Citrus Sinensis ID: 031773

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MSKENISSTSSRLAVLTSHLSAVVMASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG
cccccccccccccEEEEccccHHHHccHHHHHHHccccccccHHHHHHccccccccEEEcccEEEEcccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccEEEcEEEEEEEcccccccccc
cccccHcccccEEEEEcccccHHHHHHHHHHHHHHcccccccHHHHHHcccccccEEEEcccEEEEEcccccccEEEEEEEccccccccHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHccccccccEEEEEccccccccc
mskenisstSSRLAVLTSHLSAVVMASENEaavaavpsdsptifdkiinkeipskvvyeddkvlafrdidpqapthiliipkvkdgltglskAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVindgpnggqsVFHIHVHLlggrqmnwppg
mskenisstssrLAVLTSHLSAVVMASENEAAvaavpsdsptifdkiinkeipskvvYEDDKVLAFRdidpqapthiliipkvkdGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLlggrqmnwppg
MSKENISSTSSRLAVLTSHLSAVVMASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG
**********************VV****************PTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGR*******
*********SSRLAVLTSH**********************TIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPP*
*************AVLTSHLSAVVMASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG
*****ISSTSSRLAVLTSHL*****ASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNW**G
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKENISSTSSRLAVLTSHLSAVVMASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
P42856128 14 kDa zinc-binding prote N/A no 0.836 1.0 0.829 2e-58
P42855113 14 kDa zinc-binding prote N/A no 0.732 0.991 0.848 7e-52
P32084114 Uncharacterized HIT-like yes no 0.718 0.964 0.589 1e-34
P62958126 Histidine triad nucleotid yes no 0.823 1.0 0.542 2e-34
P80912126 Histidine triad nucleotid yes no 0.823 1.0 0.534 5e-34
Q9BX68163 Histidine triad nucleotid yes no 0.856 0.803 0.5 9e-34
P62959126 Histidine triad nucleotid no no 0.823 1.0 0.534 1e-33
P70349126 Histidine triad nucleotid yes no 0.823 1.0 0.534 1e-33
P53795130 Histidine triad nucleotid yes no 0.830 0.976 0.484 2e-33
Q9D0S9163 Histidine triad nucleotid no no 0.816 0.766 0.492 2e-33
>sp|P42856|ZB14_MAIZE 14 kDa zinc-binding protein OS=Zea mays GN=ZBP14 PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/129 (82%), Positives = 118/129 (91%), Gaps = 1/129 (0%)

Query: 25  MASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVK 84
           M+SE EAA+  +  DSPTIFDKII KEIPS VVYED+KVLAFRDI+PQAPTHILIIPKVK
Sbjct: 1   MSSEKEAALRRL-DDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVK 59

Query: 85  DGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLG 144
           DGLTGL+KAEERH EILG LLY AK+VAKQEGLEDG+R+VINDGP+G QSV+HIHVHLLG
Sbjct: 60  DGLTGLAKAEERHIEILGYLLYVAKVVAKQEGLEDGYRVVINDGPSGCQSVYHIHVHLLG 119

Query: 145 GRQMNWPPG 153
           GRQMNWPPG
Sbjct: 120 GRQMNWPPG 128

Zea mays (taxid: 4577)
>sp|P42855|ZB14_BRAJU 14 kDa zinc-binding protein (Fragment) OS=Brassica juncea PE=3 SV=1 Back     alignment and function description
>sp|P32084|Y1390_SYNE7 Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=4 SV=1 Back     alignment and function description
>sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|Q9BX68|HINT2_HUMAN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens GN=HINT2 PE=1 SV=1 Back     alignment and function description
>sp|P62959|HINT1_RAT Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5 Back     alignment and function description
>sp|P70349|HINT1_MOUSE Histidine triad nucleotide-binding protein 1 OS=Mus musculus GN=Hint1 PE=1 SV=3 Back     alignment and function description
>sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=4 SV=1 Back     alignment and function description
>sp|Q9D0S9|HINT2_MOUSE Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus GN=Hint2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
225439125160 PREDICTED: 14 kDa zinc-binding protein-l 0.993 0.95 0.802 3e-66
297816972147 hypothetical protein ARALYDRAFT_486090 [ 0.941 0.979 0.815 4e-64
18410510147 HIS triad family protein 3 [Arabidopsis 0.941 0.979 0.801 5e-63
357497245153 14 kDa zinc-binding protein [Medicago tr 0.980 0.980 0.762 1e-62
351723367159 uncharacterized protein LOC100527347 [Gl 0.928 0.893 0.815 1e-62
363807326129 uncharacterized protein LOC100785079 [Gl 0.836 0.992 0.882 1e-61
449437648156 PREDICTED: 14 kDa zinc-binding protein-l 0.836 0.820 0.875 2e-61
255559128129 histidine triad (hit) protein, putative 0.843 1.0 0.875 4e-61
296085851129 unnamed protein product [Vitis vinifera] 0.843 1.0 0.883 6e-61
242041091129 hypothetical protein SORBIDRAFT_01g03683 0.843 1.0 0.868 8e-61
>gi|225439125|ref|XP_002270641.1| PREDICTED: 14 kDa zinc-binding protein-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (87%)

Query: 2   SKENISSTSSRLAVLTSHLSAVVMASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDD 61
           ++  +   +SRL V+ SHLS+  MASE  AAVAA PSDSPTIFDKIINKEIP+ +VYEDD
Sbjct: 9   NQSRVGDINSRLGVIASHLSSAYMASEKGAAVAATPSDSPTIFDKIINKEIPATIVYEDD 68

Query: 62  KVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGF 121
           KVLAFRDI PQAPTHIL+IPKVKDGLTGLSKAEERH  ILG LLYTAKLVAKQEGLEDGF
Sbjct: 69  KVLAFRDIAPQAPTHILLIPKVKDGLTGLSKAEERHSVILGHLLYTAKLVAKQEGLEDGF 128

Query: 122 RIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG 153
           RIVINDGP+  QSV+HIHVHLLGGRQMNWPPG
Sbjct: 129 RIVINDGPSACQSVYHIHVHLLGGRQMNWPPG 160

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297816972|ref|XP_002876369.1| hypothetical protein ARALYDRAFT_486090 [Arabidopsis lyrata subsp. lyrata] gi|297322207|gb|EFH52628.1| hypothetical protein ARALYDRAFT_486090 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18410510|ref|NP_567038.1| HIS triad family protein 3 [Arabidopsis thaliana] gi|26983874|gb|AAN86189.1| putative protein kinase C inhibitor [Arabidopsis thaliana] gi|332646006|gb|AEE79527.1| HIS triad family protein 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357497245|ref|XP_003618911.1| 14 kDa zinc-binding protein [Medicago truncatula] gi|355493926|gb|AES75129.1| 14 kDa zinc-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|351723367|ref|NP_001238556.1| uncharacterized protein LOC100527347 [Glycine max] gi|255632137|gb|ACU16421.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|363807326|ref|NP_001242625.1| uncharacterized protein LOC100785079 [Glycine max] gi|255640400|gb|ACU20487.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449437648|ref|XP_004136603.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus] gi|449522450|ref|XP_004168239.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255559128|ref|XP_002520586.1| histidine triad (hit) protein, putative [Ricinus communis] gi|223540246|gb|EEF41819.1| histidine triad (hit) protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296085851|emb|CBI31175.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|242041091|ref|XP_002467940.1| hypothetical protein SORBIDRAFT_01g036830 [Sorghum bicolor] gi|241921794|gb|EER94938.1| hypothetical protein SORBIDRAFT_01g036830 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
TAIR|locus:2102554147 HIT3 "HIS triad family protein 0.941 0.979 0.801 2.7e-59
TAIR|locus:2029559187 HINT 2 "HISTIDINE TRIAD NUCLEO 0.810 0.663 0.637 1.9e-42
ZFIN|ZDB-GENE-040927-8126 hint1 "histidine triad nucleot 0.823 1.0 0.527 1.7e-34
ZFIN|ZDB-GENE-070410-139161 hint2 "histidine triad nucleot 0.725 0.689 0.575 4.6e-34
UNIPROTKB|F1RKI3126 HINT1 "Uncharacterized protein 0.823 1.0 0.550 1.2e-33
GENEDB_PFALCIPARUM|PF08_0059185 PF08_0059 "protein kinase c in 0.888 0.735 0.510 1.5e-33
UNIPROTKB|Q9I882126 chPKCI "Protein kinase C inhib 0.823 1.0 0.542 2.5e-33
FB|FBgn0031459150 CG2862 [Drosophila melanogaste 0.823 0.84 0.534 3.2e-33
UNIPROTKB|P62958126 HINT1 "Histidine triad nucleot 0.823 1.0 0.542 4.1e-33
UNIPROTKB|Q78DM8126 quPKCI "Protein kinase C inhib 0.823 1.0 0.534 5.2e-33
TAIR|locus:2102554 HIT3 "HIS triad family protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 608 (219.1 bits), Expect = 2.7e-59, P = 2.7e-59
 Identities = 117/146 (80%), Positives = 131/146 (89%)

Query:    10 SSRLAVLTSHLS--AVVMASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFR 67
             S R+++L+SH S  + VMASE EAA+AA PSDSPTIFDKII+KEIPS VV+EDDKVLAFR
Sbjct:     2 SHRVSILSSHFSPASAVMASEKEAALAATPSDSPTIFDKIISKEIPSTVVFEDDKVLAFR 61

Query:    68 DIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVIND 127
             DI PQ P HIL+IPKV+DGLTGLSKAEERH +ILGRLLYTAKLVAKQEGL +GFRIVIND
Sbjct:    62 DITPQGPVHILLIPKVRDGLTGLSKAEERHIDILGRLLYTAKLVAKQEGLAEGFRIVIND 121

Query:   128 GPNGGQSVFHIHVHLLGGRQMNWPPG 153
             GP G QSV+HIHVHL+GGRQMNWPPG
Sbjct:   122 GPQGCQSVYHIHVHLIGGRQMNWPPG 147
GO:0003824 "catalytic activity" evidence=IEA
GO:0005080 "protein kinase C binding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0006790 "sulfur compound metabolic process" evidence=IDA
GO:0009150 "purine ribonucleotide metabolic process" evidence=IDA
GO:0047627 "adenylylsulfatase activity" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2029559 HINT 2 "HISTIDINE TRIAD NUCLEOTIDE-BINDING 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-8 hint1 "histidine triad nucleotide binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-139 hint2 "histidine triad nucleotide binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKI3 HINT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF08_0059 PF08_0059 "protein kinase c inhibitor-like protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q9I882 chPKCI "Protein kinase C inhibitor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0031459 CG2862 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P62958 HINT1 "Histidine triad nucleotide-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q78DM8 quPKCI "Protein kinase C inhibitor" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P62958HINT1_BOVIN3, ., -, ., -, ., -0.54260.82351.0yesno
P70349HINT1_MOUSE3, ., -, ., -, ., -0.53480.82351.0yesno
P44956Y961_HAEINNo assigned EC number0.53770.66010.8706yesno
P42856ZB14_MAIZENo assigned EC number0.82940.83661.0N/Ano
P42855ZB14_BRAJUNo assigned EC number0.84820.73200.9911N/Ano
Q23921PKIA_DICDINo assigned EC number0.44960.81040.9763yesno
P0ACE9HINT_SHIFLNo assigned EC number0.56600.67320.8655yesno
P32084Y1390_SYNE7No assigned EC number0.58920.71890.9649yesno
Q9BX68HINT2_HUMAN3, ., -, ., -, ., -0.50.85620.8036yesno
P80912HINT1_RABIT3, ., -, ., -, ., -0.53480.82351.0yesno
P53795HINT_CAEELNo assigned EC number0.48480.83000.9769yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 1e-53
pfam0123097 pfam01230, HIT, HIT domain 1e-36
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramid 2e-36
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 2e-35
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 1e-29
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 9e-28
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine tria 2e-15
cd01275126 cd01275, FHIT, FHIT (fragile histidine family): FH 3e-12
cd01278104 cd01278, aprataxin_related, aprataxin related: Apr 2e-05
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information 
 Score =  164 bits (417), Expect = 1e-53
 Identities = 64/106 (60%), Positives = 75/106 (70%), Gaps = 3/106 (2%)

Query: 41  PTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEI 100
             IF KII  EIP+K VYEDD+VLAF DI+PQAP HIL+IPK       LS A E   E+
Sbjct: 1   DCIFCKIIRGEIPAKKVYEDDEVLAFHDINPQAPVHILVIPKKHIA--SLSDATEEDEEL 58

Query: 101 LGRLLYTAKLVAKQEGL-EDGFRIVINDGPNGGQSVFHIHVHLLGG 145
           LG LL  A  VAK  G+ EDG+R+VIN G +GGQ VFH+H+HLLGG
Sbjct: 59  LGHLLSAAAKVAKDLGIAEDGYRLVINCGKDGGQEVFHLHLHLLGG 104

The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238263 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238606 cd01275, FHIT, FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG3275127 consensus Zinc-binding protein of the histidine tr 100.0
PRK10687119 purine nucleoside phosphoramidase; Provisional 100.0
cd01276104 PKCI_related Protein Kinase C Interacting protein 100.0
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.98
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.97
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.97
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.97
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.97
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.96
PLN02643336 ADP-glucose phosphorylase 99.96
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.95
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.95
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.92
KOG3379150 consensus Diadenosine polyphosphate hydrolase and 99.87
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.86
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 99.81
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 99.79
KOG4359166 consensus Protein kinase C inhibitor-like protein 99.72
KOG2958354 consensus Galactose-1-phosphate uridylyltransferas 99.65
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 99.2
KOG2476 528 consensus Uncharacterized conserved protein [Funct 98.69
KOG0562184 consensus Predicted hydrolase (HIT family) [Genera 98.64
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 97.74
KOG3969310 consensus Uncharacterized conserved protein [Funct 97.71
KOG2477 628 consensus Uncharacterized conserved protein [Funct 97.59
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 97.09
KOG2720 431 consensus Predicted hydrolase (HIT family) [Genera 96.63
PLN02643 336 ADP-glucose phosphorylase 96.58
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 96.36
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 96.25
COG4360 298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 96.24
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 96.13
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 95.75
COG5075305 Uncharacterized conserved protein [Function unknow 95.48
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 95.4
TIGR00209 347 galT_1 galactose-1-phosphate uridylyltransferase, 95.06
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta 93.11
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 82.97
>KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-37  Score=213.64  Aligned_cols=125  Identities=62%  Similarity=1.013  Sum_probs=115.8

Q ss_pred             HHHHHhhhcCCCCCCceeeeccccccCccEEEEcCeEEEEecCCCCCCceEEEEecCCCCCCCCCcchhhHHHHHHHHHH
Q 031773           27 SENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLY  106 (153)
Q Consensus        27 ~~~~~~~~~~~~~~~C~fC~ii~~e~~~~iv~e~d~~va~~~~~p~~pgh~LViPkrH~~~~~l~~l~~~~~~~l~~l~~  106 (153)
                      .|.+.|+.-...++.|+||+|+++|+|..+|||||.++||.|..|.+|+|+|||||+|  ++.++.+.+.+.+++++++.
T Consensus         3 ~e~~~a~~a~~~~~~tIF~kIi~keIPa~ii~Edd~~lAF~Di~Pqap~HfLvIPK~h--i~~~s~aed~~~e~Lg~ll~   80 (127)
T KOG3275|consen    3 SEVEKAQTAAAGAAPTIFCKIIRKEIPAKIIFEDDRCLAFHDIAPQAPGHFLVIPKKH--ITQLSKAEDRDDELLGHLLP   80 (127)
T ss_pred             chHHHHhhhcccCCCcEeeeeecccCCcceEeeccceEEEEecCCCCCceEEEeeccc--ccchhhcccCCHHHHHHHHH
Confidence            3455555545558899999999999999999999999999999999999999999999  88888888888899999999


Q ss_pred             HHHHHHHHhCCCCceEEEEecCCCCCCccceEEEEEeCCCCCCCCCC
Q 031773          107 TAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG  153 (153)
Q Consensus       107 ~~~~~~~~~~~~~~~ni~~n~g~~~gq~v~HlHlHIIPr~~~~w~~~  153 (153)
                      ++|+++++++..+|||+.+|+|+.+.|+|+|+|+||+|++.++||+|
T Consensus        81 ~~k~vak~~Gl~~gYrvv~NnG~~g~QsV~HvH~HvlgGrqm~WPpg  127 (127)
T KOG3275|consen   81 VAKKVAKALGLEDGYRVVQNNGKDGHQSVYHVHLHVLGGRQMQWPPG  127 (127)
T ss_pred             HHHHHHHHhCcccceeEEEcCCcccceEEEEEEEEEeCCcccCCCCC
Confidence            99999999998899999999999999999999999999999999997

>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>KOG3379 consensus Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism; General function prediction only] Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] Back     alignment and domain information
>KOG2958 consensus Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>KOG3969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2477 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 4e-35
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 5e-35
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 5e-35
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 5e-35
4eqe_A128 Crystal Structure Of Histidine Triad Nucleotide-Bin 3e-34
3tw2_A126 High Resolution Structure Of Human Histidine Triad 4e-34
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 5e-34
1kpa_A126 Pkci-1-Zinc Length = 126 2e-33
1kpb_A125 Pkci-1-Apo Length = 125 2e-33
3n1s_A119 Crystal Structure Of Wild Type Echint Gmp Complex L 5e-25
3oj7_A117 Crystal Structure Of A Histidine Triad Family Prote 4e-24
3n1t_A119 Crystal Structure Of The H101a Mutant Echint Gmp Co 6e-24
1xqu_A147 Hit Family Hydrolase From Clostridium Thermocellum 4e-20
4egu_A119 0.95a Resolution Structure Of A Histidine Triad Pro 2e-19
3lb5_A161 Crystal Structure Of Hit-Like Protein Involved In C 9e-13
3l7x_A173 The Crystal Structure Of Smu.412c From Streptococcu 7e-12
3imi_A147 2.01 Angstrom Resolution Crystal Structure Of A Hit 8e-11
1y23_A145 Crystal Structure Of A Member Of Hit Family Of Prot 3e-10
2eo4_A149 Crystal Structure Of Hypothetical Histidine Triad N 3e-10
3p0t_A138 Crystal Structure Of An Hit-Like Protein From Mycob 3e-10
3o0m_A149 Crystal Structure Of A Zn-Bound Histidine Triad Fam 4e-09
3ksv_A149 Hypothetical Protein From Leishmania Major Length = 4e-07
3r6f_A135 Crystal Structure Of A Zinc-Containing Hit Family P 3e-05
>pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure 
Iteration: 1

 Score =  143 bits (360), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (70%), Gaps = 3/129 (2%)
Query: 25  MASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVK 84
           MA E   A  A P    TIF KII KEIP+K+++EDD+ LAF DI PQAPTH L+IPK  
Sbjct: 1   MADEIAKAQVARPGGD-TIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKH 59
Query: 85  DGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLG 144
             ++ +S AE+    +LG L+   K  A   GL+ G+R+V+N+G +GGQSV+H+H+H+LG
Sbjct: 60  --ISQISAAEDADESLLGHLMIVGKKAAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLG 117
Query: 145 GRQMNWPPG 153
           GRQMNWPPG
Sbjct: 118 GRQMNWPPG 126
>pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure
>pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 Back     alignment and structure
>pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 Back     alignment and structure
>pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure
>pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>pdb|3N1S|A Chain A, Crystal Structure Of Wild Type Echint Gmp Complex Length = 119 Back     alignment and structure
>pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 Back     alignment and structure
>pdb|3N1T|A Chain A, Crystal Structure Of The H101a Mutant Echint Gmp Complex Length = 119 Back     alignment and structure
>pdb|1XQU|A Chain A, Hit Family Hydrolase From Clostridium Thermocellum Cth-393 Length = 147 Back     alignment and structure
>pdb|4EGU|A Chain A, 0.95a Resolution Structure Of A Histidine Triad Protein From Clostridium Difficile Length = 119 Back     alignment and structure
>pdb|3LB5|A Chain A, Crystal Structure Of Hit-Like Protein Involved In Cell-Cycle Regulation From Bartonella Henselae With Unknown Ligand Length = 161 Back     alignment and structure
>pdb|3L7X|A Chain A, The Crystal Structure Of Smu.412c From Streptococcus Mutans Ua159 Length = 173 Back     alignment and structure
>pdb|3IMI|A Chain A, 2.01 Angstrom Resolution Crystal Structure Of A Hit Family Protein From Bacillus Anthracis Str. 'ames Ancestor' Length = 147 Back     alignment and structure
>pdb|1Y23|A Chain A, Crystal Structure Of A Member Of Hit Family Of Proteins From Bacillus Subtilis Length = 145 Back     alignment and structure
>pdb|2EO4|A Chain A, Crystal Structure Of Hypothetical Histidine Triad Nucleotide-Binding Protein St2152 From Sulfolobus Tokodaii Strain7 Length = 149 Back     alignment and structure
>pdb|3P0T|A Chain A, Crystal Structure Of An Hit-Like Protein From Mycobacterium Paratuberculosis Length = 138 Back     alignment and structure
>pdb|3O0M|A Chain A, Crystal Structure Of A Zn-Bound Histidine Triad Family Protein From Mycobacterium Smegmatis Length = 149 Back     alignment and structure
>pdb|3KSV|A Chain A, Hypothetical Protein From Leishmania Major Length = 149 Back     alignment and structure
>pdb|3R6F|A Chain A, Crystal Structure Of A Zinc-Containing Hit Family Protein From Encephalitozoon Cuniculi Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 6e-74
4egu_A119 Histidine triad (HIT) protein; structural genomics 1e-64
3oj7_A117 Putative histidine triad family protein; hydrolase 2e-64
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 3e-61
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 6e-61
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 1e-55
3ksv_A149 Uncharacterized protein; HIT family, structural ge 3e-53
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 3e-51
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 6e-50
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 1e-49
3imi_A147 HIT family protein; structural genomics, infectiou 1e-48
2eo4_A149 150AA long hypothetical histidine triad nucleotid 1e-48
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 7e-47
3r6f_A135 HIT family protein; structural genomics, seattle s 2e-39
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 8e-30
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 7e-21
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 6e-17
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 5e-11
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 4e-10
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 3e-04
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
 Score =  216 bits (552), Expect = 6e-74
 Identities = 69/129 (53%), Positives = 91/129 (70%), Gaps = 3/129 (2%)

Query: 25  MASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVK 84
           MA E   A  A P    TIF KII KEIP+K+++EDD+ LAF DI PQAPTH L+IPK  
Sbjct: 1   MADEIAKAQVARPG-GDTIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKH 59

Query: 85  DGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLG 144
             ++ +S AE+    +LG L+   K  A   GL+ G+R+V+N+G +GGQSV+H+H+H+LG
Sbjct: 60  --ISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLG 117

Query: 145 GRQMNWPPG 153
           GRQMNWPPG
Sbjct: 118 GRQMNWPPG 126
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Length = 147 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Length = 218 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Length = 154 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Length = 348 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 100.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 100.0
3oj7_A117 Putative histidine triad family protein; hydrolase 100.0
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 100.0
4egu_A119 Histidine triad (HIT) protein; structural genomics 100.0
3ksv_A149 Uncharacterized protein; HIT family, structural ge 100.0
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 100.0
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 100.0
3imi_A147 HIT family protein; structural genomics, infectiou 100.0
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 100.0
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.97
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.97
3r6f_A135 HIT family protein; structural genomics, seattle s 99.97
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.97
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.97
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.96
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.96
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.95
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.94
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.93
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.84
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.83
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.78
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.73
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.66
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.21
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 99.18
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 98.75
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 96.4
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 96.03
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
Probab=100.00  E-value=2.9e-42  Score=244.63  Aligned_cols=126  Identities=54%  Similarity=0.966  Sum_probs=110.2

Q ss_pred             hHHHHHHhhhcCCCCCCceeeeccccccCccEEEEcCeEEEEecCCCCCCceEEEEecCCCCCCCCCcchhhHHHHHHHH
Q 031773           25 MASENEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRL  104 (153)
Q Consensus        25 ~~~~~~~~~~~~~~~~~C~fC~ii~~e~~~~iv~e~d~~va~~~~~p~~pgh~LViPkrH~~~~~l~~l~~~~~~~l~~l  104 (153)
                      +..|++.|++|+ .+++|+||+|+++|.+.++|||||.++||.|.+|.+|||+||+||+|  +.++.+|++++.++++++
T Consensus         1 ~~~~~~~~~~~~-~~~~CiFC~i~~~e~~~~iv~e~e~~~af~d~~P~~pgH~LViPk~H--~~~l~dL~~~e~~~l~~l   77 (126)
T 3o1c_A            1 MADEIAKAQVAR-PGGDTIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKH--ISQISAAEDADESLLGHL   77 (126)
T ss_dssp             -----------C-TTCSSHHHHHHHTSSCCCEEEECSSEEEEECSSCSSSEEEEEEESSC--CCCGGGCCGGGHHHHHHH
T ss_pred             CcchhhcccccC-CCCCCCcchhhcCCCcCCEEEECCCEEEEECCCCCCCceEEEEechH--hchHhhCchhHHHHHHHH
Confidence            356889999998 67889999999999999999999999999999999999999999999  899999999999999999


Q ss_pred             HHHHHHHHHHhCCCCceEEEEecCCCCCCccceEEEEEeCCCCCCCCCC
Q 031773          105 LYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG  153 (153)
Q Consensus       105 ~~~~~~~~~~~~~~~~~ni~~n~g~~~gq~v~HlHlHIIPr~~~~w~~~  153 (153)
                      +..+++++++++.++|||+++|+|+.+||+++|+|+|||||++++||+|
T Consensus        78 ~~~~~~~~~~~~~~~g~ni~~n~g~~agq~v~HlH~Hiipr~~~~~~~~  126 (126)
T 3o1c_A           78 MIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG  126 (126)
T ss_dssp             HHHHHHHHHHTTCTTCEEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             HHHHHHHHHHhCCCCCeEEEEecCCccCCccCEeEEEEeCCcccCCCCC
Confidence            9999999999877789999999999999999999999999999999997
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 1e-42
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 4e-31
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] 3e-24
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 9e-24
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protei 2e-17
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly 7e-16
d1vlra1192 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C- 5e-15
d2oika1139 d.13.1.1 (A:6-144) Histidine triad protein Mfla250 2e-13
d1z84a2156 d.13.1.2 (A:196-351) Galactose-1-phosphate uridyly 5e-11
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  135 bits (340), Expect = 1e-42
 Identities = 59/112 (52%), Positives = 81/112 (72%), Gaps = 2/112 (1%)

Query: 42  TIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEIL 101
           TIF KII KEIP+K+++EDD+ LAF DI PQAPTH L+IPK       +++ +     +L
Sbjct: 2   TIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDD--DESLL 59

Query: 102 GRLLYTAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG 153
           G L+   K  A   GL  G+R+V+N+G +GGQSV+H+H+H+LGGRQM+WPPG
Sbjct: 60  GHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Length = 139 Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 100.0
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 100.0
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 100.0
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.97
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.97
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.97
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.94
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.94
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.52
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 97.83
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 97.33
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 96.61
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9e-40  Score=225.63  Aligned_cols=111  Identities=56%  Similarity=1.058  Sum_probs=106.2

Q ss_pred             CceeeeccccccCccEEEEcCeEEEEecCCCCCCceEEEEecCCCCCCCCCcchhhHHHHHHHHHHHHHHHHHHhCCCCc
Q 031773           41 PTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLEDG  120 (153)
Q Consensus        41 ~C~fC~ii~~e~~~~iv~e~d~~va~~~~~p~~pgh~LViPkrH~~~~~l~~l~~~~~~~l~~l~~~~~~~~~~~~~~~~  120 (153)
                      +|+||+|++||.|..+|||||.++||.|.+|.++||+||+||+|  +.++.++++++.+++..++..+++++++.+..+|
T Consensus         1 dCiFc~I~~~e~p~~ivyede~~~af~D~~P~~~gH~LViPk~H--~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g   78 (111)
T d1kpfa_           1 DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVAEDDDESLLGHLMIVGKKCAADLGLNKG   78 (111)
T ss_dssp             CCHHHHHHTTSSCCCEEEECSSEEEEECSSCSSSEEEEEEESSC--CSCGGGCCGGGHHHHHHHHHHHHHHHHHTTCTTC
T ss_pred             CCcccccccCCCCccEEEeCCCEEEEecCCCCCCceEEEeecch--hcchhhhhhHHHHHHHHHHHHHHHHHHHhCCCCC
Confidence            69999999999999999999999999999999999999999999  8999999998888898999899999988877889


Q ss_pred             eEEEEecCCCCCCccceEEEEEeCCCCCCCCCC
Q 031773          121 FRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG  153 (153)
Q Consensus       121 ~ni~~n~g~~~gq~v~HlHlHIIPr~~~~w~~~  153 (153)
                      ||+++|+|+.+||+|+|+|+|||||++++||+|
T Consensus        79 ~~i~~n~g~~agq~V~HlH~Hiip~~~l~wppg  111 (111)
T d1kpfa_          79 YRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG  111 (111)
T ss_dssp             EEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             EEEEEeCCccCCcccceeEEEEeCCCcCCCCcC
Confidence            999999999999999999999999999999998
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure