Citrus Sinensis ID: 031882

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MGSKLVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHSSASSLAATFFTLLVSLLSSYI
ccHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHcccEEEEccEEEEEEcccccEEEEcHHHcccccccccccccccccccEEEEcccccEEEEcccccccccccEEEEEEcccccccccccccHHHHHHHHHHccc
ccHHHHHHHHHHHHHHHHHHHcccEEEEccccccEEcccccccHHHHHHcccEEEccEEEEEEcccccEEEEcHHHHHHccccccHHHEccccccEEEEcccccEEEEEccccccccccEEEEEEEcccccccccccccHHHHHHHHHHHc
MGSKLVLFGFLVVVPAIFDAAAAEtytvgdemgwttppsgaaaystwaskqkfhfgdtivfnwtgshsvaevskadydkcrtkspdgeihetspanytlnsngthYFICtvdshcdrgqkvtiniggehssassLAATFFTLLVSLLSSYI
MGSKLVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKspdgeihetspaNYTLNSNGTHYFICTVDSHCDRGQKVTINIGGehssasslaATFFTLLVSLLSSYI
MGSKLVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHssasslaatfftllvsllsSYI
****LVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVS**********************NYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHSSASSLAATFFTLLVSLL****
****LVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTI********************VSLLSSYI
MGSKLVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHSSASSLAATFFTLLVSLLSSYI
**SKLVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEH*******ATFFTLLVSLLSSYI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSKLVLFGFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWTGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHSSASSLAATFFTLLVSLLSSYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
P29602137 Cucumber peeling cupredox N/A no 0.655 0.722 0.401 2e-16
P42849115 Umecyanin OS=Armoracia ru N/A no 0.662 0.869 0.407 2e-15
Q9SK27182 Early nodulin-like protei no no 0.682 0.565 0.379 2e-15
Q07488196 Blue copper protein OS=Ar no no 0.662 0.510 0.398 4e-15
P00302107 Stellacyanin OS=Toxicoden N/A no 0.655 0.925 0.401 5e-14
Q41001189 Blue copper protein OS=Pi N/A no 0.781 0.624 0.362 6e-14
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.708 0.990 0.369 3e-13
Q9T076 349 Early nodulin-like protei no no 0.788 0.340 0.336 1e-12
P60496126 Chemocyanin OS=Lilium lon N/A no 0.642 0.769 0.367 1e-10
O80517202 Uclacyanin-2 OS=Arabidops no no 0.662 0.495 0.360 3e-10
>sp|P29602|CPC_CUCSA Cucumber peeling cupredoxin OS=Cucumis sativus PE=1 SV=3 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (60%), Gaps = 3/102 (2%)

Query: 26  YTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEV-SKADYDKCRTK 83
           + VGD  GW+ P S    YS WA+ + F  GD++ FN+   +H+V E+ +K  +D C   
Sbjct: 5   HIVGDNTGWSVP-SSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFV 63

Query: 84  SPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINI 125
           + D ++  TSP    L+  G HYF+CTV +HC  GQK++IN+
Sbjct: 64  NSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINV 105

Cucumis sativus (taxid: 3659)
>sp|P42849|UMEC_ARMRU Umecyanin OS=Armoracia rusticana PE=1 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
225445551153 PREDICTED: umecyanin [Vitis vinifera] gi 0.953 0.941 0.486 4e-32
147780458153 hypothetical protein VITISV_018635 [Viti 0.953 0.941 0.48 3e-31
297743460 624 unnamed protein product [Vitis vinifera] 0.867 0.209 0.451 5e-28
225442953 319 PREDICTED: uncharacterized protein LOC10 0.867 0.410 0.451 1e-27
147832961 319 hypothetical protein VITISV_023424 [Viti 0.867 0.410 0.451 2e-27
350535054 332 dicyanin precursor [Solanum lycopersicum 0.821 0.373 0.507 2e-27
88683126160 putative dicyanin blue copper protein pr 0.841 0.793 0.496 9e-27
255572513163 Cucumber peeling cupredoxin, putative [R 0.801 0.742 0.492 3e-25
147778919174 hypothetical protein VITISV_032660 [Viti 0.980 0.850 0.403 3e-25
225442957174 PREDICTED: cucumber peeling cupredoxin-l 0.980 0.850 0.403 5e-25
>gi|225445551|ref|XP_002285305.1| PREDICTED: umecyanin [Vitis vinifera] gi|297738973|emb|CBI28218.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 98/150 (65%), Gaps = 6/150 (4%)

Query: 1   MGSKLVLFGFLVVVPAIFD-AAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTI 59
           M +++ + G L+VV  +   AAAA+T+ VG  + W+ P  G +AY+TWAS + F  GDTI
Sbjct: 1   MAARVEIIGCLIVVAVLLQGAAAADTHHVGGNISWSIPTEGESAYTTWASGEDFKLGDTI 60

Query: 60  VFNWTGSHSVAEVSKADYDKCRTKSP-DGEIHETSPANYTLNSNGTHYFICTVDSHCDRG 118
           VFNWTG+H+VA VSK  YD C T +  D +I  TSP NYTLNS    YFICT+  HC  G
Sbjct: 61  VFNWTGTHTVARVSKDVYDNCTTANVLDNDIQATSPVNYTLNSTEPQYFICTIGRHCSLG 120

Query: 119 QKVTINIGGEHSSASSLAATFFTLLVSLLS 148
           QKVTI+I    SSA+SL     T ++ +++
Sbjct: 121 QKVTISI----SSATSLTVGAVTTMLLVMA 146

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147780458|emb|CAN60010.1| hypothetical protein VITISV_018635 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743460|emb|CBI36327.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442953|ref|XP_002265604.1| PREDICTED: uncharacterized protein LOC100250809 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147832961|emb|CAN66123.1| hypothetical protein VITISV_023424 [Vitis vinifera] Back     alignment and taxonomy information
>gi|350535054|ref|NP_001234429.1| dicyanin precursor [Solanum lycopersicum] gi|7670832|gb|AAF66242.1|AF243180_1 dicyanin [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|88683126|emb|CAJ77497.1| putative dicyanin blue copper protein precursor [Solanum tuberosum] Back     alignment and taxonomy information
>gi|255572513|ref|XP_002527191.1| Cucumber peeling cupredoxin, putative [Ricinus communis] gi|223533456|gb|EEF35204.1| Cucumber peeling cupredoxin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147778919|emb|CAN69318.1| hypothetical protein VITISV_032660 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442957|ref|XP_002266874.1| PREDICTED: cucumber peeling cupredoxin-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:2149249196 BCB "blue-copper-binding prote 0.748 0.576 0.401 1.6e-17
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.741 0.598 0.380 2e-17
TAIR|locus:2085775203 ENODL9 "early nodulin-like pro 0.774 0.576 0.355 1.8e-16
TAIR|locus:2040164182 ENODL14 "early nodulin-like pr 0.701 0.582 0.376 2.3e-16
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.794 0.677 0.341 6e-16
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.774 0.625 0.330 1.3e-15
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.754 0.57 0.358 6.9e-15
TAIR|locus:2086899188 ENODL5 "early nodulin-like pro 0.781 0.627 0.328 6.9e-15
TAIR|locus:2154679 370 ENODL1 "early nodulin-like pro 0.774 0.316 0.341 1.1e-14
TAIR|locus:2028396177 ENODL6 "early nodulin-like pro 0.794 0.677 0.338 1.4e-14
TAIR|locus:2149249 BCB "blue-copper-binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 47/117 (40%), Positives = 64/117 (54%)

Query:    10 FLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWT-GSHS 68
             FLV+V A      AE Y VGD+  WT P      Y+TWA+ + F  GD + F++  G H 
Sbjct:    10 FLVLVFAAV-VVFAEDYDVGDDTEWTRPMD-PEFYTTWATGKTFRVGDELEFDFAAGRHD 67

Query:    69 VAEVSKADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINI 125
             VA VS+A ++ C  + P   +    P    LN+ G  YFICTV  HC  GQK++I +
Sbjct:    68 VAVVSEAAFENCEKEKPISHM-TVPPVKIMLNTTGPQYFICTVGDHCRFGQKLSITV 123
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009611 "response to wounding" evidence=IEP;RCA
GO:0006979 "response to oxidative stress" evidence=RCA;TAS
GO:0015690 "aluminum cation transport" evidence=IMP
GO:0031225 "anchored to membrane" evidence=TAS
GO:0046658 "anchored to plasma membrane" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP
GO:0009620 "response to fungus" evidence=RCA
GO:0009646 "response to absence of light" evidence=IEP;RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085775 ENODL9 "early nodulin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040164 ENODL14 "early nodulin-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086899 ENODL5 "early nodulin-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154679 ENODL1 "early nodulin-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028396 ENODL6 "early nodulin-like protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016926001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (153 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 6e-27
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 4e-10
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 95.8 bits (239), Expect = 6e-27
 Identities = 40/87 (45%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 34  WTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEVSKADYDKCRTKSPDGEIHET 92
           WT P    A Y+ WAS + F  GDT+VFN+  G H+V EV+KADY+ C T  P    + T
Sbjct: 1   WTVP--LNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPI-RTYTT 57

Query: 93  SPANYTLNSNGTHYFICTVDSHCDRGQ 119
                 L   G HYFIC V  HC  GQ
Sbjct: 58  GNDIIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.75
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.61
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.5
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.43
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.38
COG3794128 PetE Plastocyanin [Energy production and conversio 98.3
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.98
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.27
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.59
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 96.4
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 96.38
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 94.9
COG4454158 Uncharacterized copper-binding protein [Inorganic 94.87
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 94.6
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 94.32
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 93.87
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 90.49
PRK02888635 nitrous-oxide reductase; Validated 88.25
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 86.63
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 86.29
PRK10378 375 inactive ferrous ion transporter periplasmic prote 83.57
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-43  Score=275.64  Aligned_cols=118  Identities=30%  Similarity=0.483  Sum_probs=105.9

Q ss_pred             HHHHHHHHhhcccceeEEEecCCCCCCCCCCCCCCccccccCCeeEeCcEEEEee-cCCCeeEEEcccccCcCcCCCCCC
Q 031882            9 GFLVVVPAIFDAAAAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEVSKADYDKCRTKSPDG   87 (151)
Q Consensus         9 ~~~~~~~~l~~~a~a~~~~VGg~~GW~~~~~~~~~Y~~Wa~~~tf~vGD~L~F~~-~~~H~V~~Vs~~~y~~C~~~~~~~   87 (151)
                      +++++++++...++|++|+|||+.||+.+    .+|++|+++|+|++||+|+|+| +++|||+||++++|++|+.++|+ 
T Consensus         6 l~~~~~~~~~~~~~a~~~~VGd~~GW~~~----~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi-   80 (167)
T PLN03148          6 LFCFFALFSASATTATDHIVGANKGWNPG----INYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAA-   80 (167)
T ss_pred             HHHHHHHHhhhhccceEEEeCCCCCcCCC----CChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCc-
Confidence            33333445567889999999999999955    7899999999999999999999 99999999999999999999999 


Q ss_pred             ccccCCCcEEEeccCceEEEEeCCCCCCCCCCeEEEEecCCCCCC
Q 031882           88 EIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHSSA  132 (151)
Q Consensus        88 ~~~~~G~~~v~l~~~G~~YFiC~v~~HC~~GmKl~I~V~~~~s~~  132 (151)
                      ..+++|++.|+|+++|++||||+ .+||+.||||+|+|.+.+++|
T Consensus        81 ~~~tsG~d~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~~~pp  124 (167)
T PLN03148         81 GNWTSGKDFIPLNKAKRYYFICG-NGQCFNGMKVTILVHPLPPPP  124 (167)
T ss_pred             ceecCCCcEEEecCCccEEEEcC-CCccccCCEEEEEEcCCCCCC
Confidence            89999999999999999999999 699999999999998765433

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 2e-17
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 2e-16
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 7e-14
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 2e-08
1f56_A91 Spinach Plantacyanin Length = 91 1e-06
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure 
Iteration: 1

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (60%), Gaps = 3/102 (2%)
Query: 26  YTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEV-SKADYDKCRTK 83
           + VGD  GW+ P S    YS WA+ + F  GD++ FN+   +H+V E+ +K  +D C   
Sbjct: 6   HIVGDNTGWSVP-SSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFV 64
Query: 84  SPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINI 125
           + D ++  TSP    L+  G HYF+CTV +HC  GQK++IN+
Sbjct: 65  NSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINV 106
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 2e-33
1jer_A138 Cucumber stellacyanin; electron transport, copper, 3e-33
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 4e-33
2cbp_A96 Cucumber basic protein; electron transport, phytoc 2e-28
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 7e-27
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  112 bits (282), Expect = 2e-33
 Identities = 42/114 (36%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 24  ETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEVSKADYDKCRT 82
           E Y VG +M W  P      Y TWA+ + F  GD + F++  G H VA V+K  +D C+ 
Sbjct: 2   EDYDVGGDMEWKRPSD-PKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKK 60

Query: 83  KSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINIGGEHSSASSLA 136
           ++P      T P    LN+ G  Y+ICTV  HC  GQK++IN+ G   +     
Sbjct: 61  ENPI-SHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAGGAGGGAT 113
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.42
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.26
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.16
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 99.11
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 99.07
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.03
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.99
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.99
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.98
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.98
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.98
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.94
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.92
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.92
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.89
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.85
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.77
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.45
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.45
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.42
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.41
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 98.39
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.38
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 98.36
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 98.31
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 98.13
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 98.03
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 98.03
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.57
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.31
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.25
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.22
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 97.01
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.77
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 96.01
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 95.57
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 95.22
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.75
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.27
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 94.22
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 93.85
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 93.47
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 90.2
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 87.13
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 86.3
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 84.69
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 82.95
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
Probab=100.00  E-value=1.6e-42  Score=251.90  Aligned_cols=108  Identities=38%  Similarity=0.736  Sum_probs=98.5

Q ss_pred             ceeEEEecCCCCCCCCCCCCCCccccccCCeeEeCcEEEEee-cCCCeeEEEcccccCcCcCCCCCCccccCCCcEEEec
Q 031882           22 AAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLN  100 (151)
Q Consensus        22 ~a~~~~VGg~~GW~~~~~~~~~Y~~Wa~~~tf~vGD~L~F~~-~~~H~V~~Vs~~~y~~C~~~~~~~~~~~~G~~~v~l~  100 (151)
                      +|++|+|||+.||++++  ..+|++||++++|++||+|+|+| +++|+|+||++++|+.|+.++|+ ..+++|+++|+|+
T Consensus         1 ~a~~~~VG~~~GW~~~~--~~~Y~~Wa~~~~F~vGD~LvF~y~~~~hsV~~V~~~~y~~C~~~~p~-~~~~~G~~~v~L~   77 (109)
T 1ws8_A            1 MATVHKVGDSTGWTTLV--PYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPA-ASYTSGADSIPLK   77 (109)
T ss_dssp             CCCEEETTGGGCSCSSS--CCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCS-EEECSSEEEEECC
T ss_pred             CCcEEEeCCCCCccCCC--CcChhHhhcCCcCcCCCEEEEeecCCCceEEEEChHHCCcccCCCcc-cccCCCCEEEEEC
Confidence            47899999999999984  47899999999999999999999 89999999999999999999999 8899999999999


Q ss_pred             cCceEEEEeCCCCCCCCCCeEEEEecCCCCCC
Q 031882          101 SNGTHYFICTVDSHCDRGQKVTINIGGEHSSA  132 (151)
Q Consensus       101 ~~G~~YFiC~v~~HC~~GmKl~I~V~~~~s~~  132 (151)
                      ++|++||||++++||++||||+|+|.++++++
T Consensus        78 ~~G~~yFic~~~gHC~~GmKl~I~V~~~~s~~  109 (109)
T 1ws8_A           78 RPGTFYFLCGIPGHCQLGQKVEIKVDPGSSSA  109 (109)
T ss_dssp             SSEEEEEECCSTTTTTTTCEEEEEECC-----
T ss_pred             CCcCEEEECCCCCcccCCCEEEEEEcCCCCCC
Confidence            99999999999999999999999999877654
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 5e-32
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 8e-32
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 1e-30
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 2e-25
d1paza_120 b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, s 9e-05
d1pmya_123 b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorq 1e-04
d1bqka_124 b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclas 0.002
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

 Score =  108 bits (270), Expect = 5e-32
 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 4/104 (3%)

Query: 23  AETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNWT-GSHSVAEVSKADYDKCR 81
           A  + VGD  GWTT       Y+ WAS  KFH GD+++FN+    H+V +V +  +  C 
Sbjct: 2   ATVHKVGDSTGWTTLVP--YDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCN 59

Query: 82  TKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTINI 125
           + SP    + +   +  L   GT YF+C +  HC  GQKV I +
Sbjct: 60  SSSPAAS-YTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 102
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Length = 120 Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Length = 123 Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.17
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 99.07
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 99.06
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 99.05
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 99.05
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 99.04
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 99.02
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.95
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.94
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.88
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.85
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.85
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.79
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.75
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.73
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.54
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.35
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 98.19
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.99
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.49
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.28
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 97.22
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 97.09
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 96.62
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 96.46
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 96.34
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.24
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 96.17
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 95.65
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 95.14
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 95.05
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 92.15
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 91.55
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 90.89
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 90.33
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 87.37
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 85.84
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 82.91
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 80.22
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=2.2e-40  Score=236.90  Aligned_cols=103  Identities=37%  Similarity=0.754  Sum_probs=97.7

Q ss_pred             ceeEEEecCCCCCCCCCCCCCCccccccCCeeEeCcEEEEee-cCCCeeEEEcccccCcCcCCCCCCccccCCCcEEEec
Q 031882           22 AAETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEVSKADYDKCRTKSPDGEIHETSPANYTLN  100 (151)
Q Consensus        22 ~a~~~~VGg~~GW~~~~~~~~~Y~~Wa~~~tf~vGD~L~F~~-~~~H~V~~Vs~~~y~~C~~~~~~~~~~~~G~~~v~l~  100 (151)
                      .|++|+|||+.||+.+++  .+|++|+++++|++||+|+|+| ++.|+|.||++++|+.|+.++++ ..+++|++.|+|+
T Consensus         1 ~at~~~VGg~~gW~~~~~--~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~-~~~~~G~~~v~l~   77 (104)
T d1ws8a_           1 MATVHKVGDSTGWTTLVP--YDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPA-ASYTSGADSIPLK   77 (104)
T ss_dssp             CCCEEETTGGGCSCSSSC--CCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCS-EEECSSEEEEECC
T ss_pred             CCcEEEeCCcCccCcCCC--cCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCcc-ccccCCCeEEEEe
Confidence            378999999999998753  7899999999999999999999 99999999999999999999998 8889999999999


Q ss_pred             cCceEEEEeCCCCCCCCCCeEEEEecC
Q 031882          101 SNGTHYFICTVDSHCDRGQKVTINIGG  127 (151)
Q Consensus       101 ~~G~~YFiC~v~~HC~~GmKl~I~V~~  127 (151)
                      ++|++||+|++++||++|||++|+|++
T Consensus        78 ~~g~~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          78 RPGTFYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             SSEEEEEECCSTTTTTTTCEEEEEECC
T ss_pred             cCccEEEECCCcchhhCCCEEEEEECC
Confidence            999999999999999999999999975
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure