Citrus Sinensis ID: 031969
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 150 | ||||||
| 255555594 | 261 | Defective in cullin neddylation protein, | 0.966 | 0.555 | 0.889 | 5e-73 | |
| 224098848 | 259 | predicted protein [Populus trichocarpa] | 0.966 | 0.559 | 0.841 | 9e-71 | |
| 359494685 | 259 | PREDICTED: DCN1-like protein 2-like [Vit | 0.966 | 0.559 | 0.834 | 1e-68 | |
| 297736127 | 309 | unnamed protein product [Vitis vinifera] | 0.966 | 0.469 | 0.834 | 1e-68 | |
| 343171976 | 249 | hypothetical protein, partial [Silene la | 0.966 | 0.582 | 0.848 | 1e-68 | |
| 343171974 | 249 | hypothetical protein, partial [Silene la | 0.966 | 0.582 | 0.848 | 3e-68 | |
| 356525740 | 259 | PREDICTED: DCN1-like protein 2-like [Gly | 0.966 | 0.559 | 0.827 | 2e-67 | |
| 356557032 | 259 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.559 | 0.820 | 2e-67 | |
| 388500426 | 259 | unknown [Lotus japonicus] | 0.96 | 0.555 | 0.826 | 1e-66 | |
| 449519908 | 259 | PREDICTED: DCN1-like protein 2-like [Cuc | 0.966 | 0.559 | 0.813 | 2e-66 |
| >gi|255555594|ref|XP_002518833.1| Defective in cullin neddylation protein, putative [Ricinus communis] gi|223542006|gb|EEF43551.1| Defective in cullin neddylation protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 278 bits (711), Expect = 5e-73, Method: Compositional matrix adjust.
Identities = 129/145 (88%), Positives = 140/145 (96%)
Query: 1 MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLE 60
MHKL+R NRDK+QQF++ITGASEKAALQALKASDWHLEGAFDVFYS PQ K+ TD+RHLE
Sbjct: 1 MHKLTRGNRDKVQQFMTITGASEKAALQALKASDWHLEGAFDVFYSHPQIKTFTDSRHLE 60
Query: 61 ELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQ 120
ELYNRYKDPY+DMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQ
Sbjct: 61 ELYNRYKDPYVDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQ 120
Query: 121 SLGIDSLDKFRERISFMRAELKDER 145
+LGIDSL+KFRERI FMR+ELKDE+
Sbjct: 121 ALGIDSLEKFRERIPFMRSELKDEQ 145
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224098848|ref|XP_002311289.1| predicted protein [Populus trichocarpa] gi|222851109|gb|EEE88656.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359494685|ref|XP_002263696.2| PREDICTED: DCN1-like protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297736127|emb|CBI24165.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|343171976|gb|AEL98692.1| hypothetical protein, partial [Silene latifolia] | Back alignment and taxonomy information |
|---|
| >gi|343171974|gb|AEL98691.1| hypothetical protein, partial [Silene latifolia] | Back alignment and taxonomy information |
|---|
| >gi|356525740|ref|XP_003531481.1| PREDICTED: DCN1-like protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356557032|ref|XP_003546822.1| PREDICTED: uncharacterized protein LOC100527072 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388500426|gb|AFK38279.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449519908|ref|XP_004166976.1| PREDICTED: DCN1-like protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 150 | ||||||
| TAIR|locus:2087720 | 250 | AT3G12760 "AT3G12760" [Arabido | 0.966 | 0.58 | 0.760 | 2.2e-57 | |
| UNIPROTKB|Q96GG9 | 259 | DCUN1D1 "DCN1-like protein 1" | 0.953 | 0.552 | 0.446 | 3.8e-30 | |
| UNIPROTKB|I3L7H0 | 259 | DCUN1D1 "Uncharacterized prote | 0.953 | 0.552 | 0.446 | 3.8e-30 | |
| ZFIN|ZDB-GENE-030131-5443 | 282 | dcun1d1 "DCN1, defective in cu | 0.96 | 0.510 | 0.446 | 7.9e-30 | |
| MGI|MGI:2142792 | 259 | Dcun1d2 "DCN1, defective in cu | 0.953 | 0.552 | 0.426 | 1e-29 | |
| UNIPROTKB|Q5ZKU1 | 259 | DCUN1D1 "DCN1-like protein 1" | 0.953 | 0.552 | 0.44 | 1.3e-29 | |
| UNIPROTKB|E2QV42 | 262 | DCUN1D1 "Uncharacterized prote | 0.946 | 0.541 | 0.442 | 1.3e-29 | |
| UNIPROTKB|F1NPG9 | 258 | DCUN1D1 "DCN1-like protein 1" | 0.946 | 0.550 | 0.436 | 4.4e-29 | |
| UNIPROTKB|F1MDM6 | 244 | DCUN1D1 "Uncharacterized prote | 0.833 | 0.512 | 0.439 | 4.6e-25 | |
| ZFIN|ZDB-GENE-040625-171 | 204 | dcun1d2 "DCN1, defective in cu | 0.62 | 0.455 | 0.468 | 6.5e-19 |
| TAIR|locus:2087720 AT3G12760 "AT3G12760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 590 (212.7 bits), Expect = 2.2e-57, P = 2.2e-57
Identities = 111/146 (76%), Positives = 129/146 (88%)
Query: 1 MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKS-LTDTRHL 59
MHKLSRSNRDKLQQFV+ITGASEK ALQALKASDWHLE AFDVFYSQPQ +S + R L
Sbjct: 1 MHKLSRSNRDKLQQFVAITGASEKNALQALKASDWHLEAAFDVFYSQPQPRSNAAEVRRL 60
Query: 60 EELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGL 119
EELYNRYKDPY DMIL +GI++LCNDL+V+PQDIV LV+SWHM AAT CEFS+QEFI GL
Sbjct: 61 EELYNRYKDPYSDMILAEGISVLCNDLEVEPQDIVTLVLSWHMNAATACEFSRQEFISGL 120
Query: 120 QSLGIDSLDKFRERISFMRAELKDER 145
Q+LG+DS+ K +E++ FMR+ELKDE+
Sbjct: 121 QALGVDSIGKLQEKLPFMRSELKDEQ 146
|
|
| UNIPROTKB|Q96GG9 DCUN1D1 "DCN1-like protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L7H0 DCUN1D1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5443 dcun1d1 "DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2142792 Dcun1d2 "DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZKU1 DCUN1D1 "DCN1-like protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QV42 DCUN1D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPG9 DCUN1D1 "DCN1-like protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MDM6 DCUN1D1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-171 dcun1d2 "DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| KOG3077 | 260 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 99.49 | |
| smart00804 | 63 | TAP_C C-terminal domain of vertebrate Tap protein. | 98.1 | |
| PF03943 | 51 | TAP_C: TAP C-terminal domain; InterPro: IPR005637 | 98.04 | |
| KOG1364 | 356 | consensus Predicted ubiquitin regulatory protein, | 97.34 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 97.1 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 96.15 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 96.07 | |
| KOG2086 | 380 | consensus Protein tyrosine phosphatase SHP1/Cofact | 95.67 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 95.12 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 94.86 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 94.46 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 94.1 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 93.84 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 93.52 | |
| PTZ00183 | 158 | centrin; Provisional | 93.42 | |
| TIGR00264 | 116 | alpha-NAC-related protein. This hypothetical prote | 93.37 | |
| PRK06369 | 115 | nac nascent polypeptide-associated complex protein | 93.24 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 92.81 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 92.54 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 92.46 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 92.41 | |
| PTZ00184 | 149 | calmodulin; Provisional | 92.21 | |
| PTZ00184 | 149 | calmodulin; Provisional | 92.08 | |
| PTZ00183 | 158 | centrin; Provisional | 91.93 | |
| KOG4351 | 244 | consensus Uncharacterized conserved protein [Funct | 91.9 | |
| TIGR01446 | 73 | DnaD_dom DnaD and phage-associated domain. This mo | 91.9 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 91.81 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 91.65 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 90.91 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 89.89 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 88.54 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 88.21 | |
| KOG2756 | 349 | consensus Predicted Mg2+-dependent phosphodiestera | 88.07 | |
| PRK12332 | 198 | tsf elongation factor Ts; Reviewed | 87.78 | |
| CHL00098 | 200 | tsf elongation factor Ts | 87.68 | |
| TIGR00116 | 290 | tsf translation elongation factor Ts. This protein | 87.33 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 86.45 | |
| PRK09377 | 290 | tsf elongation factor Ts; Provisional | 86.43 | |
| COG1308 | 122 | EGD2 Transcription factor homologous to NACalpha-B | 86.41 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 86.28 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 86.23 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 85.8 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 84.47 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 83.77 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 83.24 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 80.68 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 80.27 |
| >KOG3077 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-37 Score=250.52 Aligned_cols=149 Identities=46% Similarity=0.848 Sum_probs=139.3
Q ss_pred CCCCCcchHHHHHHHHHHhCCCHHHHHHHHHhCCCCchhh-hhhhhccCCC------CCcCCHHHHHHHHHHhcCCCC-C
Q 031969 1 MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGA-FDVFYSQPQS------KSLTDTRHLEELYNRYKDPYL-D 72 (150)
Q Consensus 1 m~~l~~~~~~~i~~F~~iT~~~~~~A~~~L~~~~w~le~A-i~~f~~~~~~------~~~~~~~~l~~lFd~Y~d~~~-d 72 (150)
|++|+..+++.+++|+.+|++++++++.+|.+++|++..| ...||.++.. .+.++.+.++++|.+|+||+. +
T Consensus 1 mnklk~~~~d~~~~~~~~~~~~~~~s~~~~~~~dw~~~~~~~~s~~~~~~~~~~~~~~~~~s~~~l~~~f~~y~d~~d~~ 80 (260)
T KOG3077|consen 1 MNKLKSSQKDKFEQFMSFTASRKKTSLSCLAACDWNLKYAFNDSYYTNPQSLREESVQARVSEKRLEELFNQYKDPDDDN 80 (260)
T ss_pred CCccchhHHHHHHhhcccccccchhhhhhhcccccccchhcccchhcchhHHHHhhhhccccHHHHHHHHHHhcCccccc
Confidence 8899999999999999999999999999999999999999 6666666543 235789999999999999976 6
Q ss_pred ccchHHHHHHHhhcCCCCCcHHHHHHHHhhcccccccccHHHHHHHhHHcCCCCHHHHHHHHHHHHHHcCCCccccC
Q 031969 73 MILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDERTCTG 149 (150)
Q Consensus 73 ~I~~dG~~~~~edLgv~ped~~~LvLa~~l~a~~~g~~tr~eF~~g~~~l~~dsi~~lk~~l~~l~~~l~~~~~Fk~ 149 (150)
.|++||+.+||+||||+|+++++|||||+|+|++||+|||++|+.||.+++|||+++|+.+|+.++..|+|.+.||+
T Consensus 81 ~i~~dgi~~fc~dlg~~p~~i~~LvlAwkl~A~~m~~Fsr~ef~~g~~~l~~dS~d~lq~~l~~l~~~l~d~~~Fk~ 157 (260)
T KOG3077|consen 81 LIGPDGIEKFCEDLGVEPEDISVLVLAWKLGAATMCEFSREEFLKGMTALGCDSIDKLQQRLDFLRSVLKDLEKFKS 157 (260)
T ss_pred ccChHHHHHHHHHhCCCchhHHHHHHHHHhccchhhhhhHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHccHHHhhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999998899985
|
|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >smart00804 TAP_C C-terminal domain of vertebrate Tap protein | Back alignment and domain information |
|---|
| >PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) | Back alignment and domain information |
|---|
| >KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >TIGR00264 alpha-NAC-related protein | Back alignment and domain information |
|---|
| >PRK06369 nac nascent polypeptide-associated complex protein; Reviewed | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG4351 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01446 DnaD_dom DnaD and phage-associated domain | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >KOG2756 consensus Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12332 tsf elongation factor Ts; Reviewed | Back alignment and domain information |
|---|
| >CHL00098 tsf elongation factor Ts | Back alignment and domain information |
|---|
| >TIGR00116 tsf translation elongation factor Ts | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09377 tsf elongation factor Ts; Provisional | Back alignment and domain information |
|---|
| >COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 150 | ||||
| 3tdu_A | 200 | N-Terminal Acetylation Acts As An Avidity Enhancer | 1e-20 | ||
| 4gao_A | 200 | Dcnl Complex With N-terminally Acetylated Nedd8 E2 | 1e-18 | ||
| 3kev_A | 199 | X-Ray Crystal Structure Of A Dcun1 Domain-Containin | 9e-18 | ||
| 4gba_A | 221 | Dcnl Complex With N-terminally Acetylated Nedd8 E2 | 2e-16 |
| >pdb|3TDU|A Chain A, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 200 | Back alignment and structure |
|
| >pdb|4GAO|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 200 | Back alignment and structure |
| >pdb|3KEV|A Chain A, X-Ray Crystal Structure Of A Dcun1 Domain-Containing Protein From Galdieria Sulfuraria Length = 199 | Back alignment and structure |
| >pdb|4GBA|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 221 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 150 | |||
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 2e-37 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 1e-29 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 2e-27 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 1e-06 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 3e-04 |
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Length = 199 | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A Length = 200 | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Length = 46 | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 100.0 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 100.0 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 100.0 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 100.0 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 99.55 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 99.48 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 99.47 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 99.41 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 99.32 | |
| 2jp7_A | 57 | MRNA export factor MEX67; solution MEX67, UBA, tra | 98.41 | |
| 1oai_A | 59 | Nuclear RNA export factor; nuclear transport, nucl | 98.36 | |
| 4gew_A | 362 | 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy | 98.26 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 97.87 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 97.65 | |
| 1jkg_B | 250 | TAP; NTF2-like domain, transport protein; 1.90A {H | 97.14 | |
| 2l2d_A | 73 | OTU domain-containing protein 7A; UBA fold, struct | 97.0 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 96.83 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 96.82 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 96.66 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 96.64 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 96.64 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 96.61 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 96.57 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 96.51 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 96.48 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 96.43 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 96.41 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 96.36 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 96.35 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 96.33 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 96.22 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 96.2 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 96.11 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 96.07 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 96.05 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 96.04 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 96.03 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 96.0 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 96.0 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 95.95 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 95.91 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 95.86 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 95.8 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 95.78 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 95.76 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 95.75 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 95.73 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 95.71 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 95.69 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 95.69 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 95.66 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 95.61 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 95.59 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 95.58 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 95.55 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 95.53 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 95.47 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 95.45 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 95.4 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 95.39 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 95.36 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 95.36 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 95.32 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 95.29 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 95.29 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 95.28 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 95.22 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 95.22 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 95.19 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 95.18 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 95.17 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 95.16 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 95.16 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 95.15 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 95.15 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 95.14 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 95.02 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 95.02 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 95.01 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 94.99 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 94.98 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 94.98 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 94.91 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 94.9 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 94.86 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 94.76 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 94.75 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 94.74 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 94.7 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 94.68 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 94.68 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 94.67 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 94.67 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 94.65 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 94.61 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 94.6 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 94.48 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 94.45 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 94.39 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 94.34 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 94.31 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 94.28 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 94.23 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 94.22 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 94.17 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 94.16 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 94.13 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 94.12 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 94.11 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 94.11 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 94.08 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 94.07 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 94.06 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 94.02 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 94.01 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 93.92 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 93.92 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 93.86 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 93.84 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 93.84 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 93.83 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 93.82 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 93.8 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 93.79 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 93.62 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 93.56 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 93.53 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 93.49 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 93.45 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 93.38 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 93.38 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 93.35 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 93.28 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 93.26 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 93.25 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 93.22 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 93.14 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 93.13 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 93.12 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 93.08 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 93.04 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 93.03 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 93.01 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 92.99 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 92.98 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 92.91 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 92.9 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 92.88 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 92.85 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 92.84 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 92.81 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 92.79 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 92.77 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 92.69 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 92.68 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 92.67 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 92.6 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 92.59 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 92.59 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 92.53 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 92.52 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 92.48 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 92.44 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 92.43 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 92.41 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 92.4 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 92.34 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 92.22 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 92.19 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 92.17 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 92.05 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 91.99 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 91.95 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 91.87 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 91.82 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 91.77 | |
| 1tr8_A | 102 | Conserved protein (MTH177); chaperones, nascent po | 91.74 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 91.72 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 91.62 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 91.59 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 91.59 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 91.57 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 91.51 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 91.5 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 91.44 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 91.41 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 91.38 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 91.3 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 91.23 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 91.23 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 91.2 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 91.0 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 90.98 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 90.9 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 90.83 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 90.8 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 90.75 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 90.6 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 90.49 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 90.46 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 90.44 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 90.43 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 90.42 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 90.4 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 90.3 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 90.26 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 90.18 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 89.58 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 89.55 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 89.5 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 89.44 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 89.34 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 89.33 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 89.32 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 89.3 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 89.26 | |
| 1aip_C | 196 | EF-TS, elongation factor TS; nucleotide exchange, | 89.25 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 89.23 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 89.09 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 89.07 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 89.07 | |
| 2zc2_A | 78 | DNAD-like replication protein; GI 24377835, struct | 88.94 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 88.91 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 88.75 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 88.7 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 88.67 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 88.55 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 88.42 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 88.26 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 88.13 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 88.12 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 88.11 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 88.1 | |
| 1vdl_A | 80 | Ubiquitin carboxyl-terminal hydrolase 25; UBA doma | 87.81 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 87.75 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 87.69 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 87.65 | |
| 1xb2_B | 291 | EF-TS, elongation factor TS, mitochondrial, EF-TSM | 87.64 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 87.57 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 87.36 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 87.36 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 87.24 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 87.22 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 87.18 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 87.18 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 86.86 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 86.85 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 86.74 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 86.58 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 85.88 | |
| 1aua_A | 296 | Phosphatidylinositol transfer protein SEC14P; phos | 85.66 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 85.57 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 85.41 | |
| 3q8g_A | 320 | CRAL-TRIO domain-containing protein YKL091C; strin | 85.13 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 84.55 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 84.49 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 84.38 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 84.24 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 83.96 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 83.87 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 83.78 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 83.77 | |
| 1r5l_A | 262 | Alpha-TTP, protein (alpha-tocopherol transfer prot | 83.62 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 83.09 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 82.66 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 82.06 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 81.93 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 81.84 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 81.56 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 81.46 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 81.1 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 80.85 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 80.64 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 80.19 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 80.17 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 80.04 |
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A | Back alignment and structure |
|---|
| >1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A | Back alignment and structure |
|---|
| >2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2zc2_A DNAD-like replication protein; GI 24377835, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Streptococcus mutans UA159} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1aua_A Phosphatidylinositol transfer protein SEC14P; phospholipid-binding protein, peripheral golgi membrane protein, phospholipid exchange; HET: BOG; 2.50A {Saccharomyces cerevisiae} SCOP: a.5.3.1 c.13.1.1 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3q8g_A CRAL-TRIO domain-containing protein YKL091C; string motif, signaling protein, directed evoluti SEC14, phospholipid transporter, lipid; HET: PEE; 1.80A {Saccharomyces cerevisiae} PDB: 3b7n_A* 3b74_A* 3b7q_A* 3b7z_A* | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1r5l_A Alpha-TTP, protein (alpha-tocopherol transfer protein); ataxia with vitamin E deficiency, transport protein; HET: MSE VIV; 1.50A {Homo sapiens} SCOP: a.5.3.1 c.13.1.1 PDB: 1oiz_A* 1oip_A* | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 150 | ||||
| d1v92a_ | 46 | a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- | 9e-10 |
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RuvA C-terminal domain-like superfamily: UBA-like family: TAP-C domain-like domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 49.3 bits (118), Expect = 9e-10
Identities = 15/42 (35%), Positives = 26/42 (61%)
Query: 4 LSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFY 45
++ +D L++FV++TGA E A L+++ W L+ A FY
Sbjct: 1 MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFY 42
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 99.62 | |
| d1oaia_ | 59 | FG-binding, C-terminal domain of TAP {Human (Homo | 98.42 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 97.74 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 96.94 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 96.92 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 96.81 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.61 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 96.5 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 96.48 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 96.46 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 96.37 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 96.36 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 96.29 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 96.27 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 96.25 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 96.14 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 96.03 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 95.99 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 95.66 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.57 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 95.51 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 95.42 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 95.24 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 95.0 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 94.86 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 94.72 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 94.69 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 94.63 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 94.63 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 94.63 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 94.57 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 94.44 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 94.34 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 94.3 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 94.08 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 93.95 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 93.87 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 93.72 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 93.67 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 93.57 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 93.37 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 93.23 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 93.16 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 92.98 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 92.98 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 92.96 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 92.88 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 92.82 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 92.71 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 92.65 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 92.6 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 92.49 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 92.41 | |
| d1olma1 | 75 | Supernatant protein factor (SPF), N-terminal domai | 92.26 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 92.18 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 91.94 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 91.71 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 91.62 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 91.44 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 91.37 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 91.35 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 91.27 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 91.15 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 90.93 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 90.91 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 90.8 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 90.7 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 90.52 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 90.51 | |
| d1vdla_ | 80 | Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M | 90.23 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 90.04 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 89.92 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 89.41 | |
| d1auaa1 | 93 | N-terminal domain of phosphatidylinositol transfer | 89.36 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 89.25 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 88.95 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 88.86 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 88.71 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 87.86 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 87.42 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 87.28 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 86.98 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 86.72 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 86.6 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 85.94 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 85.61 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 85.44 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 84.91 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 84.35 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 84.24 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 84.03 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 83.18 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 82.53 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 81.64 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 81.39 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 80.66 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 80.54 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 80.14 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 80.07 |
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RuvA C-terminal domain-like superfamily: UBA-like family: TAP-C domain-like domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.62 E-value=2.1e-16 Score=95.39 Aligned_cols=45 Identities=33% Similarity=0.620 Sum_probs=42.1
Q ss_pred CCcchHHHHHHHHHHhCCCHHHHHHHHHhCCCCchhhhhhhhccC
Q 031969 4 LSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQP 48 (150)
Q Consensus 4 l~~~~~~~i~~F~~iT~~~~~~A~~~L~~~~w~le~Ai~~f~~~~ 48 (150)
++++++++|.||++|||+++.+|++||+.++|||+.||+.||++.
T Consensus 1 ma~~~~~lI~qF~~iTg~~~~~A~~~Le~~~w~Le~Ai~~yfe~g 45 (46)
T d1v92a_ 1 MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDG 45 (46)
T ss_dssp CTTHHHHHHHHHHHHTCCCHHHHHHHHHHTTSCSHHHHHHHHHTC
T ss_pred CCccHHHHHHHHHHHHCcCHHHHHHHHHHcCCcHHHHHHHHHhcC
Confidence 467889999999999999999999999999999999999999863
|
| >d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1olma1 a.5.3.1 (A:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1auaa1 a.5.3.1 (A:4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|