Citrus Sinensis ID: 031886

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
ccccccccccccccHHHHHHccEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccccccHHHHHHccEEEEccccccccHHHHHHHHHHHcccHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHcc
mkappktndvpvirphqlkeadgflfgfpsrfgVMAAQCKAFFDATYELWASQAlagkpagifwstgfhgggqeLTALTAVTQLAHhgmlfvplgytfgsgmfemnevkggssygagtfaadgsrqptDLELQQAFHQGKYVAEIAKKLKR
mkappktndvpvirpHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
MKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
****************QLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVK******************************************
******TNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTF***********ELQQAFHQGKYVAEIAKKLKR
********DVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
*******NDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q8Z7N9198 Flavoprotein WrbA OS=Salm N/A no 0.973 0.742 0.506 9e-33
B5XXP0198 Flavoprotein WrbA OS=Kleb yes no 0.966 0.737 0.503 2e-32
A8AI59198 Flavoprotein WrbA OS=Citr yes no 0.973 0.742 0.506 2e-32
P42058204 Minor allergen Alt a 7 OS N/A no 0.980 0.725 0.516 3e-32
Q3Z3B7201 Flavoprotein WrbA OS=Shig yes no 0.973 0.731 0.506 3e-32
P0A8G8198 Flavoprotein WrbA OS=Shig yes no 0.973 0.742 0.506 4e-32
Q0T630198 Flavoprotein WrbA OS=Shig yes no 0.973 0.742 0.506 4e-32
Q1RDL3198 Flavoprotein WrbA OS=Esch yes no 0.973 0.742 0.506 4e-32
B1LJ00198 Flavoprotein WrbA OS=Esch yes no 0.973 0.742 0.506 4e-32
B6I980198 Flavoprotein WrbA OS=Esch yes no 0.973 0.742 0.506 4e-32
>sp|Q8Z7N9|WRBA_SALTI Flavoprotein WrbA OS=Salmonella typhi GN=wrbA PE=3 SV=3 Back     alignment and function desciption
 Score =  139 bits (349), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 99/150 (66%), Gaps = 3/150 (2%)

Query: 2   KAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAG 61
           KA  KT + PV  P +L + D  +FG P+RFG M+ Q + F D T  LWAS AL GK  G
Sbjct: 50  KAGGKTQNAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGG 109

Query: 62  IFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA- 120
           +F STG  GGGQE T  +  T LAHHGM+ VP+GY+    +F++++V+GG+ YGA T A 
Sbjct: 110 VFSSTG-TGGGQEQTITSTWTTLAHHGMVIVPIGYS-AQELFDVSQVRGGTPYGATTIAG 167

Query: 121 ADGSRQPTDLELQQAFHQGKYVAEIAKKLK 150
            DGSRQP+  EL  A +QG+YVA +A KL 
Sbjct: 168 GDGSRQPSQEELSIARYQGEYVAGLAVKLN 197
Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.
Salmonella typhi (taxid: 90370)
>sp|B5XXP0|WRBA_KLEP3 Flavoprotein WrbA OS=Klebsiella pneumoniae (strain 342) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|A8AI59|WRBA_CITK8 Flavoprotein WrbA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|P42058|ALTA7_ALTAL Minor allergen Alt a 7 OS=Alternaria alternata GN=ALTA7 PE=1 SV=1 Back     alignment and function description
>sp|Q3Z3B7|WRBA_SHISS Flavoprotein WrbA OS=Shigella sonnei (strain Ss046) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|P0A8G8|WRBA_SHIFL Flavoprotein WrbA OS=Shigella flexneri GN=wrbA PE=3 SV=2 Back     alignment and function description
>sp|Q0T630|WRBA_SHIF8 Flavoprotein WrbA OS=Shigella flexneri serotype 5b (strain 8401) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q1RDL3|WRBA_ECOUT Flavoprotein WrbA OS=Escherichia coli (strain UTI89 / UPEC) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B1LJ00|WRBA_ECOSM Flavoprotein WrbA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B6I980|WRBA_ECOSE Flavoprotein WrbA OS=Escherichia coli (strain SE11) GN=wrbA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
255569313203 Flavoprotein wrbA, putative [Ricinus com 0.993 0.738 0.913 7e-75
224106287203 predicted protein [Populus trichocarpa] 0.993 0.738 0.853 4e-69
449450804203 PREDICTED: flavoprotein WrbA-like [Cucum 1.0 0.743 0.841 9e-69
356553062203 PREDICTED: flavoprotein wrbA-like [Glyci 0.993 0.738 0.833 1e-68
225434636211 PREDICTED: flavoprotein wrbA isoform 1 [ 0.993 0.710 0.84 4e-68
357490641203 Flavoprotein wrbA [Medicago truncatula] 0.993 0.738 0.82 4e-67
388499250204 unknown [Lotus japonicus] 0.993 0.735 0.8 2e-66
22327957207 quinone reductase-like protein [Arabidop 1.0 0.729 0.754 2e-62
297789297207 quinone reductase family protein [Arabid 1.0 0.729 0.748 1e-61
116785818203 unknown [Picea sitchensis] 0.986 0.733 0.74 3e-61
>gi|255569313|ref|XP_002525624.1| Flavoprotein wrbA, putative [Ricinus communis] gi|223535060|gb|EEF36742.1| Flavoprotein wrbA, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  284 bits (727), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (96%)

Query: 1   MKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPA 60
           MKAPPK +DVPVI+P QL EADGF+FGFPSRFGVMAAQ KAFFDAT ELWASQALAGKPA
Sbjct: 53  MKAPPKADDVPVIQPEQLLEADGFIFGFPSRFGVMAAQFKAFFDATGELWASQALAGKPA 112

Query: 61  GIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA 120
           GIFWSTGFHGGGQELTALTA+TQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGT+A
Sbjct: 113 GIFWSTGFHGGGQELTALTAITQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTYA 172

Query: 121 ADGSRQPTDLELQQAFHQGKYVAEIAKKLK 150
           ADG+R+PT+LELQQAFHQGKYVAEIAKKLK
Sbjct: 173 ADGTREPTELELQQAFHQGKYVAEIAKKLK 202

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106287|ref|XP_002314113.1| predicted protein [Populus trichocarpa] gi|222850521|gb|EEE88068.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449450804|ref|XP_004143152.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus] gi|449520663|ref|XP_004167353.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553062|ref|XP_003544877.1| PREDICTED: flavoprotein wrbA-like [Glycine max] Back     alignment and taxonomy information
>gi|225434636|ref|XP_002279668.1| PREDICTED: flavoprotein wrbA isoform 1 [Vitis vinifera] gi|297745921|emb|CBI15977.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357490641|ref|XP_003615608.1| Flavoprotein wrbA [Medicago truncatula] gi|355516943|gb|AES98566.1| Flavoprotein wrbA [Medicago truncatula] gi|388503242|gb|AFK39687.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388499250|gb|AFK37691.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|22327957|ref|NP_200688.2| quinone reductase-like protein [Arabidopsis thaliana] gi|79331364|ref|NP_001032099.1| quinone reductase-like protein [Arabidopsis thaliana] gi|8843802|dbj|BAA97350.1| 1,4-benzoquinone reductase-like [Arabidopsis thaliana] gi|17381198|gb|AAL36411.1| putative light harvesting pigment protein [Arabidopsis thaliana] gi|20465807|gb|AAM20008.1| putative light harvesting pigment protein [Arabidopsis thaliana] gi|332009722|gb|AED97105.1| quinone reductase-like protein [Arabidopsis thaliana] gi|332009723|gb|AED97106.1| quinone reductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297789297|ref|XP_002862630.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297796817|ref|XP_002866293.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297308269|gb|EFH38888.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312128|gb|EFH42552.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|116785818|gb|ABK23874.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:2178868207 AT5G58800 [Arabidopsis thalian 1.0 0.729 0.754 1.5e-60
TAIR|locus:2131749205 AT4G27270 [Arabidopsis thalian 0.986 0.726 0.753 3.5e-59
TAIR|locus:2115405273 AT4G36750 [Arabidopsis thalian 0.986 0.545 0.651 1.5e-49
CGD|CAL0003649199 PST3 [Candida albicans (taxid: 0.973 0.738 0.54 1.5e-33
ASPGD|ASPL0000059021204 AN0297 [Emericella nidulans (t 0.920 0.681 0.545 2e-33
CGD|CAL0003651288 YCP4 [Candida albicans (taxid: 0.986 0.517 0.516 5.2e-33
CGD|CAL0000303201 PST2 [Candida albicans (taxid: 0.907 0.681 0.535 1.8e-32
UNIPROTKB|Q59Y37201 PST2 "Putative uncharacterized 0.907 0.681 0.535 1.8e-32
CGD|CAL0006260198 PST1 [Candida albicans (taxid: 0.913 0.696 0.524 2.3e-32
UNIPROTKB|P0A8G6198 wrbA [Escherichia coli K-12 (t 0.966 0.737 0.510 2.3e-32
TAIR|locus:2178868 AT5G58800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 620 (223.3 bits), Expect = 1.5e-60, P = 1.5e-60
 Identities = 114/151 (75%), Positives = 132/151 (87%)

Query:     1 MKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPA 60
             +KA P+ +DVP IRP QL EADGF+FGFPSRFGVMA+Q   FFD T +LW +QALAGKPA
Sbjct:    53 VKAVPRPDDVPDIRPEQLAEADGFMFGFPSRFGVMASQVMTFFDNTNDLWTTQALAGKPA 112

Query:    61 GIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA 120
             GIFWSTGFHGGGQELTALTAVT+LAHHGM+FVP+GYTFG  M+EM EVKGGS YG+GT+A
Sbjct:   113 GIFWSTGFHGGGQELTALTAVTKLAHHGMIFVPVGYTFGKSMYEMGEVKGGSPYGSGTYA 172

Query:   121 ADGSRQPTDLELQQAFHQGKYVAEIAKKLKR 151
             ADGSR+PT+LE+QQA + GKY A IAKKLK+
Sbjct:   173 ADGSREPTELEIQQANYHGKYFAGIAKKLKK 203
GO:0005737 "cytoplasm" evidence=ISM
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2131749 AT4G27270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115405 AT4G36750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003649 PST3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059021 AN0297 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0003651 YCP4 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
CGD|CAL0000303 PST2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59Y37 PST2 "Putative uncharacterized protein CQR2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
CGD|CAL0006260 PST1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0A8G6 wrbA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7N3F9WRBA_ECOLUNo assigned EC number0.50660.97350.7424yesno
Q1CHD6WRBA_YERPNNo assigned EC number0.50990.97350.7386yesno
B7UNY7WRBA_ECO27No assigned EC number0.50660.97350.7424yesno
Q0T630WRBA_SHIF8No assigned EC number0.50660.97350.7424yesno
B7LFB3WRBA_ECO55No assigned EC number0.50660.97350.7424yesno
B7LP27WRBA_ESCF3No assigned EC number0.50660.97350.7424yesno
A1A9Q9WRBA_ECOK1No assigned EC number0.50660.97350.7424yesno
Q32HQ6WRBA_SHIDSNo assigned EC number0.50660.97350.7424yesno
Q1RDL3WRBA_ECOUTNo assigned EC number0.50660.97350.7424yesno
C4ZQD2WRBA_ECOBWNo assigned EC number0.50660.97350.7424yesno
B6I980WRBA_ECOSENo assigned EC number0.50660.97350.7424yesno
B7NLC1WRBA_ECO7INo assigned EC number0.50660.97350.7424yesno
B7M8Y8WRBA_ECO8ANo assigned EC number0.50660.97350.7424yesno
B2K198WRBA_YERPBNo assigned EC number0.50990.97350.7386yesno
A8AI59WRBA_CITK8No assigned EC number0.50660.97350.7424yesno
P25349YCP4_YEASTNo assigned EC number0.51650.98670.6032yesno
B1X9C5WRBA_ECODHNo assigned EC number0.50660.97350.7424yesno
B7MIE9WRBA_ECO45No assigned EC number0.50660.97350.7424yesno
B5YU47WRBA_ECO5ENo assigned EC number0.50660.97350.7424yesno
P0A8G7WRBA_ECOL6No assigned EC number0.50660.97350.7424yesno
A7ZYV7WRBA_ECOHSNo assigned EC number0.50660.97350.7424yesno
Q8ZF61WRBA_YERPENo assigned EC number0.50990.97350.7386yesno
Q0TJ63WRBA_ECOL5No assigned EC number0.50660.97350.7424yesno
B1IV93WRBA_ECOLCNo assigned EC number0.50660.97350.7424yesno
A4TK49WRBA_YERPPNo assigned EC number0.50990.97350.7386yesno
P0A8G8WRBA_SHIFLNo assigned EC number0.50660.97350.7424yesno
B1LJ00WRBA_ECOSMNo assigned EC number0.50660.97350.7424yesno
A7ZKA9WRBA_ECO24No assigned EC number0.50660.97350.7424yesno
B1JNA9WRBA_YERPYNo assigned EC number0.50990.97350.7386yesno
Q3Z3B7WRBA_SHISSNo assigned EC number0.50660.97350.7313yesno
A9R7R8WRBA_YERPGNo assigned EC number0.50990.97350.7386yesno
Q66BP3WRBA_YERPSNo assigned EC number0.50990.97350.7386yesno
B5XXP0WRBA_KLEP3No assigned EC number0.50330.96680.7373yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00091203
hypothetical protein (203 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
PRK03767200 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase 8e-53
TIGR01755197 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreducta 5e-44
COG0655207 COG0655, WrbA, Multimeric flavodoxin WrbA [General 5e-31
pfam03358151 pfam03358, FMN_red, NADPH-dependent FMN reductase 4e-09
pfam00258142 pfam00258, Flavodoxin_1, Flavodoxin 4e-04
>gnl|CDD|179647 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information 
 Score =  165 bits (420), Expect = 8e-53
 Identities = 72/142 (50%), Positives = 88/142 (61%), Gaps = 2/142 (1%)

Query: 11  PVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHG 70
           PV  P +L + D  +FG P+RFG MA Q + F D T  LWA  AL GK   +F STG   
Sbjct: 60  PVATPDELADYDAIIFGTPTRFGNMAGQMRNFLDQTGGLWAKGALVGKVGSVFTSTGTQH 119

Query: 71  GGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA-ADGSRQPTD 129
           GGQE T  +  T L HHGM+ V L Y F  G  +++EV GGS YGA T A  DGSRQP++
Sbjct: 120 GGQETTITSTHTTLLHHGMVIVGLPYAF-QGQMDVDEVTGGSPYGATTIAGGDGSRQPSE 178

Query: 130 LELQQAFHQGKYVAEIAKKLKR 151
            EL  A +QG++VAEIA KL  
Sbjct: 179 NELAGARYQGRHVAEIAAKLAG 200

Length = 200
>gnl|CDD|130816 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>gnl|CDD|223728 COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>gnl|CDD|217511 pfam03358, FMN_red, NADPH-dependent FMN reductase Back     alignment and domain information
>gnl|CDD|215823 pfam00258, Flavodoxin_1, Flavodoxin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG3135203 consensus 1,4-benzoquinone reductase-like; Trp rep 100.0
TIGR01755197 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. 99.96
PRK03767200 NAD(P)H:quinone oxidoreductase; Provisional 99.96
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 99.88
PRK05569141 flavodoxin; Provisional 99.69
PRK06242150 flavodoxin; Provisional 99.68
PRK05568142 flavodoxin; Provisional 99.66
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 99.65
PRK06756148 flavodoxin; Provisional 99.63
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 99.62
TIGR01753140 flav_short flavodoxin, short chain. Flavodoxins ar 99.62
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 99.61
TIGR03566174 FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb 99.57
PRK06703151 flavodoxin; Provisional 99.55
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 99.53
PRK07308146 flavodoxin; Validated 99.53
TIGR03567171 FMN_reduc_SsuE FMN reductase, SsuE family. Members 99.49
TIGR02690219 resist_ArsH arsenical resistance protein ArsH. Mem 99.44
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 99.44
PRK00170201 azoreductase; Reviewed 99.4
PRK09267169 flavodoxin FldA; Validated 99.35
PRK01355199 azoreductase; Reviewed 99.29
PRK13556208 azoreductase; Provisional 99.26
PRK09739199 hypothetical protein; Provisional 99.25
COG0431184 Predicted flavoprotein [General function predictio 99.23
PRK13555208 azoreductase; Provisional 99.14
PRK12359172 flavodoxin FldB; Provisional 99.14
TIGR01752167 flav_long flavodoxin, long chain. Flavodoxins are 99.11
PF02525199 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR0 99.1
PRK04930184 glutathione-regulated potassium-efflux system anci 98.99
COG1182202 AcpD Acyl carrier protein phosphodiesterase [Lipid 98.97
PRK00871176 glutathione-regulated potassium-efflux system anci 98.93
KOG4530199 consensus Predicted flavoprotein [General function 98.92
PRK09271160 flavodoxin; Provisional 98.87
PRK06934221 flavodoxin; Provisional 98.84
PRK07116160 flavodoxin; Provisional 98.72
PF12682156 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A. 98.7
PF12724143 Flavodoxin_5: Flavodoxin domain 98.61
TIGR01754140 flav_RNR ribonucleotide reductase-associated flavo 98.6
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 98.48
COG2249189 MdaB Putative NADPH-quinone reductase (modulator o 98.44
PRK09004146 FMN-binding protein MioC; Provisional 98.36
PF00258143 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This 98.34
PF12641160 Flavodoxin_3: Flavodoxin domain 98.28
COG0716151 FldA Flavodoxins [Energy production and conversion 97.95
PRK08105149 flavodoxin; Provisional 97.86
PRK05723151 flavodoxin; Provisional 97.42
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 97.12
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 97.1
COG4635175 HemG Flavodoxin [Energy production and conversion 96.96
PRK03600134 nrdI ribonucleotide reductase stimulatory protein; 96.7
TIGR00333125 nrdI ribonucleoside-diphosphate reductase 2, opero 96.4
>KOG3135 consensus 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-32  Score=197.07  Aligned_cols=151  Identities=72%  Similarity=1.149  Sum_probs=144.7

Q ss_pred             CCCCCCCCCCCCCChHHHhhCCEeEEeccccCCcchHHHHHHHHHhhhhhhhccCCCCcEEEEEccCCCCccHHHHHHHH
Q 031886            1 MKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTA   80 (151)
Q Consensus         1 ~~~~~~~~~~~~~~~~~l~~aD~iIlgsPtY~~~~~~~~K~flDrl~~~~~~~~l~gK~~~~f~s~g~~~g~~~~~l~~~   80 (151)
                      |+||||+.|+|+++.+.+.++|+.+||-||.||++++++|+|+|+...+|....|.||++++|.|.|+.+|+++.+..+-
T Consensus        50 m~a~pkp~d~piit~~~L~e~D~flFG~PTRfG~~~AQ~kaF~D~TggLW~~~aL~GK~AG~F~Stgs~gGgqE~talta  129 (203)
T KOG3135|consen   50 MKAPPKPSDYPIITPETLTEYDGFLFGFPTRFGNMPAQWKAFWDSTGGLWAKGALAGKPAGIFVSTGSQGGGQETTALTA  129 (203)
T ss_pred             hcCCCCCccCCccCHHHHhhccceeecccccccCcHHHHHHHHhccCchhhhccccCCceeEEEeccCCCCchHhHHHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999998889999999999


Q ss_pred             HHHHHhcCcEEecCCCC-CCCCCccccccccccccccceecC-CCCCCCCHHHHHHHHHHHHHHHHHHHHhhC
Q 031886           81 VTQLAHHGMLFVPLGYT-FGSGMFEMNEVKGGSSYGAGTFAA-DGSRQPTDLELQQAFHQGKYVAEIAKKLKR  151 (151)
Q Consensus        81 ~~~l~~~g~~~v~~g~~-~~~~~~~~~~~~~~~~~g~~~~~~-~~~~~p~e~~l~~a~~lG~~la~~~~~l~~  151 (151)
                      ...|.+|||++|+.||. ....+.+++++++|++||++++++ |+.+.|++.+++.++-.|+-+++.+++|++
T Consensus       130 ~t~LvHHGmifVPlGYkn~~a~m~~me~V~Ggsp~GAGt~Ag~DGsR~ps~lEL~~a~~qGk~f~~~~kkl~~  202 (203)
T KOG3135|consen  130 ITQLVHHGMIFVPLGYKNFGAEMFEMEEVHGGSPWGAGTFAGIDGSREPSELELQQAEIQGKYFAEIVKKLKG  202 (203)
T ss_pred             HHHHHhcceEEEecccchhhhhhhhhhcccCCCCCCCceeecCCCCCCCCHHHHHHHHHhhHHHHHHHHHhcC
Confidence            99999999999999999 566778899999999999999999 999999999999999999999999999874

>TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>PRK06242 flavodoxin; Provisional Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01753 flav_short flavodoxin, short chain Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>PRK07308 flavodoxin; Validated Back     alignment and domain information
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family Back     alignment and domain information
>TIGR02690 resist_ArsH arsenical resistance protein ArsH Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK00170 azoreductase; Reviewed Back     alignment and domain information
>PRK09267 flavodoxin FldA; Validated Back     alignment and domain information
>PRK01355 azoreductase; Reviewed Back     alignment and domain information
>PRK13556 azoreductase; Provisional Back     alignment and domain information
>PRK09739 hypothetical protein; Provisional Back     alignment and domain information
>COG0431 Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PRK13555 azoreductase; Provisional Back     alignment and domain information
>PRK12359 flavodoxin FldB; Provisional Back     alignment and domain information
>TIGR01752 flav_long flavodoxin, long chain Back     alignment and domain information
>PF02525 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR003680 This family consists of a domain with a flavodoxin-like fold Back     alignment and domain information
>PRK04930 glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional Back     alignment and domain information
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism] Back     alignment and domain information
>PRK00871 glutathione-regulated potassium-efflux system ancillary protein KefF; Provisional Back     alignment and domain information
>KOG4530 consensus Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PRK06934 flavodoxin; Provisional Back     alignment and domain information
>PRK07116 flavodoxin; Provisional Back     alignment and domain information
>PF12682 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A Back     alignment and domain information
>PF12724 Flavodoxin_5: Flavodoxin domain Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG2249 MdaB Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only] Back     alignment and domain information
>PRK09004 FMN-binding protein MioC; Provisional Back     alignment and domain information
>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase Back     alignment and domain information
>PF12641 Flavodoxin_3: Flavodoxin domain Back     alignment and domain information
>COG0716 FldA Flavodoxins [Energy production and conversion] Back     alignment and domain information
>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>PRK05723 flavodoxin; Provisional Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Back     alignment and domain information
>TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
3b6i_A198 Wrba From Escherichia Coli, Native Structure Length 3e-33
1zwk_A207 Structure Of Wrba From Pseudomonas Aeruginosa Lengt 1e-19
2zki_A199 Crystal Structure Of Hypothetical Trp Repressor Bin 2e-19
2a5l_A200 The Crystal Structure Of The Trp Repressor Binding 1e-12
1ydg_A211 Crystal Structure Of Trp Repressor Binding Protein 4e-11
1yrh_A211 Crystal Structure Of Trp Repressor Binding Protein 5e-11
>pdb|3B6I|A Chain A, Wrba From Escherichia Coli, Native Structure Length = 198 Back     alignment and structure 
Iteration: 1

 Score =  137 bits (344), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 97/150 (64%), Gaps = 3/150 (2%)
Query: 2   KAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAG 61
           KA  KT   PV  P +L + D  +FG P+RFG M+ Q + F D T  LWAS AL GK A 
Sbjct: 50  KAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLAS 109
Query: 62  IFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA- 120
           +F STG  GGGQE T  +  T LAHHGM+ VP+GY     +F++++V+GG+ YGA T A 
Sbjct: 110 VFSSTG-TGGGQEQTITSTWTTLAHHGMVIVPIGYA-AQELFDVSQVRGGTPYGATTIAG 167
Query: 121 ADGSRQPTDLELQQAFHQGKYVAEIAKKLK 150
            DGSRQP+  EL  A +QG+YVA +A KL 
Sbjct: 168 GDGSRQPSQEELSIARYQGEYVAGLAVKLN 197
>pdb|1ZWK|A Chain A, Structure Of Wrba From Pseudomonas Aeruginosa Length = 207 Back     alignment and structure
>pdb|2ZKI|A Chain A, Crystal Structure Of Hypothetical Trp Repressor Binding Protein From Sul Folobus Tokodaii (St0872) Length = 199 Back     alignment and structure
>pdb|2A5L|A Chain A, The Crystal Structure Of The Trp Repressor Binding Protein Wrba From Pseudomonas Aeruginosa Length = 200 Back     alignment and structure
>pdb|1YDG|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba Length = 211 Back     alignment and structure
>pdb|1YRH|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba In Complex With Fmn Length = 211 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 1e-62
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 3e-62
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 1e-60
2zki_A199 199AA long hypothetical Trp repressor binding prot 3e-60
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 1e-57
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 3e-48
1sqs_A242 Conserved hypothetical protein; structural genomic 7e-11
3edo_A151 Flavoprotein, putative Trp repressor binding prote 8e-07
1rli_A184 Trp repressor binding protein; structural genomics 2e-06
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 3e-05
2fzv_A279 Putative arsenical resistance protein; flavin bind 9e-05
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 2e-04
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 6e-04
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Length = 200 Back     alignment and structure
 Score =  189 bits (483), Expect = 1e-62
 Identities = 57/150 (38%), Positives = 72/150 (48%), Gaps = 4/150 (2%)

Query: 2   KAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAG 61
                           LK   G   G P+RFG MA+  K F D T  LW + +L GKPA 
Sbjct: 53  APDIPAEGALYATLEDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLWLTGSLVGKPAA 112

Query: 62  IFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA- 120
           +F ST    GGQE T L+ +  L HHGML + + Y+  +    +    GG+ YGA  FA 
Sbjct: 113 VFTSTASLHGGQETTQLSMLLPLLHHGMLVLGIPYSEPA---LLETRGGGTPYGASHFAG 169

Query: 121 ADGSRQPTDLELQQAFHQGKYVAEIAKKLK 150
           ADG R   + EL      GK +AE A KL 
Sbjct: 170 ADGKRSLDEHELTLCRALGKRLAETAGKLG 199
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Length = 198 Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Length = 211 Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Length = 199 Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Length = 193 Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Length = 188 Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Length = 242 Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Length = 151 Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Length = 184 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Length = 247 Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Length = 279 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Length = 191 Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 99.92
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 99.91
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 99.9
2zki_A199 199AA long hypothetical Trp repressor binding prot 99.89
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 99.89
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 99.84
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 99.73
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 99.71
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 99.71
2fzv_A279 Putative arsenical resistance protein; flavin bind 99.71
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 99.7
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 99.7
1sqs_A242 Conserved hypothetical protein; structural genomic 99.7
1rtt_A193 Conserved hypothetical protein; protein structure 99.68
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 99.68
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 99.67
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 99.67
3u7r_A190 NADPH-dependent FMN reductase; alpha/beta twisted 99.66
1rli_A184 Trp repressor binding protein; structural genomics 99.66
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 99.63
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 99.62
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.61
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 99.38
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 99.58
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.57
2hpv_A208 FMN-dependent NADH-azoreductase; structural genomi 99.55
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 99.54
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 99.53
1t5b_A201 Acyl carrier protein phosphodiesterase; structural 99.51
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 99.49
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.48
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 99.48
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.47
3r6w_A212 FMN-dependent NADH-azoreductase 1; nitrofurazone, 99.42
3f2v_A192 General stress protein 14; alpha-beta protein., st 99.38
3u7i_A223 FMN-dependent NADH-azoreductase 1; structural geno 99.37
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 99.37
3p0r_A211 Azoreductase; structural genomics, center for stru 99.37
2amj_A204 Modulator of drug activity B; oxidoreductase, mena 99.36
3lcm_A196 SMU.1420, putative oxidoreductase; NADPH:quinone o 99.34
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 99.33
3ha2_A177 NADPH-quinone reductase; structural genomics, PSI- 99.32
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 99.3
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 99.26
1ag9_A175 Flavodoxin; electron transport, reductive activati 99.26
1d4a_A273 DT-diaphorase, quinone reductase; flavoprotein, ro 99.24
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 99.22
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 99.22
3tem_A228 Ribosyldihydronicotinamide dehydrogenase [quinone; 99.18
3rpe_A218 MDAB, modulator of drug activity B; structural gen 99.17
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 99.15
3klb_A162 Putative flavoprotein; structural genomi center fo 99.08
4ici_A171 Putative flavoprotein; PF12682 family protein, fla 99.05
3edo_A151 Flavoprotein, putative Trp repressor binding prote 99.04
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 98.97
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 98.93
4gi5_A280 Quinone reductase; protein structure initiative, F 98.89
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 98.79
2xod_A119 NRDI protein, NRDI; flavoprotein, redox protein, r 98.62
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 98.38
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 98.33
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 97.73
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 97.72
3n3a_C153 Protein NRDI; ribonucleotide reductase, four-helix 96.95
1rlj_A139 NRDI protein; flavoprotein, FMN, thioredoxin, alph 96.92
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure
Probab=99.92  E-value=1.4e-24  Score=161.33  Aligned_cols=143  Identities=25%  Similarity=0.246  Sum_probs=106.4

Q ss_pred             CCCCCChHHHhhCCEeEEeccccCCcchHHHHHHHHHhhhhhhhccCCCCcEEEEEccCCCCccHHHHHHHHHHHHHhcC
Q 031886            9 DVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHG   88 (151)
Q Consensus         9 ~~~~~~~~~l~~aD~iIlgsPtY~~~~~~~~K~flDrl~~~~~~~~l~gK~~~~f~s~g~~~g~~~~~l~~~~~~l~~~g   88 (151)
                      ++++...+++.+||+||||||+|++++++++|+|+|++..+|....++||++++|+++|+..++.+.++.++...+..+|
T Consensus        43 ~~~~~~~~~l~~~D~ii~gsP~y~g~~~~~~k~fld~~~~~~~~~~l~gK~~~~f~s~g~~~g~~~~~l~~l~~~l~~~G  122 (193)
T 3d7n_A           43 NLSEDGWAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPWFSAKWQDKVFGGFTNSASLNGDKLNTLQYLVLLAGQHG  122 (193)
T ss_dssp             CCCHHHHHHHHHCSEEEEEEEEETTEECHHHHHHHHHTHHHHHTTTTTTCEEEEEEEESSCHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCHhHHHHHHHCCEEEEEeCccCCCccHHHHHHHHHhhhhccccccCCCEEEEEEECCCCCCChHHHHHHHHHHHHHCC
Confidence            34443368999999999999999999999999999999887776789999999999998876777889999999999999


Q ss_pred             cEEecCCCCCCCCC--ccccccccccccccceecC-CC-CCCCCHHHHHHHHHHHHHHHHHHHHhhC
Q 031886           89 MLFVPLGYTFGSGM--FEMNEVKGGSSYGAGTFAA-DG-SRQPTDLELQQAFHQGKYVAEIAKKLKR  151 (151)
Q Consensus        89 ~~~v~~g~~~~~~~--~~~~~~~~~~~~g~~~~~~-~~-~~~p~e~~l~~a~~lG~~la~~~~~l~~  151 (151)
                      |.+++.++..+...  ...+....|++||..++.+ ++ ...|+++++++|+++|++|++.+++|++
T Consensus       123 ~~~vg~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~d~~~l~~a~~~G~~la~~~~~l~~  189 (193)
T 3d7n_A          123 GLWVSLGIKPSNLKSSVRNDANRMGSYIAPMAQSDADAAPEEMSVGDLETARLYGARVANVARQHKS  189 (193)
T ss_dssp             CEECCCC-------------------CCSCEEEC-------CCCHHHHHHHHHHHHHHHHHHHHTC-
T ss_pred             CEEeCCccCcccccccccccCCCCCCcceeeEEcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999876543200  0011223466688776653 22 1238999999999999999999998863
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} SCOP: c.23.5.4 PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3r6w_A FMN-dependent NADH-azoreductase 1; nitrofurazone, P. aeruginosa, nitroreductase, flavodoxin, oxidoreductase; HET: FMN NFZ; 2.08A {Pseudomonas aeruginosa} PDB: 3lt5_A* 2v9c_A* 3keg_A* Back     alignment and structure
>3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} Back     alignment and structure
>3u7i_A FMN-dependent NADH-azoreductase 1; structural genomics, the center for structural genomics of I diseases, csgid, oxidoreductase; HET: MSE; 1.75A {Bacillus anthracis} Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Back     alignment and structure
>3p0r_A Azoreductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>2amj_A Modulator of drug activity B; oxidoreductase, menadione, DT-diaphorase, montreal-kingston structural genomics initiative, BSGI; 1.80A {Escherichia coli} PDB: 2b3d_A* Back     alignment and structure
>3lcm_A SMU.1420, putative oxidoreductase; NADPH:quinone oxidoreductase, MDAB; HET: FAD NAP; 1.80A {Streptococcus mutans} PDB: 4f8y_A* Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Back     alignment and structure
>3ha2_A NADPH-quinone reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics, consortium, NESG; HET: MSE; 1.80A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Back     alignment and structure
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A* Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Back     alignment and structure
>3tem_A Ribosyldihydronicotinamide dehydrogenase [quinone; oxidoreductase-oxidoreductase inhibitor complex; HET: FAD 6A1 IMD; 1.45A {Homo sapiens} SCOP: c.23.5.3 PDB: 3te7_A* 3tzb_A* 3fw1_A* 2qwx_A* 1zx1_A* 3g5m_A* 3gam_A* 3ovm_A* 3owh_A* 3owx_A* 3ox1_A* 3ox2_A* 3ox3_A* 1sg0_A* 1qr2_A* 1xi2_A* 2qmy_A* 2qmz_A* 2qr2_A* 2qx4_A* ... Back     alignment and structure
>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} Back     alignment and structure
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Back     alignment and structure
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A* Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C* Back     alignment and structure
>1rlj_A NRDI protein; flavoprotein, FMN, thioredoxin, alpha/beta/alpha sandwich, structural genomics, PSI, protein structure initiative; HET: FMN; 2.00A {Bacillus subtilis} SCOP: c.23.5.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d1ydga_201 c.23.5.8 (A:) Trp repressor binding protein WrbA { 3e-35
d2a5la1196 c.23.5.8 (A:3-198) Trp repressor binding protein W 5e-33
d2arka1184 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolic 2e-23
d1sqsa_232 c.23.5.5 (A:) Hypothetical protein SP1951 {(Strept 8e-13
d1e5da1152 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreduct 4e-09
d1rlia_179 c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus 1e-08
d1nni1_171 c.23.5.4 (1:) Azobenzene reductase {Bacillus subti 2e-06
d1t0ia_185 c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker 1e-05
d1ycga1149 c.23.5.1 (A:251-399) Nitric oxide reductase C-term 3e-05
d1vmea1148 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, 0.001
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

 Score =  119 bits (298), Expect = 3e-35
 Identities = 45/150 (30%), Positives = 59/150 (39%), Gaps = 7/150 (4%)

Query: 2   KAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAG 61
                  DVP   P  L+ A+  +F  P+RFG   +Q +AF D    LW+S  LA K   
Sbjct: 56  ANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFS 115

Query: 62  IFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAA 121
              S     GGQE T  T      H G +  P GYT            GG+ YGA   A 
Sbjct: 116 AMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIF-----KSGGNPYGASVTA- 169

Query: 122 DGSRQPTDLELQQAFHQGKYVAEIAKKLKR 151
              +   + +     HQ +   E+  KL  
Sbjct: 170 -NGQPLLENDRASIRHQVRRQVELTAKLLE 198
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Length = 196 Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Length = 184 Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Length = 232 Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 152 Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Length = 171 Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 185 Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 149 Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 148 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 99.95
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 99.94
d2a5la1196 Trp repressor binding protein WrbA {Pseudomonas ae 99.93
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 99.77
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 99.76
d1sqsa_232 Hypothetical protein SP1951 {(Streptococcus pneumo 99.74
d1rlia_179 Hypothetical protein YwqN {Bacillus subtilis [TaxI 99.71
d1nni1_171 Azobenzene reductase {Bacillus subtilis [TaxId: 14 99.7
d2fzva1233 Putative arsenical resistance protein {Shigella fl 99.67
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 99.62
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 99.56
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 99.54
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 99.53
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 99.45
d2z98a1200 ACP phosphodiesterase AcpD {Escherichia coli [TaxI 99.34
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 99.11
d1d4aa_273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 99.07
d1oboa_169 Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 11 98.86
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 98.82
d1czna_169 Flavodoxin {Synechococcus elongatus PCC 7942 [TaxI 98.81
d1ag9a_175 Flavodoxin {Escherichia coli [TaxId: 562]} 98.57
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 98.56
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 98.46
d1fuea_163 Flavodoxin {Helicobacter pylori [TaxId: 210]} 98.13
d1ykga1146 Sulfite reductase alpha-component CysJ N-terminal 98.02
d1ja1a2177 NADPH-cytochrome p450 reductase, N-terminal domain 96.78
d1bvyf_152 FMN-binding domain of the cytochrome P450bm-3 {Bac 96.25
d1tlla2202 Nitric oxide (NO) synthase FMN domain {Rat (Rattus 96.12
d1rlja_135 Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423] 95.94
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

Probab=99.95  E-value=1.5e-27  Score=176.75  Aligned_cols=134  Identities=33%  Similarity=0.429  Sum_probs=116.9

Q ss_pred             CCCCChHHHhhCCEeEEeccccCCcchHHHHHHHHHhhhhhhhccCCCCcEEEEEccCCCCccHHHHHHHHHHHHHhcCc
Q 031886           10 VPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGM   89 (151)
Q Consensus        10 ~~~~~~~~l~~aD~iIlgsPtY~~~~~~~~K~flDrl~~~~~~~~l~gK~~~~f~s~g~~~g~~~~~l~~~~~~l~~~g~   89 (151)
                      ......++|.+||+|||||||||++++++||+||||+..+|....+.||+++.|+++|+.+++++.++..+...+.+++|
T Consensus        64 ~~~~~~~~i~~aD~ii~gsPvy~~~~s~~~k~flDr~~~~~~~~~l~gK~~~~~~s~g~~~gg~e~~~~~~~~~~~~~g~  143 (201)
T d1ydga_          64 VPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGA  143 (201)
T ss_dssp             SCBCCHHHHHHCSEEEEEEEEETTEECHHHHHHHHTTHHHHHTTTTTTCEEEEEEEESSTTSSTTHHHHHHHHHHHTTTC
T ss_pred             chhhhhhhHhhCCEeEEecceeeeeccchhHHHHHHhhhHHhccccCCceeeeeeccccCCCchHHHHHhHHHHHHHcCC
Confidence            33444999999999999999999999999999999999888888899999999999999888999999999999999999


Q ss_pred             EEecCCCCCCCCCccccccccccccccceecCCCCCCCCHHHHHHHHHHHHHHHHHHHHhh
Q 031886           90 LFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLK  150 (151)
Q Consensus        90 ~~v~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~p~e~~l~~a~~lG~~la~~~~~l~  150 (151)
                      .+++.++....     .....+++||..+.+.  ...++|++++.|++||+++|+.+++|+
T Consensus       144 ~~v~~~~~~~~-----~~~~gg~~~G~~~~~~--~~~~~e~~l~~ar~lGk~la~~a~kL~  197 (201)
T d1ydga_         144 VLTPPGYTDEV-----IFKSGGNPYGASVTAN--GQPLLENDRASIRHQVRRQVELTAKLL  197 (201)
T ss_dssp             EECCCTTCSHH-----HHHTTCCSSSCEEECC--SSCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccccccchh-----hhcCCCcccCcceecC--CCCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            99987765411     2234677899888864  256999999999999999999999986
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z98a1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure