Citrus Sinensis ID: 031686


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MILSASNGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLGDKLRNQK
ccccccccccccccccccEEEccccccHHHHHHHHHHcccccEEEcccccHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccccccccEEEEEEccccccccccccccHHHHHHHHHHHHcccccccc
cEEEcccccEEEEEEEEEEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHcccccccccEEEEEEccccccccccccccHHHHHHHHHHHHcccccccc
milsasngrfIHALSVFCFIFSDVSFTISVIddfislnkippmitysrettplilnsPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIypklkgqifdyfgVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLgdklrnqk
MILSASNGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYvlngeltlsnvksfaldflgdklrnqk
MILSASNGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLGDKLRNQK
*******GRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLG*******
******NGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFL*DKL****
MILSASNGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLGDKLRNQK
MILSASNGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLGDK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILSASNGRFIHALSVFCFIFSDVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALDFLGDKLRNQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
Q8VX13 579 Protein disulfide isomera no no 0.838 0.224 0.398 6e-20
Q67IX6 563 Protein disulfide isomera yes no 0.845 0.232 0.380 2e-18
Q9FF55 597 Protein disulfide isomera no no 0.838 0.217 0.368 2e-14
P05307 510 Protein disulfide-isomera yes no 0.767 0.233 0.314 7e-08
P04785 509 Protein disulfide-isomera yes no 0.767 0.233 0.307 1e-07
P09103 509 Protein disulfide-isomera yes no 0.767 0.233 0.307 2e-07
Q2HWU2 510 Protein disulfide-isomera N/A no 0.767 0.233 0.307 2e-07
Q5R5B6 508 Protein disulfide-isomera yes no 0.767 0.234 0.307 4e-07
P07237 508 Protein disulfide-isomera yes no 0.767 0.234 0.307 4e-07
P21195 509 Protein disulfide-isomera yes no 0.767 0.233 0.299 4e-07
>sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 84/133 (63%), Gaps = 3/133 (2%)

Query: 23  DVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLK-LLWLFAAVHDSEAK-SIFQET 80
           D +FT + I +F+S NK+P +I ++RE   LI  S +K  L LFA  ++SE      +E 
Sbjct: 291 DGNFTKTAIAEFVSANKVPLVINFTREGASLIFESSVKNQLILFAKANESEKHLPTLREV 350

Query: 81  ARAFKGKLLFVYSQIYPKLKGQ-IFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNV 139
           A++FKGK +FVY Q+  +  G+ +  +FGVT    +V+        +K++L+GELT++N+
Sbjct: 351 AKSFKGKFVFVYVQMDNEDYGEAVSGFFGVTGAAPKVLVYTGNEDMRKFILDGELTVNNI 410

Query: 140 KSFALDFLGDKLR 152
           K+ A DFL DKL+
Sbjct: 411 KTLAEDFLADKLK 423




Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 3EC: .EC: 4EC: .EC: 1
>sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 Back     alignment and function description
>sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 Back     alignment and function description
>sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 Back     alignment and function description
>sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 Back     alignment and function description
>sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 Back     alignment and function description
>sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 Back     alignment and function description
>sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 Back     alignment and function description
>sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
296086024 458 unnamed protein product [Vitis vinifera] 0.838 0.283 0.469 3e-21
147855039 578 hypothetical protein VITISV_036230 [Viti 0.864 0.231 0.455 3e-21
225449060 561 PREDICTED: protein disulfide isomerase-l 0.838 0.231 0.469 4e-21
225435313 577 PREDICTED: protein disulfide isomerase-l 0.825 0.221 0.435 8e-21
297746254 462 unnamed protein product [Vitis vinifera] 0.825 0.277 0.435 9e-21
28140231 447 protein disulphide isomerase, partial [E 0.838 0.290 0.443 7e-20
326531866 587 predicted protein [Hordeum vulgare subsp 0.858 0.226 0.411 6e-19
357472209 583 Protein disulfide isomerase L-2 [Medicag 0.838 0.222 0.383 1e-18
224104643 583 predicted protein [Populus trichocarpa] 0.864 0.229 0.415 2e-18
255578860 575 protein disulfide isomerase, putative [R 0.851 0.229 0.392 3e-18
>gi|296086024|emb|CBI31465.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 83/132 (62%), Gaps = 2/132 (1%)

Query: 23  DVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLK-LLWLFAAVHDSE-AKSIFQET 80
           D  F  S I +F+  NK P +I +++E++  I  +P+K  L LFA   DSE     FQE 
Sbjct: 171 DGQFIKSAIAEFVFANKHPLVIIFTKESSRQIFENPIKKQLLLFATSKDSENVLPQFQEA 230

Query: 81  ARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNVK 140
           A+AFKGKL+FVY ++  K    + DYFGVT    RV+A       KKYVL+GELTL+++K
Sbjct: 231 AKAFKGKLIFVYVEMDNKDGKSVADYFGVTGDAPRVLAYTGNDDAKKYVLDGELTLTSIK 290

Query: 141 SFALDFLGDKLR 152
           SF  DFL DKL+
Sbjct: 291 SFGEDFLEDKLK 302




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147855039|emb|CAN82379.1| hypothetical protein VITISV_036230 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449060|ref|XP_002275017.1| PREDICTED: protein disulfide isomerase-like 1-3-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225435313|ref|XP_002285136.1| PREDICTED: protein disulfide isomerase-like 1-4 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297746254|emb|CBI16310.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|28140231|gb|AAO26314.1| protein disulphide isomerase, partial [Elaeis guineensis] Back     alignment and taxonomy information
>gi|326531866|dbj|BAK01309.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357472209|ref|XP_003606389.1| Protein disulfide isomerase L-2 [Medicago truncatula] gi|355507444|gb|AES88586.1| Protein disulfide isomerase L-2 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224104643|ref|XP_002313512.1| predicted protein [Populus trichocarpa] gi|222849920|gb|EEE87467.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255578860|ref|XP_002530284.1| protein disulfide isomerase, putative [Ricinus communis] gi|223530182|gb|EEF32091.1| protein disulfide isomerase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
TAIR|locus:2082712 579 PDIL1-3 "PDI-like 1-3" [Arabid 0.838 0.224 0.398 4.4e-19
TAIR|locus:2175811 597 PDIL1-4 "PDI-like 1-4" [Arabid 0.838 0.217 0.368 5.9e-15
UNIPROTKB|A6H7J6 510 P4HB "Prolyl 4-hydroxylase, be 0.767 0.233 0.314 1.3e-08
UNIPROTKB|P05307 510 P4HB "Protein disulfide-isomer 0.767 0.233 0.314 1.3e-08
UNIPROTKB|F1PL97 510 P4HB "Uncharacterized protein" 0.761 0.231 0.312 2.2e-08
RGD|3244 509 P4hb "prolyl 4-hydroxylase, be 0.767 0.233 0.307 2.8e-08
MGI|MGI:97464 509 P4hb "prolyl 4-hydroxylase, be 0.767 0.233 0.307 3.6e-08
UNIPROTKB|I3L2P8 450 P4HB "Protein disulfide-isomer 0.761 0.262 0.312 3.7e-08
UNIPROTKB|F5H8J2 451 P4HB "Uncharacterized protein" 0.761 0.261 0.312 3.8e-08
UNIPROTKB|H7BZ94 464 P4HB "Protein disulfide-isomer 0.761 0.254 0.312 3.9e-08
TAIR|locus:2082712 PDIL1-3 "PDI-like 1-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 237 (88.5 bits), Expect = 4.4e-19, P = 4.4e-19
 Identities = 53/133 (39%), Positives = 84/133 (63%)

Query:    23 DVSFTISVIDDFISLNKIPPMITYSRETTPLILNSPLK-LLWLFAAVHDSEAK-SIFQET 80
             D +FT + I +F+S NK+P +I ++RE   LI  S +K  L LFA  ++SE      +E 
Sbjct:   291 DGNFTKTAIAEFVSANKVPLVINFTREGASLIFESSVKNQLILFAKANESEKHLPTLREV 350

Query:    81 ARAFKGKLLFVYSQIYPKLKGQ-IFDYFGVTCYTSRVIAVASIRKRKKYVLNGELTLSNV 139
             A++FKGK +FVY Q+  +  G+ +  +FGVT    +V+        +K++L+GELT++N+
Sbjct:   351 AKSFKGKFVFVYVQMDNEDYGEAVSGFFGVTGAAPKVLVYTGNEDMRKFILDGELTVNNI 410

Query:   140 KSFALDFLGDKLR 152
             K+ A DFL DKL+
Sbjct:   411 KTLAEDFLADKLK 423




GO:0005783 "endoplasmic reticulum" evidence=IEA;IDA
GO:0006662 "glycerol ether metabolic process" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0016853 "isomerase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0003756 "protein disulfide isomerase activity" evidence=ISS
GO:0034976 "response to endoplasmic reticulum stress" evidence=IEP;RCA
GO:0006457 "protein folding" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2175811 PDIL1-4 "PDI-like 1-4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7J6 P4HB "Prolyl 4-hydroxylase, beta subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P05307 P4HB "Protein disulfide-isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PL97 P4HB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|3244 P4hb "prolyl 4-hydroxylase, beta polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97464 P4hb "prolyl 4-hydroxylase, beta polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3L2P8 P4HB "Protein disulfide-isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H8J2 P4HB "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H7BZ94 P4HB "Protein disulfide-isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018195001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (555 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
cd02982103 cd02982, PDI_b'_family, Protein Disulfide Isomeras 4e-10
pfam13848183 pfam13848, Thioredoxin_6, Thioredoxin-like domain 6e-10
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 2e-08
>gnl|CDD|239280 cd02982, PDI_b'_family, Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
 Score = 53.4 bits (129), Expect = 4e-10
 Identities = 36/95 (37%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 57  SPLKLLWLFAAVHDS---EAKSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYT 113
           S   LL LF    DS   E +  F+E A+ FKGKLLFV         G+  +YFG+    
Sbjct: 11  SGKPLLVLFYNKDDSESEELRERFKEVAKKFKGKLLFVVVD--ADDFGRHLEYFGLKEED 68

Query: 114 SRVIAVASIRKRKKYVL-NGELTLSNVKSFALDFL 147
             VIA+ ++   KKY++   ELT  +++ F  DFL
Sbjct: 69  LPVIAIINLSDGKKYLMPEEELTAESLEEFVEDFL 103


Members of this family include PDI, calsequestrin and other PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5 and PDIR. PDI, ERp57, ERp72, P5 and PDIR are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and one or more redox inactive TRX-like (b) domains. The molecular structure of PDI is abb'a'. Also included in this family is the PDI-related protein ERp27, which contains only redox-inactive TRX-like (b and b') domains. The redox inactive domains are implicated in substrate recognition with the b' domain serving as the primary substrate binding site. Only the b' domain is necessary for the binding of small peptide substrates. In addition to the b' domain, other domains are required for the binding of larger polypeptide substrates. The b' domain is also implicated in chaperone activity. Length = 103

>gnl|CDD|222416 pfam13848, Thioredoxin_6, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 99.88
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 99.87
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 99.81
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 99.78
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 99.73
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.71
PTZ00102 477 disulphide isomerase; Provisional 99.69
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 99.59
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.54
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 99.22
cd03071116 PDI_b'_NRX PDIb' family, NRX subgroup, redox inact 98.82
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.7
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.6
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 98.59
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 98.57
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 98.55
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 98.51
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.5
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 98.39
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 98.35
KOG4277 468 consensus Uncharacterized conserved protein, conta 98.33
PRK10996139 thioredoxin 2; Provisional 98.3
PRK09381109 trxA thioredoxin; Provisional 98.3
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 98.25
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.25
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.24
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 98.19
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 98.18
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 98.16
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 98.15
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.13
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 98.1
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.1
PTZ00102477 disulphide isomerase; Provisional 98.09
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.07
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 98.01
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 97.95
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 97.94
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 97.93
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.9
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.89
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 97.88
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 97.87
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.86
PTZ00443224 Thioredoxin domain-containing protein; Provisional 97.85
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 97.71
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 97.69
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 97.67
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 97.67
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 97.66
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 97.6
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 97.58
PF01216 383 Calsequestrin: Calsequestrin; InterPro: IPR001393 97.53
cd0294793 TRX_family TRX family; composed of two groups: Gro 97.53
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 97.51
COG3118 304 Thioredoxin domain-containing protein [Posttransla 97.49
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 97.46
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 97.39
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 97.32
PF13848 184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 97.31
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 97.3
PLN02309457 5'-adenylylsulfate reductase 97.18
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 97.14
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.12
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 97.08
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 97.08
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 97.01
cd02958114 UAS UAS family; UAS is a domain of unknown functio 96.68
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 96.66
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 96.66
PTZ0005198 thioredoxin; Provisional 96.65
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 96.56
cd02962152 TMX2 TMX2 family; composed of proteins similar to 96.48
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 96.41
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 96.36
smart00594122 UAS UAS domain. 96.2
PHA02278103 thioredoxin-like protein 96.19
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 96.12
KOG2603 331 consensus Oligosaccharyltransferase, gamma subunit 96.11
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 95.79
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 95.7
PRK03147173 thiol-disulfide oxidoreductase; Provisional 95.61
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 95.22
KOG4277 468 consensus Uncharacterized conserved protein, conta 94.97
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 94.66
TIGR02740271 TraF-like TraF-like protein. This protein is relat 94.42
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 94.22
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 93.87
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 93.59
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 93.41
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 92.96
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 92.59
PF13728215 TraF: F plasmid transfer operon protein 91.98
PRK00293571 dipZ thiol:disulfide interchange protein precursor 91.45
TIGR02739256 TraF type-F conjugative transfer system pilin asse 90.85
KOG0907106 consensus Thioredoxin [Posttranslational modificat 90.23
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 90.15
PF13778118 DUF4174: Domain of unknown function (DUF4174) 90.15
cd02955124 SSP411 TRX domain, SSP411 protein family; members 90.11
PRK13703248 conjugal pilus assembly protein TraF; Provisional 90.01
PTZ00062204 glutaredoxin; Provisional 88.72
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 88.54
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 88.15
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 87.86
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 87.08
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 86.93
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 84.26
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 82.64
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 82.23
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 81.71
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
Probab=99.88  E-value=4e-22  Score=136.83  Aligned_cols=106  Identities=25%  Similarity=0.235  Sum_probs=94.6

Q ss_pred             eEecCCCchhhhhcCCCceEEEEeecCChhH-HHHHHHHHHh---hcCceEEEEEeCCCcchhhhhhhhCCCCCCcceEE
Q 031686           43 MITYSRETTPLILNSPLKLLWLFAAVHDSEA-KSIFQETARA---FKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIA  118 (155)
Q Consensus        43 v~e~~~~~~~~i~~~~~~~v~lf~~~~~~~~-~~~~~~vA~~---~~~~i~F~~vd~~~~~~~~~~~~~gl~~~~~P~v~  118 (155)
                      |.++|++|+..|++++.|..++|++.++.+. .+.++++|++   +|+++.|+++|++.  +.+.+++||++++++|+++
T Consensus         1 ~~e~t~e~~~~~~~~~~~~~~l~f~~~~~~~~~~~~~~vAk~~~~~kgki~Fv~~d~~~--~~~~~~~fgl~~~~~P~i~   78 (111)
T cd03072           1 VREITFENAEELTEEGLPFLILFHDKDDLESLKEFKQAVARQLISEKGAINFLTADGDK--FRHPLLHLGKTPADLPVIA   78 (111)
T ss_pred             CcccccccHHHHhcCCCCeEEEEecchHHHHHHHHHHHHHHHHHhcCceEEEEEEechH--hhhHHHHcCCCHhHCCEEE
Confidence            5789999999999999999555555556777 9999999999   99999999999997  5679999999988899999


Q ss_pred             EEecCCCeeec-CCCCCCHHHHHHHHHHHHcCC
Q 031686          119 VASIRKRKKYV-LNGELTLSNVKSFALDFLGDK  150 (155)
Q Consensus       119 i~~~~~~~kY~-~~~~~t~~~I~~Fi~~f~~Gk  150 (155)
                      |.+.+++.||+ +++++|+++|.+|+++|++||
T Consensus        79 i~~~~~~~Ky~~~~~~~t~~~i~~Fv~~~~~Gk  111 (111)
T cd03072          79 IDSFRHMYLFPDFEDVYVPGKLKQFVLDLHSGK  111 (111)
T ss_pred             EEcchhcCcCCCCccccCHHHHHHHHHHHhcCC
Confidence            99986557998 677899999999999999996



It contains an N-terminal TRX domain with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. Through the formation of reversible mixed disulfides, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. ERp44 also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Similar to PDI, the b' domain of ERp44 is likely involved in substrate recognition and may be the primary binding site.

>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PF13778 DUF4174: Domain of unknown function (DUF4174) Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
2k18_A228 Solution Structure Of Bb' Domains Of Human Protein 6e-08
3uem_A 361 Crystal Structure Of Human Pdi Bb'a' Domains Length 6e-08
3bj5_A147 Alternative Conformations Of The X Region Of Human 8e-06
>pdb|2K18|A Chain A, Solution Structure Of Bb' Domains Of Human Protein Disulfide Isomerase Length = 228 Back     alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 8/127 (6%) Query: 33 DFISLNKIPPMITYSRETTPLILNSPLK---LLWLFAAVHDSEAK-SIFQETARAFKGKL 88 DFI N++P +I ++ +T P I +K LL+L +V D + K S F+ A +FKGK+ Sbjct: 98 DFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKI 157 Query: 89 LFVYSQIYPKLKGQIFDYFGV---TCYTSRVIAVASIRKRKKYVLNGELTLSNVKSFALD 145 LF++ +I ++FG+ C R+I + + K + ELT + F Sbjct: 158 LFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPE-SEELTAERITEFCHR 216 Query: 146 FLGDKLR 152 FL K++ Sbjct: 217 FLEGKIK 223
>pdb|3UEM|A Chain A, Crystal Structure Of Human Pdi Bb'a' Domains Length = 361 Back     alignment and structure
>pdb|3BJ5|A Chain A, Alternative Conformations Of The X Region Of Human Protein Disulphide- Isomerase Modulate Exposure Of The Substrate Binding B' Domain Length = 147 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 9e-15
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 1e-14
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 1e-14
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 1e-12
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 3e-12
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 9e-10
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 4e-09
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 4e-05
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Length = 147 Back     alignment and structure
 Score = 66.2 bits (161), Expect = 9e-15
 Identities = 27/127 (21%), Positives = 51/127 (40%), Gaps = 6/127 (4%)

Query: 31  IDDFISLNKIPPMITYSRETTPLILNSPLKLLWLFAAVHDSEA----KSIFQETARAFKG 86
               +  N++P +I ++ +T P I    +K   L              S F+  A +FKG
Sbjct: 4   HHHHMKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKG 63

Query: 87  KLLFVYSQIYPKLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVL--NGELTLSNVKSFAL 144
           K+LF +         +I ++FG+       + + ++ +        + ELT   +  F  
Sbjct: 64  KILFAFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCH 123

Query: 145 DFLGDKL 151
            FL  K+
Sbjct: 124 RFLEGKI 130


>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Length = 133 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Length = 252 Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Length = 250 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 99.93
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.92
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 99.91
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 99.91
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.85
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 99.83
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.83
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 99.81
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.81
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.79
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.76
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.28
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 98.96
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.88
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.84
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 98.83
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 98.74
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 98.73
2yzu_A109 Thioredoxin; redox protein, electron transport, st 98.63
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 98.62
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.61
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 98.6
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 98.59
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 98.59
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 98.58
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 98.57
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 98.56
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 98.56
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.55
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 98.55
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 98.55
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 98.53
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 98.53
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.52
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 98.5
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 98.49
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 98.47
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 98.47
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 98.46
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 98.46
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 98.46
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 98.44
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 98.43
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 98.42
2l5l_A136 Thioredoxin; structural genomics, electron transpo 98.4
2l57_A126 Uncharacterized protein; structural genomics, unkn 98.39
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 98.39
1mek_A120 Protein disulfide isomerase; electron transport, r 98.38
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.38
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 98.33
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 98.33
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.33
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 98.3
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.29
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 98.29
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 98.28
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 98.27
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 98.27
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 98.25
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 98.24
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.23
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 98.22
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 98.22
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.21
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 98.2
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.19
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 98.19
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 98.18
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.18
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 98.17
4euy_A105 Uncharacterized protein; structural genomics, PSI- 98.15
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.14
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 98.11
2h8l_A 252 Protein disulfide-isomerase A3; thioredoxin-like f 98.1
2qsi_A137 Putative hydrogenase expression/formation protein; 98.09
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 98.08
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 98.07
3ec3_A 250 Protein disulfide-isomerase A4; thioredoxin-like f 98.07
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 98.06
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 98.03
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 98.02
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 98.0
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.96
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 97.94
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 97.94
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 97.94
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.93
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 97.92
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 97.92
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 97.92
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 97.91
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 97.91
2kuc_A130 Putative disulphide-isomerase; structural genomics 97.89
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 97.09
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.85
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 97.79
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 97.76
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.71
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 97.7
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 97.67
1zma_A118 Bacterocin transport accessory protein; alpha-beta 97.66
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.66
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 97.64
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 97.62
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.61
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 97.6
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.58
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 97.58
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 97.52
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.52
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 97.51
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 97.51
1wmj_A130 Thioredoxin H-type; structural genomics, program f 97.5
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 97.38
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 97.38
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 97.37
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 97.35
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 97.33
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 97.32
3raz_A151 Thioredoxin-related protein; structural genomics, 97.32
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 97.29
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 97.21
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 97.16
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 96.18
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 97.1
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 97.05
2l5o_A153 Putative thioredoxin; structural genomics, unknown 97.04
4f9z_D 227 Endoplasmic reticulum resident protein 27; thiored 97.0
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 96.97
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 96.92
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 96.87
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 96.86
2lrn_A152 Thiol:disulfide interchange protein; structural ge 96.86
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 96.86
4evm_A138 Thioredoxin family protein; structural genomics, n 96.78
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 96.77
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 96.69
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 96.69
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 96.66
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 96.6
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 96.51
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 96.3
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.3
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 96.26
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 96.24
3f9u_A172 Putative exported cytochrome C biogenesis-related; 96.22
2ywi_A196 Hypothetical conserved protein; uncharacterized co 96.17
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 96.16
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.1
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 96.02
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 95.93
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 95.82
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 95.72
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 95.68
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 95.52
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 95.37
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 95.36
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 95.3
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 95.18
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 95.15
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 94.81
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 94.7
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 94.0
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 93.96
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 93.57
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 93.52
2lrt_A152 Uncharacterized protein; structural genomics, thio 93.31
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 92.93
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 92.03
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 91.63
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 91.39
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 91.3
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 91.25
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 91.15
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 91.04
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 90.83
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 90.67
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 90.54
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 90.32
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 89.96
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 89.81
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 89.42
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 88.71
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 88.6
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 88.54
1ttz_A87 Conserved hypothetical protein; structural genomic 87.76
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 87.57
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 87.32
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 87.24
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 85.88
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 85.68
2ls5_A159 Uncharacterized protein; structural genomics, unkn 85.69
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 85.31
3ira_A173 Conserved protein; methanosarcina mazei,structural 84.54
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 83.82
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 83.63
1un2_A 197 DSBA, thiol-disulfide interchange protein; disulfi 81.88
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 80.6
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 80.41
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=1.4e-25  Score=160.04  Aligned_cols=121  Identities=26%  Similarity=0.479  Sum_probs=98.8

Q ss_pred             HHHhCCCCCeEecCCCchhhhhcCCCceEEE-EeecC--ChhH-HHHHHHHHHhhcCceEEEEEeCCCcchhhhhhhhCC
Q 031686           34 FISLNKIPPMITYSRETTPLILNSPLKLLWL-FAAVH--DSEA-KSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGV  109 (155)
Q Consensus        34 fI~~~~~P~v~e~~~~~~~~i~~~~~~~v~l-f~~~~--~~~~-~~~~~~vA~~~~~~i~F~~vd~~~~~~~~~~~~~gl  109 (155)
                      -++.+++|+|+++|.+|+.+|++++.+.+++ |...+  +.+. ++.++++|++|+++++|+++|++...+.+.+++||+
T Consensus         7 ~~~~~~~PLV~e~t~en~~~~~~~~~~~~~l~f~~~~~~~~~~~~~~~~~vAk~fkgki~Fv~vd~~~~~~~~~l~~fGl   86 (147)
T 3bj5_A            7 HMKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFAFIDSDHTDNQRILEFFGL   86 (147)
T ss_dssp             --------CEEECCTTTHHHHHSSSCCEEEEEECCTTSSSHHHHHHHHHHHHHTTTTTCEEEEECTTCGGGHHHHHHTTC
T ss_pred             chhhccCCeeEEeccccHHHHhcCCCceEEEEEecCCcHhHHHHHHHHHHHHHHcCCceEEEEEecchHhHHHHHHHcCC
Confidence            4678999999999999999999999998544 55433  3567 899999999999999999999954347789999999


Q ss_pred             CCCCcceEEEEec-CCCeeecCC-CCCCHHHHHHHHHHHHcCCCccC
Q 031686          110 TCYTSRVIAVASI-RKRKKYVLN-GELTLSNVKSFALDFLGDKLRNQ  154 (155)
Q Consensus       110 ~~~~~P~v~i~~~-~~~~kY~~~-~~~t~~~I~~Fi~~f~~Gkl~p~  154 (155)
                      +++++|+++|++. ..++||.++ +++|.++|++|+++|++|||+||
T Consensus        87 ~~~~~P~v~i~~~~~~~~Ky~~~~~~~t~~~i~~Fv~d~l~GkL~p~  133 (147)
T 3bj5_A           87 KKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPH  133 (147)
T ss_dssp             CGGGCSEEEEEECSSSCEEECCSCCCCCHHHHHHHHHHHHTTCSCEE
T ss_pred             CcccCCEEEEEecccccccCCCCcccCCHHHHHHHHHHHHcCCcccc
Confidence            9888999999987 556799886 68999999999999999999997



>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d2djka1133 c.47.1.2 (A:1-133) Protein disulfide isomerase, PD 6e-14
d2b5ea3125 c.47.1.2 (A:240-364) Protein disulfide isomerase, 2e-10
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 133 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: PDI-like
domain: Protein disulfide isomerase, PDI
species: Fungi (Humicola insolens) [TaxId: 34413]
 Score = 62.6 bits (152), Expect = 6e-14
 Identities = 24/116 (20%), Positives = 45/116 (38%), Gaps = 6/116 (5%)

Query: 40  IPPMITYSRETTPLILNSPLKLLWLFAAVHDS--EAKSIFQETARAFKGKLLFVYSQIYP 97
            P +     ET    +++ + L ++FA   +   E     +  A A +G + F    I  
Sbjct: 5   SPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGT--IDA 62

Query: 98  KLKGQIFDYFGVTCYTSRVIAVASIRKRKKYVL--NGELTLSNVKSFALDFLGDKL 151
           K  G       +        A+  + K +K+      E+T   +K+F  DF+  K+
Sbjct: 63  KAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKI 118


>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 99.92
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 99.9
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.0
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.85
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.77
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.75
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.74
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 98.65
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.63
d1a8ya3119 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.54
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.53
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.34
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 98.34
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.26
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 98.15
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 98.15
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.14
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 98.09
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.08
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.91
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 97.86
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 97.77
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.75
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.71
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 97.69
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.69
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.68
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 97.67
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 97.65
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.56
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 97.41
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 97.21
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 96.73
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 96.43
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 96.39
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 95.4
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 94.97
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 94.8
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 94.54
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 93.91
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 92.72
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 92.1
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 91.85
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 91.28
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 91.16
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 89.72
d1wjka_100 Thioredoxin-like structure containing protein C330 89.5
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 80.81
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: PDI-like
domain: Protein disulfide isomerase, PDI
species: Fungi (Humicola insolens) [TaxId: 34413]
Probab=99.92  E-value=2.4e-25  Score=154.33  Aligned_cols=116  Identities=18%  Similarity=0.260  Sum_probs=104.9

Q ss_pred             CCCCCeEecCCCchhhhhcCCCceEEEEeecC-ChhH-HHHHHHHHHhhcCceEEEEEeCCCcchhhhhhhhCCCCCCcc
Q 031686           38 NKIPPMITYSRETTPLILNSPLKLLWLFAAVH-DSEA-KSIFQETARAFKGKLLFVYSQIYPKLKGQIFDYFGVTCYTSR  115 (155)
Q Consensus        38 ~~~P~v~e~~~~~~~~i~~~~~~~v~lf~~~~-~~~~-~~~~~~vA~~~~~~i~F~~vd~~~~~~~~~~~~~gl~~~~~P  115 (155)
                      ..+|+|+++|.+|+..|++.++|++|+|.+.+ +.++ .+.++++|++||++++|+|+|++.  +.+.+++||++.+++|
T Consensus         3 ~~lPLv~e~~~~n~~~~~~~~~pl~~lf~~~~~~~~~~~~~~~~vA~~~~~ki~Fv~vd~~~--~~~~l~~~gl~~~~~P   80 (133)
T d2djka1           3 LGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKA--FGAHAGNLNLKTDKFP   80 (133)
T ss_dssp             CSCCCSEECCHHHHHHHHHTTSCEEEEECSCSSSHHHHHHHHHHHHHSSTTTSEEEEECTTT--TGGGTTTTTCCSSSSS
T ss_pred             CCCCceeccChhhHHHHhcCCCCEEEEEeCCchHHHHHHHHHHHHHHHhcCceEEEEEeHHH--hHHHHHHhcCCcccCC
Confidence            36899999999999999999999999998765 5677 999999999999999999999886  7899999999988999


Q ss_pred             eEEEEecCCCeeecCC--CCCCHHHHHHHHHHHHcCCCccCC
Q 031686          116 VIAVASIRKRKKYVLN--GELTLSNVKSFALDFLGDKLRNQK  155 (155)
Q Consensus       116 ~v~i~~~~~~~kY~~~--~~~t~~~I~~Fi~~f~~Gkl~p~~  155 (155)
                      +++|++...+.+|++.  +++|.++|.+||++|++|||+||.
T Consensus        81 ~~~i~~~~~~~~~~~~~~~~i~~~~i~~Fi~d~~~Gkl~p~~  122 (133)
T d2djka1          81 AFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSI  122 (133)
T ss_dssp             EEEEECTTTCCBCCCCSSSCCCHHHHHHHHHHHHHTCCCCSS
T ss_pred             cEEEEEcCCCceecCCccccCCHHHHHHHHHHHHcCCCCccc
Confidence            9999998767788765  479999999999999999999984



>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure