Citrus Sinensis ID: 031969


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDERTCTGA
cccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccc
cccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHEEEEEEEEEcHHHccHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccc
mhklsrsnrdKLQQFVSITGASEKAALQALKASdwhlegafdvfysqpqsksltdtRHLEELYNrykdpyldmILVDGITLLcndlqvdpqdIVMLVVSWHMKAATMCEFSKQEFigglqslgidsLDKFRERISFMRAELKdertctga
mhklsrsnrdklQQFVSITGASEKAALQALKASDWHLEGAFDVfysqpqsksltdtrHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMraelkdertctga
MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDERTCTGA
************************AALQALKASDWHLEGAFDVFYSQ*****LTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFM*************
************QQFVSITGASEKAALQALKASDWHLEGAFDVFY**********TRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMR************
**********KLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAEL*********
*******NRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQS*SLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDERTCTGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q96GG9 259 DCN1-like protein 1 OS=Ho yes no 0.953 0.552 0.446 5e-31
Q8BZJ7 259 DCN1-like protein 2 OS=Mu no no 0.953 0.552 0.426 2e-30
Q5ZKU1 259 DCN1-like protein 1 OS=Ga yes no 0.953 0.552 0.44 2e-30
Q9QZ73 259 DCN1-like protein 1 OS=Mu no no 0.953 0.552 0.44 3e-30
Q6PH85 259 DCN1-like protein 2 OS=Ho no no 0.953 0.552 0.426 6e-30
Q9VUQ8 288 DCN1-like protein OS=Dros yes no 0.953 0.496 0.356 1e-21
A4IHK8 303 DCN1-like protein 3 OS=Xe no no 0.933 0.462 0.344 2e-16
Q4V8B2 304 DCN1-like protein 3 OS=Ra no no 0.586 0.289 0.420 9e-16
Q5E9V1 304 DCN1-like protein 3 OS=Bo no no 0.653 0.322 0.393 1e-15
Q8K0V2 304 DCN1-like protein 3 OS=Mu no no 0.586 0.289 0.420 1e-15
>sp|Q96GG9|DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens GN=DCUN1D1 PE=1 SV=1 Back     alignment and function desciption
 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 96/150 (64%), Gaps = 7/150 (4%)

Query: 1   MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQ------SKSLT 54
           M+KL  S +DK++QF+  T +SEK A+  L  +DW L+ A D F+  P+       K   
Sbjct: 1   MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSL 60

Query: 55  DTRHLEELYNRYKDPY-LDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQ 113
           D + LE+LYNRYKDP   + I +DGI   C+DL +DP  I +L+++W  +AAT CEFSKQ
Sbjct: 61  DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQ 120

Query: 114 EFIGGLQSLGIDSLDKFRERISFMRAELKD 143
           EF+ G+  LG DS++K + +I  M  ELK+
Sbjct: 121 EFMDGMTELGCDSIEKLKAQIPKMEQELKE 150




Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.
Homo sapiens (taxid: 9606)
>sp|Q8BZJ7|DCNL2_MOUSE DCN1-like protein 2 OS=Mus musculus GN=Dcun1d2 PE=2 SV=3 Back     alignment and function description
>sp|Q5ZKU1|DCNL1_CHICK DCN1-like protein 1 OS=Gallus gallus GN=DCUN1D1 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZ73|DCNL1_MOUSE DCN1-like protein 1 OS=Mus musculus GN=Dcun1d1 PE=2 SV=1 Back     alignment and function description
>sp|Q6PH85|DCNL2_HUMAN DCN1-like protein 2 OS=Homo sapiens GN=DCUN1D2 PE=1 SV=1 Back     alignment and function description
>sp|Q9VUQ8|DCN1L_DROME DCN1-like protein OS=Drosophila melanogaster GN=CG7427 PE=1 SV=2 Back     alignment and function description
>sp|A4IHK8|DCNL3_XENTR DCN1-like protein 3 OS=Xenopus tropicalis GN=dcun1d3 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8B2|DCNL3_RAT DCN1-like protein 3 OS=Rattus norvegicus GN=Dcun1d3 PE=2 SV=1 Back     alignment and function description
>sp|Q5E9V1|DCNL3_BOVIN DCN1-like protein 3 OS=Bos taurus GN=DCUN1D3 PE=2 SV=1 Back     alignment and function description
>sp|Q8K0V2|DCNL3_MOUSE DCN1-like protein 3 OS=Mus musculus GN=Dcun1d3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
255555594 261 Defective in cullin neddylation protein, 0.966 0.555 0.889 5e-73
224098848 259 predicted protein [Populus trichocarpa] 0.966 0.559 0.841 9e-71
359494685 259 PREDICTED: DCN1-like protein 2-like [Vit 0.966 0.559 0.834 1e-68
297736127 309 unnamed protein product [Vitis vinifera] 0.966 0.469 0.834 1e-68
343171976249 hypothetical protein, partial [Silene la 0.966 0.582 0.848 1e-68
343171974249 hypothetical protein, partial [Silene la 0.966 0.582 0.848 3e-68
356525740 259 PREDICTED: DCN1-like protein 2-like [Gly 0.966 0.559 0.827 2e-67
356557032 259 PREDICTED: uncharacterized protein LOC10 0.966 0.559 0.820 2e-67
388500426 259 unknown [Lotus japonicus] 0.96 0.555 0.826 1e-66
449519908 259 PREDICTED: DCN1-like protein 2-like [Cuc 0.966 0.559 0.813 2e-66
>gi|255555594|ref|XP_002518833.1| Defective in cullin neddylation protein, putative [Ricinus communis] gi|223542006|gb|EEF43551.1| Defective in cullin neddylation protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 129/145 (88%), Positives = 140/145 (96%)

Query: 1   MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLE 60
           MHKL+R NRDK+QQF++ITGASEKAALQALKASDWHLEGAFDVFYS PQ K+ TD+RHLE
Sbjct: 1   MHKLTRGNRDKVQQFMTITGASEKAALQALKASDWHLEGAFDVFYSHPQIKTFTDSRHLE 60

Query: 61  ELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQ 120
           ELYNRYKDPY+DMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQ
Sbjct: 61  ELYNRYKDPYVDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQ 120

Query: 121 SLGIDSLDKFRERISFMRAELKDER 145
           +LGIDSL+KFRERI FMR+ELKDE+
Sbjct: 121 ALGIDSLEKFRERIPFMRSELKDEQ 145




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224098848|ref|XP_002311289.1| predicted protein [Populus trichocarpa] gi|222851109|gb|EEE88656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359494685|ref|XP_002263696.2| PREDICTED: DCN1-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736127|emb|CBI24165.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|343171976|gb|AEL98692.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|343171974|gb|AEL98691.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|356525740|ref|XP_003531481.1| PREDICTED: DCN1-like protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356557032|ref|XP_003546822.1| PREDICTED: uncharacterized protein LOC100527072 [Glycine max] Back     alignment and taxonomy information
>gi|388500426|gb|AFK38279.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449519908|ref|XP_004166976.1| PREDICTED: DCN1-like protein 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2087720250 AT3G12760 "AT3G12760" [Arabido 0.966 0.58 0.760 2.2e-57
UNIPROTKB|Q96GG9 259 DCUN1D1 "DCN1-like protein 1" 0.953 0.552 0.446 3.8e-30
UNIPROTKB|I3L7H0 259 DCUN1D1 "Uncharacterized prote 0.953 0.552 0.446 3.8e-30
ZFIN|ZDB-GENE-030131-5443 282 dcun1d1 "DCN1, defective in cu 0.96 0.510 0.446 7.9e-30
MGI|MGI:2142792 259 Dcun1d2 "DCN1, defective in cu 0.953 0.552 0.426 1e-29
UNIPROTKB|Q5ZKU1 259 DCUN1D1 "DCN1-like protein 1" 0.953 0.552 0.44 1.3e-29
UNIPROTKB|E2QV42 262 DCUN1D1 "Uncharacterized prote 0.946 0.541 0.442 1.3e-29
UNIPROTKB|F1NPG9 258 DCUN1D1 "DCN1-like protein 1" 0.946 0.550 0.436 4.4e-29
UNIPROTKB|F1MDM6 244 DCUN1D1 "Uncharacterized prote 0.833 0.512 0.439 4.6e-25
ZFIN|ZDB-GENE-040625-171 204 dcun1d2 "DCN1, defective in cu 0.62 0.455 0.468 6.5e-19
TAIR|locus:2087720 AT3G12760 "AT3G12760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 590 (212.7 bits), Expect = 2.2e-57, P = 2.2e-57
 Identities = 111/146 (76%), Positives = 129/146 (88%)

Query:     1 MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKS-LTDTRHL 59
             MHKLSRSNRDKLQQFV+ITGASEK ALQALKASDWHLE AFDVFYSQPQ +S   + R L
Sbjct:     1 MHKLSRSNRDKLQQFVAITGASEKNALQALKASDWHLEAAFDVFYSQPQPRSNAAEVRRL 60

Query:    60 EELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGL 119
             EELYNRYKDPY DMIL +GI++LCNDL+V+PQDIV LV+SWHM AAT CEFS+QEFI GL
Sbjct:    61 EELYNRYKDPYSDMILAEGISVLCNDLEVEPQDIVTLVLSWHMNAATACEFSRQEFISGL 120

Query:   120 QSLGIDSLDKFRERISFMRAELKDER 145
             Q+LG+DS+ K +E++ FMR+ELKDE+
Sbjct:   121 QALGVDSIGKLQEKLPFMRSELKDEQ 146




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q96GG9 DCUN1D1 "DCN1-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7H0 DCUN1D1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5443 dcun1d1 "DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2142792 Dcun1d2 "DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKU1 DCUN1D1 "DCN1-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV42 DCUN1D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPG9 DCUN1D1 "DCN1-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDM6 DCUN1D1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-171 dcun1d2 "DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG3077 260 consensus Uncharacterized conserved protein [Funct 100.0
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 99.49
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 98.1
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 98.04
KOG1364 356 consensus Predicted ubiquitin regulatory protein, 97.34
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 97.1
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 96.15
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 96.07
KOG2086 380 consensus Protein tyrosine phosphatase SHP1/Cofact 95.67
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 95.12
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 94.86
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 94.46
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 94.1
cd0005267 EH Eps15 homology domain; found in proteins implic 93.84
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 93.52
PTZ00183158 centrin; Provisional 93.42
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 93.37
PRK06369115 nac nascent polypeptide-associated complex protein 93.24
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 92.81
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 92.54
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 92.46
cd0503088 calgranulins Calgranulins: S-100 domain found in p 92.41
PTZ00184149 calmodulin; Provisional 92.21
PTZ00184149 calmodulin; Provisional 92.08
PTZ00183158 centrin; Provisional 91.93
KOG4351244 consensus Uncharacterized conserved protein [Funct 91.9
TIGR0144673 DnaD_dom DnaD and phage-associated domain. This mo 91.9
smart0054643 CUE Domain that may be involved in binding ubiquit 91.81
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 91.65
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 90.91
cd0021388 S-100 S-100: S-100 domain, which represents the la 89.89
KOG0036 463 consensus Predicted mitochondrial carrier protein 88.54
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 88.21
KOG2756 349 consensus Predicted Mg2+-dependent phosphodiestera 88.07
PRK12332198 tsf elongation factor Ts; Reviewed 87.78
CHL00098200 tsf elongation factor Ts 87.68
TIGR00116 290 tsf translation elongation factor Ts. This protein 87.33
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 86.45
PRK09377 290 tsf elongation factor Ts; Provisional 86.43
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 86.41
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 86.28
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 86.23
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 85.8
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 84.47
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 83.77
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 83.24
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 80.68
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 80.27
>KOG3077 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=2.3e-37  Score=250.52  Aligned_cols=149  Identities=46%  Similarity=0.848  Sum_probs=139.3

Q ss_pred             CCCCCcchHHHHHHHHHHhCCCHHHHHHHHHhCCCCchhh-hhhhhccCCC------CCcCCHHHHHHHHHHhcCCCC-C
Q 031969            1 MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGA-FDVFYSQPQS------KSLTDTRHLEELYNRYKDPYL-D   72 (150)
Q Consensus         1 m~~l~~~~~~~i~~F~~iT~~~~~~A~~~L~~~~w~le~A-i~~f~~~~~~------~~~~~~~~l~~lFd~Y~d~~~-d   72 (150)
                      |++|+..+++.+++|+.+|++++++++.+|.+++|++..| ...||.++..      .+.++.+.++++|.+|+||+. +
T Consensus         1 mnklk~~~~d~~~~~~~~~~~~~~~s~~~~~~~dw~~~~~~~~s~~~~~~~~~~~~~~~~~s~~~l~~~f~~y~d~~d~~   80 (260)
T KOG3077|consen    1 MNKLKSSQKDKFEQFMSFTASRKKTSLSCLAACDWNLKYAFNDSYYTNPQSLREESVQARVSEKRLEELFNQYKDPDDDN   80 (260)
T ss_pred             CCccchhHHHHHHhhcccccccchhhhhhhcccccccchhcccchhcchhHHHHhhhhccccHHHHHHHHHHhcCccccc
Confidence            8899999999999999999999999999999999999999 6666666543      235789999999999999976 6


Q ss_pred             ccchHHHHHHHhhcCCCCCcHHHHHHHHhhcccccccccHHHHHHHhHHcCCCCHHHHHHHHHHHHHHcCCCccccC
Q 031969           73 MILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDERTCTG  149 (150)
Q Consensus        73 ~I~~dG~~~~~edLgv~ped~~~LvLa~~l~a~~~g~~tr~eF~~g~~~l~~dsi~~lk~~l~~l~~~l~~~~~Fk~  149 (150)
                      .|++||+.+||+||||+|+++++|||||+|+|++||+|||++|+.||.+++|||+++|+.+|+.++..|+|.+.||+
T Consensus        81 ~i~~dgi~~fc~dlg~~p~~i~~LvlAwkl~A~~m~~Fsr~ef~~g~~~l~~dS~d~lq~~l~~l~~~l~d~~~Fk~  157 (260)
T KOG3077|consen   81 LIGPDGIEKFCEDLGVEPEDISVLVLAWKLGAATMCEFSREEFLKGMTALGCDSIDKLQQRLDFLRSVLKDLEKFKS  157 (260)
T ss_pred             ccChHHHHHHHHHhCCCchhHHHHHHHHHhccchhhhhhHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHccHHHhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998899985



>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG4351 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01446 DnaD_dom DnaD and phage-associated domain Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG2756 consensus Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms] Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information
>CHL00098 tsf elongation factor Ts Back     alignment and domain information
>TIGR00116 tsf translation elongation factor Ts Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3tdu_A 200 N-Terminal Acetylation Acts As An Avidity Enhancer 1e-20
4gao_A 200 Dcnl Complex With N-terminally Acetylated Nedd8 E2 1e-18
3kev_A199 X-Ray Crystal Structure Of A Dcun1 Domain-Containin 9e-18
4gba_A 221 Dcnl Complex With N-terminally Acetylated Nedd8 E2 2e-16
>pdb|3TDU|A Chain A, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 200 Back     alignment and structure

Iteration: 1

Score = 95.5 bits (236), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 1/88 (1%) Query: 57 RHLEELYNRYKDPY-LDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEF 115 + LE+LYNRYKDP + I +DGI C+DL +DP I +L+++W +AAT CEFSKQEF Sbjct: 4 KKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEF 63 Query: 116 IGGLQSLGIDSLDKFRERISFMRAELKD 143 + G+ LG DS++K + +I M ELK+ Sbjct: 64 MDGMTELGCDSIEKLKAQIPKMEQELKE 91
>pdb|4GAO|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 200 Back     alignment and structure
>pdb|3KEV|A Chain A, X-Ray Crystal Structure Of A Dcun1 Domain-Containing Protein From Galdieria Sulfuraria Length = 199 Back     alignment and structure
>pdb|4GBA|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 221 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3bq3_A 270 Defective in cullin neddylation protein 1; ubiquit 2e-37
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 1e-29
3tdu_A 200 DCN1-like protein 1; E2:E3, ligase-protein binding 2e-27
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 1e-06
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 3e-04
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Length = 199 Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A Length = 200 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Length = 46 Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3bq3_A 270 Defective in cullin neddylation protein 1; ubiquit 100.0
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 100.0
4gba_A 221 DCN1-like protein 3; E3 ligase, ligase-peptide com 100.0
3tdu_A 200 DCN1-like protein 1; E2:E3, ligase-protein binding 100.0
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 99.55
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 99.48
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 99.47
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 99.41
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 99.32
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 98.41
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 98.36
4gew_A 362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 98.26
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 97.87
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.65
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 97.14
2l2d_A73 OTU domain-containing protein 7A; UBA fold, struct 97.0
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 96.83
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 96.82
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 96.66
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.64
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 96.64
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 96.61
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 96.57
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 96.51
1avs_A90 Troponin C; muscle contraction, calcium-activated, 96.48
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 96.43
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 96.41
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 96.36
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 96.35
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 96.33
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 96.22
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 96.2
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 96.11
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 96.07
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 96.05
3fwb_A161 Cell division control protein 31; gene gating, com 96.04
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 96.03
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 96.0
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 96.0
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 95.95
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 95.91
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 95.86
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 95.8
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 95.78
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 95.76
1wji_A63 Tudor domain containing protein 3; UBA domain, str 95.75
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 95.73
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 95.71
2jnf_A158 Troponin C; stretch activated muscle contraction, 95.69
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 95.69
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 95.66
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.61
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 95.59
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 95.58
3li6_A66 Calcium-binding protein; calcium signaling protein 95.55
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.53
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.47
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 95.45
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 95.4
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.39
3fwb_A161 Cell division control protein 31; gene gating, com 95.36
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 95.36
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 95.32
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 95.29
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 95.29
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 95.28
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 95.22
1exr_A148 Calmodulin; high resolution, disorder, metal trans 95.22
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 95.19
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 95.18
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.17
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 95.16
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 95.16
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 95.15
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 95.15
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 95.14
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 95.02
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 95.02
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 95.01
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 94.99
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 94.98
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 94.98
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 94.91
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 94.9
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 94.86
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 94.76
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 94.75
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 94.74
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 94.7
2jnf_A158 Troponin C; stretch activated muscle contraction, 94.68
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 94.68
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 94.67
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 94.67
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 94.65
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 94.61
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 94.6
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 94.48
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 94.45
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 94.39
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 94.34
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 94.31
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 94.28
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 94.23
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 94.22
1y1x_A191 Leishmania major homolog of programmed cell death 94.17
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 94.16
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 94.13
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 94.12
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 94.11
1y1x_A191 Leishmania major homolog of programmed cell death 94.11
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 94.08
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 94.07
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 94.06
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 94.02
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 94.01
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 93.92
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 93.92
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 93.86
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 93.84
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 93.84
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 93.83
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 93.82
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 93.8
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 93.79
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 93.62
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 93.56
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 93.53
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 93.49
2cwb_A108 Chimera of immunoglobulin G binding protein G and 93.45
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 93.38
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 93.38
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 93.35
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 93.28
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 93.26
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 93.25
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 93.22
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 93.14
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 93.13
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 93.12
3akb_A166 Putative calcium binding protein; EF-hand, metal b 93.08
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 93.04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 93.03
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 93.01
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 92.99
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 92.98
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 92.91
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 92.9
1c07_A95 Protein (epidermal growth factor receptor pathway 92.88
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 92.85
1qjt_A99 EH1, epidermal growth factor receptor substrate su 92.84
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 92.81
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 92.79
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 92.77
3akb_A166 Putative calcium binding protein; EF-hand, metal b 92.69
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 92.68
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 92.67
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 92.6
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 92.59
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 92.59
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 92.53
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 92.52
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 92.48
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 92.44
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 92.43
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 92.41
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 92.4
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 92.34
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 92.22
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 92.19
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 92.17
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 92.05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 91.99
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 91.95
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 91.87
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 91.82
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 91.77
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 91.74
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 91.72
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 91.62
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 91.59
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 91.59
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 91.57
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 91.51
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 91.5
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 91.44
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 91.41
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 91.38
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 91.3
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 91.23
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 91.23
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 91.2
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 91.0
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 90.98
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 90.9
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 90.83
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 90.8
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 90.75
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 90.6
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 90.49
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 90.46
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 90.44
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 90.43
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 90.42
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 90.4
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 90.3
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 90.26
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 90.18
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 89.58
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 89.55
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 89.5
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 89.44
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 89.34
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 89.33
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 89.32
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 89.3
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 89.26
1aip_C196 EF-TS, elongation factor TS; nucleotide exchange, 89.25
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 89.23
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 89.09
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 89.07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 89.07
2zc2_A78 DNAD-like replication protein; GI 24377835, struct 88.94
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 88.91
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 88.75
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 88.7
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 88.67
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 88.55
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 88.42
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 88.26
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 88.13
2dna_A67 Unnamed protein product; ubiquitin associated doma 88.12
2jq6_A139 EH domain-containing protein 1; metal binding prot 88.11
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 88.1
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 87.81
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 87.75
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 87.69
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 87.65
1xb2_B 291 EF-TS, elongation factor TS, mitochondrial, EF-TSM 87.64
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 87.57
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 87.36
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 87.36
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 87.24
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 87.22
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 87.18
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 87.18
2hps_A186 Coelenterazine-binding protein with bound coelent; 86.86
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 86.85
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 86.74
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 86.58
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 85.88
1aua_A 296 Phosphatidylinositol transfer protein SEC14P; phos 85.66
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 85.57
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 85.41
3q8g_A 320 CRAL-TRIO domain-containing protein YKL091C; strin 85.13
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 84.55
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 84.49
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 84.38
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 84.24
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 83.96
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 83.87
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 83.78
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 83.77
1r5l_A 262 Alpha-TTP, protein (alpha-tocopherol transfer prot 83.62
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 83.09
3a4u_B143 Multiple coagulation factor deficiency protein 2; 82.66
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 82.06
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 81.93
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 81.84
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 81.56
2dhy_A67 CUE domain-containing protein 1; structural genomi 81.46
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 81.1
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 80.85
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 80.64
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 80.19
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 80.17
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 80.04
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2zc2_A DNAD-like replication protein; GI 24377835, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Streptococcus mutans UA159} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1aua_A Phosphatidylinositol transfer protein SEC14P; phospholipid-binding protein, peripheral golgi membrane protein, phospholipid exchange; HET: BOG; 2.50A {Saccharomyces cerevisiae} SCOP: a.5.3.1 c.13.1.1 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3q8g_A CRAL-TRIO domain-containing protein YKL091C; string motif, signaling protein, directed evoluti SEC14, phospholipid transporter, lipid; HET: PEE; 1.80A {Saccharomyces cerevisiae} PDB: 3b7n_A* 3b74_A* 3b7q_A* 3b7z_A* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1r5l_A Alpha-TTP, protein (alpha-tocopherol transfer protein); ataxia with vitamin E deficiency, transport protein; HET: MSE VIV; 1.50A {Homo sapiens} SCOP: a.5.3.1 c.13.1.1 PDB: 1oiz_A* 1oip_A* Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1v92a_46 a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- 9e-10
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: TAP-C domain-like
domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 49.3 bits (118), Expect = 9e-10
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 4  LSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFY 45
          ++   +D L++FV++TGA E  A   L+++ W L+ A   FY
Sbjct: 1  MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFY 42


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 99.62
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 98.42
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 97.74
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.94
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 96.92
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.81
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.61
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 96.5
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 96.48
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.46
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 96.37
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 96.36
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 96.29
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.27
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.25
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 96.14
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 96.03
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.99
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 95.66
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.57
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 95.51
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.42
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 95.24
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.0
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 94.86
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 94.72
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 94.69
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 94.63
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.63
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 94.63
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 94.57
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.44
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 94.34
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.3
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 94.08
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 93.95
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 93.87
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 93.72
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 93.67
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 93.57
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 93.37
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 93.23
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 93.16
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 92.98
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 92.96
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 92.88
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 92.82
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 92.71
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 92.65
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 92.6
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 92.49
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 92.41
d1olma175 Supernatant protein factor (SPF), N-terminal domai 92.26
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 92.18
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.94
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 91.71
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 91.62
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 91.44
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 91.37
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 91.35
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 91.27
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 91.15
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 90.93
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 90.91
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 90.8
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 90.7
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 90.52
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 90.51
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 90.23
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 90.04
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 89.92
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 89.41
d1auaa193 N-terminal domain of phosphatidylinositol transfer 89.36
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 89.25
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 88.95
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 88.86
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 88.71
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 87.86
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 87.42
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 87.28
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 86.98
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 86.72
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 86.6
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 85.94
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 85.61
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 85.44
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 84.91
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 84.35
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 84.24
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 84.03
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 83.18
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 82.53
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 81.64
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 81.39
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 80.66
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 80.54
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 80.14
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 80.07
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: TAP-C domain-like
domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.62  E-value=2.1e-16  Score=95.39  Aligned_cols=45  Identities=33%  Similarity=0.620  Sum_probs=42.1

Q ss_pred             CCcchHHHHHHHHHHhCCCHHHHHHHHHhCCCCchhhhhhhhccC
Q 031969            4 LSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQP   48 (150)
Q Consensus         4 l~~~~~~~i~~F~~iT~~~~~~A~~~L~~~~w~le~Ai~~f~~~~   48 (150)
                      ++++++++|.||++|||+++.+|++||+.++|||+.||+.||++.
T Consensus         1 ma~~~~~lI~qF~~iTg~~~~~A~~~Le~~~w~Le~Ai~~yfe~g   45 (46)
T d1v92a_           1 MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDG   45 (46)
T ss_dssp             CTTHHHHHHHHHHHHTCCCHHHHHHHHHHTTSCSHHHHHHHHHTC
T ss_pred             CCccHHHHHHHHHHHHCcCHHHHHHHHHHcCCcHHHHHHHHHhcC
Confidence            467889999999999999999999999999999999999999863



>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1olma1 a.5.3.1 (A:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1auaa1 a.5.3.1 (A:4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure