------------------------HHHHHHHhcCCcEEE
Q 031654 83 FCFPIINGIMREYYSA-------------------------------------------------RKELRELARWVDNLM 113 (155)
Q Consensus 83 yllp~l~~l~~~~~~~-------------------------------------------------~~~~~~l~~~~~IlI 113 (155)
||+|+++++....... ..|.+.+.++|||+|
T Consensus 128 FLiPii~~~~~~~~~~~~~~~~~~~P~~lIlapTReL~~Qi~nea~k~~~~s~~~~~~~ygg~~~~~q~~~~~~gcdIlv 207 (482)
T KOG0335|consen 128 FLIPIISYLLDEGPEDRGESGGGVYPRALILAPTRELVDQIYNEARKFSYLSGMKSVVVYGGTDLGAQLRFIKRGCDILV 207 (482)
T ss_pred HHHHHHHHHHhcCcccCcccCCCCCCceEEEeCcHHHhhHHHHHHHhhcccccceeeeeeCCcchhhhhhhhccCccEEE
Confidence 9999999998764422 578888889999999
Q ss_pred EChHHHHHHHHcCCCCcccccceEEEEcccccccc-cccccC
Q 031654 114 ATLRRLVNLLERGRVSLQMIIRYLALKEAADQTLD-MALNQK 154 (155)
Q Consensus 114 ~TP~~l~~~l~~~~~~l~~l~~~lVlDEa~D~ll~-~gf~~~ 154 (155)
+|||||.++++++.+.++++ +||||||| |+|+| |||++|
T Consensus 208 aTpGrL~d~~e~g~i~l~~~-k~~vLDEA-DrMlD~mgF~p~ 247 (482)
T KOG0335|consen 208 ATPGRLKDLIERGKISLDNC-KFLVLDEA-DRMLDEMGFEPQ 247 (482)
T ss_pred ecCchhhhhhhcceeehhhC-cEEEecch-HHhhhhcccccc
Confidence 99999999999999999999 99999999 99999 999986
|
|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >KOG2340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK13880 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13876 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG3421 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PF13337 Lon_2: Putative ATP-dependent Lon protease | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK13822 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PHA01747 putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PHA00012 I assembly protein | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR02653 Lon_rel_chp conserved hypothetical protein | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 155 | ||||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 2e-14 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 1e-11 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 1e-09 | ||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 1e-05 | ||
| 3dkp_A | 245 | Human Dead-Box Rna-Helicase Ddx52, Conserved Domain | 2e-05 | ||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 2e-05 | ||
| 3fe2_A | 242 | Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D | 3e-05 | ||
| 3iuy_A | 228 | Crystal Structure Of Ddx53 Dead-Box Domain Length = | 2e-04 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 4e-04 |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
|
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
| >pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 | Back alignment and structure |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
| >pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 | Back alignment and structure |
| >pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 155 | |||
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 1e-29 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 4e-28 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 4e-26 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 1e-24 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 1e-22 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 2e-22 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 6e-17 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 3e-15 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 6e-15 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 4e-14 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 1e-13 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 6e-13 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 1e-11 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 4e-11 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 2e-10 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 1e-09 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 2e-09 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 6e-09 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 8e-09 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 1e-08 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 1e-08 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 2e-08 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 2e-08 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 2e-08 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 9e-08 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 8e-07 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-06 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 5e-06 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 5e-06 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 7e-06 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 2e-04 |
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
Score = 107 bits (269), Expect = 1e-29
Identities = 47/161 (29%), Positives = 72/161 (44%), Gaps = 50/161 (31%)
Query: 37 PQHLRNKPRTYKYVKPTPVQRHATSILVAGRDLMACAQTGSRKTTPFCFPIINGIM---- 92
+RN Y +PTP+Q++A ++ RD+MACAQTGS KT F PIIN ++
Sbjct: 31 DPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDL 90
Query: 93 -------------------RE-----YYSARK--------------------ELRELARW 108
RE ++K ++RE+
Sbjct: 91 NQQRYSKTAYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMG 150
Query: 109 VDNLMATLRRLVNLLERGRVSLQMIIRYLALKEAADQTLDM 149
L+AT RLV+ +E+ ++SL+ +Y+ L E AD+ LDM
Sbjct: 151 CHLLVATPGRLVDFIEKNKISLEF-CKYIVLDE-ADRMLDM 189
|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 155 | |||
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 100.0 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.97 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.97 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.96 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.96 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.96 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.96 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.95 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.95 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.95 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.95 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.95 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.95 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.95 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.95 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.95 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.94 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.94 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.92 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.91 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.91 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.91 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.9 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.9 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.9 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.9 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.89 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.89 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.88 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.83 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.83 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.83 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.83 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.83 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.83 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.82 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.81 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.81 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.81 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.8 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.79 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.79 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.78 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.78 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.78 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.78 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.78 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.77 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.77 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.73 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.73 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.72 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.71 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.71 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.71 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.67 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.64 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.57 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.55 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.54 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.5 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.49 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.49 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.49 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.48 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.47 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.44 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.35 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.34 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.34 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.32 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.29 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.28 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.13 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.01 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.0 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 98.72 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.68 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 98.54 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 98.49 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 98.43 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 98.13 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 97.86 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.84 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.73 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.08 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.02 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.7 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 96.68 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.68 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.64 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.54 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.46 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.45 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 96.4 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 96.31 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.12 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 96.09 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.0 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.0 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.97 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.88 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 95.81 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 95.75 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 95.72 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.65 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.59 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 95.55 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.35 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.32 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.01 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 94.93 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.8 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.77 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 94.75 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.22 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 94.21 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 94.1 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.08 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 93.94 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 93.93 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 92.62 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 92.49 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 92.36 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 92.3 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.24 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 92.23 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 92.23 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 92.17 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 92.16 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 92.13 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 92.02 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 91.98 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 91.59 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 91.55 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 91.29 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 91.26 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 90.82 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 90.72 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 90.7 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 90.37 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 90.31 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 90.21 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 90.19 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 90.14 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 89.85 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 89.82 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 89.73 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 89.71 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 89.62 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 89.6 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 89.51 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 89.45 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 89.41 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 89.37 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 89.34 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 89.33 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 89.28 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 89.28 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 89.27 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 89.24 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 89.21 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 89.16 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 89.16 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 89.08 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 89.02 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 88.97 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 88.9 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 88.89 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.81 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.76 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 88.75 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 88.62 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 88.53 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 88.44 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 88.33 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 88.29 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 88.23 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 88.17 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 88.16 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 88.15 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 88.15 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 88.13 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 88.07 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 88.01 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 88.0 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 87.98 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 87.95 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 87.93 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 87.9 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 87.84 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 87.8 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 87.57 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 87.56 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 87.44 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 87.42 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 87.32 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 87.25 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 87.18 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 87.17 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 86.92 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 86.73 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 86.7 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 86.55 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 86.53 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 86.53 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 86.41 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 86.23 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 86.17 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 86.16 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 86.13 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 86.05 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 85.89 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 85.75 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 85.72 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 85.63 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 85.52 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 85.5 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 85.41 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 85.33 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 85.22 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 85.21 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 85.13 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 85.1 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 85.1 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 85.05 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 84.87 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 84.8 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 84.79 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 84.69 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 84.63 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 84.62 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 84.44 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 84.43 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 84.31 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 84.25 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 84.17 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 83.9 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 83.8 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 83.63 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 83.4 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 83.37 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 83.35 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 83.25 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 83.13 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 83.13 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 83.05 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 83.01 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 82.82 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 82.63 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 82.48 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 82.26 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 82.21 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 82.15 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 82.01 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 81.99 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 81.81 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 81.77 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 81.74 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 81.48 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 81.32 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 81.26 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 81.12 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 81.04 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 80.82 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 80.7 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 80.63 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 80.6 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 80.44 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 80.34 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 80.15 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 80.1 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 80.09 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 80.03 |
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-34 Score=234.98 Aligned_cols=149 Identities=29% Similarity=0.514 Sum_probs=134.2
Q ss_pred CCcccCccccccCCcCcccCCCCCCCCCcccccCC--HHHHHhHHhCCCCCCCHHHHHHHHHHhcCCcEEEEccCCCCcc
Q 031654 3 ASWAADSVFASENAAPASSSTNTLSSPAARFAYVP--QHLRNKPRTYKYVKPTPVQRHATSILVAGRDLMACAQTGSRKT 80 (155)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~f~~l~--~~l~~~l~~~g~~~pt~iQ~~~i~~~l~g~dvl~~a~TGsGKT 80 (155)
....++.+|+.++++++.+.|.+.|.++.+|++++ +.++++|+++||.+|||+|+++||.+++|+|++++||||||||
T Consensus 28 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT 107 (434)
T 2db3_A 28 SGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKT 107 (434)
T ss_dssp CCCCCCTTGGGGGGSCEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHH
T ss_pred cCcccccChhhhcCceeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCch
Confidence 34566788999999999999999999999999987 9999999999999999999999999999999999999999999
Q ss_pred hhhhhHHHHHHHHhhhc-------h-------------------------------------HHHHHHHhcCCcEEEECh
Q 031654 81 TPFCFPIINGIMREYYS-------A-------------------------------------RKELRELARWVDNLMATL 116 (155)
Q Consensus 81 ~~yllp~l~~l~~~~~~-------~-------------------------------------~~~~~~l~~~~~IlI~TP 116 (155)
++|++|+++++...... . ..+...+..+++|+|+||
T Consensus 108 ~a~~lpil~~l~~~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp 187 (434)
T 2db3_A 108 AAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATP 187 (434)
T ss_dssp HHHHHHHHHHHHHSCCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECH
T ss_pred HHHHHHHHHHHHhcccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEECh
Confidence 99999999998764321 1 345566667899999999
Q ss_pred HHHHHHHHcCCCCcccccceEEEEccccccccccccc
Q 031654 117 RRLVNLLERGRVSLQMIIRYLALKEAADQTLDMALNQ 153 (155)
Q Consensus 117 ~~l~~~l~~~~~~l~~l~~~lVlDEa~D~ll~~gf~~ 153 (155)
++|.+++.++.+.++++ +++|+||| |+|+++||.+
T Consensus 188 ~~l~~~l~~~~~~l~~~-~~lVlDEa-h~~~~~gf~~ 222 (434)
T 2db3_A 188 GRLLDFVDRTFITFEDT-RFVVLDEA-DRMLDMGFSE 222 (434)
T ss_dssp HHHHHHHHTTSCCCTTC-CEEEEETH-HHHTSTTTHH
T ss_pred HHHHHHHHhCCcccccC-CeEEEccH-hhhhccCcHH
Confidence 99999999999999999 99999999 9999999875
|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 155 | ||||
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 6e-08 | |
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 1e-07 | |
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 7e-07 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 8e-07 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 2e-06 | |
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 2e-06 | |
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 2e-06 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 3e-06 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 4e-06 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 5e-06 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 1e-05 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 5e-05 |
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Helicase-like "domain" of reverse gyrase domain: Helicase-like "domain" of reverse gyrase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 48.0 bits (113), Expect = 6e-08
Identities = 16/88 (18%), Positives = 32/88 (36%), Gaps = 5/88 (5%)
Query: 12 ASENAAPASSSTNTLSSPAARFAYVPQHLRNKPRT----YKYVKPTPVQRHATSILVAGR 67
A+ AA A+++ ++ AA P+ K +P +Q+ ++
Sbjct: 1 AAAAAAAAAAAAAAAAA-AASLCLFPEDFLLKEFVEFFRKCVGEPRAIQKMWAKRILRKE 59
Query: 68 DLMACAQTGSRKTTPFCFPIINGIMREY 95
A A TG KT+ + ++
Sbjct: 60 SFAATAPTGVGKTSFGLAMSLFLALKGK 87
|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 155 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 100.0 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 100.0 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 100.0 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 100.0 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 100.0 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.97 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.87 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.86 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.84 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.69 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.42 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.1 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.93 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.92 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.87 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.84 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.49 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 98.3 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 98.06 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.95 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 97.56 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 97.33 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.01 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.92 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.75 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.49 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.2 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.17 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.96 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 95.84 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.8 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.72 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.71 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.67 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.56 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.4 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.13 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.95 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.94 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.66 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.55 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.45 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 94.32 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.26 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 93.77 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.51 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 93.1 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.83 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 92.34 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.31 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 92.18 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.18 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.16 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.02 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 91.69 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 91.24 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 91.21 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 91.02 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 90.94 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 90.79 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 90.59 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 90.52 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 90.43 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 90.37 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 89.5 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 89.49 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 89.19 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 89.13 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 89.11 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 89.1 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 89.09 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 88.95 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 88.82 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 88.72 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 88.63 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 88.43 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 88.34 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 88.22 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 88.05 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 87.68 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 87.56 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 86.7 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 86.69 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 86.55 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 86.46 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 86.21 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 86.19 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 86.01 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 86.0 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 85.96 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 85.93 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 85.82 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 85.78 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 85.66 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 85.64 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 85.56 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 85.3 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 85.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 84.82 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 84.65 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 84.62 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 84.59 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 84.53 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 84.36 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 84.11 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.57 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 83.54 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 83.3 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 83.12 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 82.71 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 82.69 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 82.58 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 82.57 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 82.45 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 81.96 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 81.8 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 81.79 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 81.43 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 80.8 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 80.2 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.8e-38 Score=237.87 Aligned_cols=124 Identities=23% Similarity=0.409 Sum_probs=113.0
Q ss_pred CCCcccccCC--HHHHHhHHhCCCCCCCHHHHHHHHHHhcCCcEEEEccCCCCcchhhhhHHHHHHHHhhhch-------
Q 031654 28 SPAARFAYVP--QHLRNKPRTYKYVKPTPVQRHATSILVAGRDLMACAQTGSRKTTPFCFPIINGIMREYYSA------- 98 (155)
Q Consensus 28 ~~~~~f~~l~--~~l~~~l~~~g~~~pt~iQ~~~i~~~l~g~dvl~~a~TGsGKT~~yllp~l~~l~~~~~~~------- 98 (155)
+...+|++|+ ++++++|+++||++|||+|++|||.+++|+|++++||||||||+||++|+++++.......
T Consensus 14 ~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~P 93 (222)
T d2j0sa1 14 DVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAP 93 (222)
T ss_dssp CCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECS
T ss_pred CCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecc
Confidence 4456899988 9999999999999999999999999999999999999999999999999999886554332
Q ss_pred --------------------------------HHHHHHHhcCCcEEEEChHHHHHHHHcCCCCcccccceEEEEcccccc
Q 031654 99 --------------------------------RKELRELARWVDNLMATLRRLVNLLERGRVSLQMIIRYLALKEAADQT 146 (155)
Q Consensus 99 --------------------------------~~~~~~l~~~~~IlI~TP~~l~~~l~~~~~~l~~l~~~lVlDEa~D~l 146 (155)
..+...+..++||+|+||+||.+++.++.++++++ +++|+||| |+|
T Consensus 94 treLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l-~~lVlDEa-D~l 171 (222)
T d2j0sa1 94 TRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAI-KMLVLDEA-DEM 171 (222)
T ss_dssp SHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTC-CEEEEETH-HHH
T ss_pred hHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccc-eeeeecch-hHh
Confidence 56667777899999999999999999999999999 99999999 999
Q ss_pred ccccccc
Q 031654 147 LDMALNQ 153 (155)
Q Consensus 147 l~~gf~~ 153 (155)
+++||.+
T Consensus 172 l~~~f~~ 178 (222)
T d2j0sa1 172 LNKGFKE 178 (222)
T ss_dssp TSTTTHH
T ss_pred hhcCcHH
Confidence 9999975
|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|