Citrus Sinensis ID: 032013
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 255563310 | 189 | Magnesium-dependent phosphatase, putativ | 0.617 | 0.486 | 0.752 | 7e-34 | |
| 225465793 | 165 | PREDICTED: magnesium-dependent phosphata | 0.590 | 0.533 | 0.761 | 3e-31 | |
| 4587681 | 151 | hypothetical protein [Arabidopsis thalia | 0.617 | 0.609 | 0.695 | 7e-31 | |
| 79555268 | 190 | haloacid dehalogenase-like hydrolase dom | 0.597 | 0.468 | 0.707 | 2e-30 | |
| 388504702 | 176 | unknown [Lotus japonicus] | 0.624 | 0.528 | 0.688 | 3e-30 | |
| 115455203 | 173 | Os03g0737400 [Oryza sativa Japonica Grou | 0.617 | 0.531 | 0.709 | 3e-30 | |
| 224035303 | 129 | unknown [Zea mays] gi|413933131|gb|AFW67 | 0.771 | 0.891 | 0.598 | 3e-30 | |
| 222625757 | 327 | hypothetical protein OsJ_12493 [Oryza sa | 0.617 | 0.281 | 0.709 | 4e-30 | |
| 388515721 | 176 | unknown [Lotus japonicus] | 0.624 | 0.528 | 0.688 | 4e-30 | |
| 449438224 | 188 | PREDICTED: magnesium-dependent phosphata | 0.597 | 0.473 | 0.707 | 6e-30 |
| >gi|255563310|ref|XP_002522658.1| Magnesium-dependent phosphatase, putative [Ricinus communis] gi|223538134|gb|EEF39745.1| Magnesium-dependent phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 148 bits (373), Expect = 7e-34, Method: Compositional matrix adjust.
Identities = 70/93 (75%), Positives = 79/93 (84%), Gaps = 1/93 (1%)
Query: 1 MGDLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEAL 60
MGD EK+K+EAL+IIG F+ LPRLVVFDLDYTLWPFYCEC + E+P LYPHAKGIL AL
Sbjct: 1 MGD-EKIKDEALQIIGMFQMLPRLVVFDLDYTLWPFYCECRSKREMPSLYPHAKGILYAL 59
Query: 61 KEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFV 93
K+KGI VA+ASRSP PDIA TFL KL + SMFV
Sbjct: 60 KDKGIDVAIASRSPTPDIANTFLDKLSLKSMFV 92
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225465793|ref|XP_002269091.1| PREDICTED: magnesium-dependent phosphatase 1 [Vitis vinifera] gi|296087423|emb|CBI34012.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|4587681|gb|AAD25851.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|79555268|ref|NP_179027.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|48310074|gb|AAT41748.1| At2g14110 [Arabidopsis thaliana] gi|50198845|gb|AAT70452.1| At2g14110 [Arabidopsis thaliana] gi|330251187|gb|AEC06281.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388504702|gb|AFK40417.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|115455203|ref|NP_001051202.1| Os03g0737400 [Oryza sativa Japonica Group] gi|29788863|gb|AAP03409.1| unknown protein [Oryza sativa Japonica Group] gi|37999990|gb|AAR07077.1| unknown protein [Oryza sativa Japonica Group] gi|108710967|gb|ABF98762.1| magnesium-dependent phosphatase-1 family protein, expressed [Oryza sativa Japonica Group] gi|113549673|dbj|BAF13116.1| Os03g0737400 [Oryza sativa Japonica Group] gi|215686587|dbj|BAG88840.1| unnamed protein product [Oryza sativa Japonica Group] gi|218193717|gb|EEC76144.1| hypothetical protein OsI_13434 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|224035303|gb|ACN36727.1| unknown [Zea mays] gi|413933131|gb|AFW67682.1| hypothetical protein ZEAMMB73_293867 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|222625757|gb|EEE59889.1| hypothetical protein OsJ_12493 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|388515721|gb|AFK45922.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449438224|ref|XP_004136889.1| PREDICTED: magnesium-dependent phosphatase 1-like [Cucumis sativus] gi|449478847|ref|XP_004155433.1| PREDICTED: magnesium-dependent phosphatase 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| TAIR|locus:2059440 | 190 | AT2G14110 "AT2G14110" [Arabido | 0.597 | 0.468 | 0.707 | 6.2e-30 | |
| ASPGD|ASPL0000029748 | 215 | AN5512 [Emericella nidulans (t | 0.456 | 0.316 | 0.392 | 3.6e-09 | |
| UNIPROTKB|F1SGN7 | 164 | LOC100520440 "Uncharacterized | 0.503 | 0.457 | 0.344 | 4.3e-06 | |
| CGD|CAL0000216 | 175 | orf19.6929 [Candida albicans ( | 0.442 | 0.377 | 0.337 | 9.4e-06 | |
| UNIPROTKB|Q59SU0 | 175 | CaO19.14191 "Putative uncharac | 0.442 | 0.377 | 0.337 | 9.4e-06 | |
| UNIPROTKB|F1MXF2 | 164 | MDP-1 "Uncharacterized protein | 0.489 | 0.445 | 0.329 | 1.5e-05 | |
| POMBASE|SPBP8B7.31 | 172 | SPBP8B7.31 "acid phosphatase ( | 0.120 | 0.104 | 0.666 | 2.9e-05 | |
| RGD|1311147 | 164 | Mdp1 "magnesium-dependent phos | 0.476 | 0.432 | 0.344 | 3e-05 | |
| MGI|MGI:1915131 | 164 | Mdp1 "magnesium-dependent phos | 0.489 | 0.445 | 0.318 | 6.6e-05 | |
| SGD|S000000936 | 178 | YER134C "Magnesium-dependent a | 0.120 | 0.101 | 0.611 | 7e-05 |
| TAIR|locus:2059440 AT2G14110 "AT2G14110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 331 (121.6 bits), Expect = 6.2e-30, P = 6.2e-30
Identities = 63/89 (70%), Positives = 73/89 (82%)
Query: 5 EKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKG 64
EKVK+EA++I+G F+ LPRLVVFDLDYTLWPFYCEC + E+P +YP AKGIL ALKEKG
Sbjct: 4 EKVKDEAMQIMGMFQILPRLVVFDLDYTLWPFYCECRSKREMPSMYPQAKGILSALKEKG 63
Query: 65 IHVAVASRSPAPDIAKTFLHKLGIHSMFV 93
I +A+ASRSP DIA TFL KL I MFV
Sbjct: 64 IEMAIASRSPTSDIANTFLDKLNIKPMFV 92
|
|
| ASPGD|ASPL0000029748 AN5512 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SGN7 LOC100520440 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000216 orf19.6929 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59SU0 CaO19.14191 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MXF2 MDP-1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP8B7.31 SPBP8B7.31 "acid phosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| RGD|1311147 Mdp1 "magnesium-dependent phosphatase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915131 Mdp1 "magnesium-dependent phosphatase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000936 YER134C "Magnesium-dependent acid phosphatase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| pfam12689 | 164 | pfam12689, Acid_PPase, Acid Phosphatase | 4e-27 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 5e-09 | |
| TIGR01685 | 174 | TIGR01685, MDP-1, magnesium-dependent phosphatase- | 2e-07 | |
| TIGR01681 | 128 | TIGR01681, HAD-SF-IIIC, HAD-superfamily phosphatas | 5e-07 | |
| COG0561 | 264 | COG0561, Cof, Predicted hydrolases of the HAD supe | 1e-04 | |
| TIGR00099 | 256 | TIGR00099, Cof-subfamily, Cof subfamily of IIB sub | 0.002 | |
| TIGR01662 | 132 | TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, | 0.002 | |
| COG0560 | 212 | COG0560, SerB, Phosphoserine phosphatase [Amino ac | 0.002 | |
| COG0637 | 221 | COG0637, COG0637, Predicted phosphatase/phosphohex | 0.003 | |
| pfam13344 | 101 | pfam13344, Hydrolase_6, Haloacid dehalogenase-like | 0.003 | |
| TIGR01668 | 170 | TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfam | 0.003 |
| >gnl|CDD|221713 pfam12689, Acid_PPase, Acid Phosphatase | Back alignment and domain information |
|---|
Score = 98.8 bits (247), Expect = 4e-27
Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 15/84 (17%)
Query: 21 LPRLVVFDLDYTLWPFYCECCYE---------------DEIPYLYPHAKGILEALKEKGI 65
LP+L+VFDLDYTLWPF+C+ E LYP IL+ LKEKGI
Sbjct: 2 LPKLIVFDLDYTLWPFWCDTHVGPPFKKDKNGTVVDRRGEELSLYPDVPSILQELKEKGI 61
Query: 66 HVAVASRSPAPDIAKTFLHKLGIH 89
+AVASR+ APD A+ L L I+
Sbjct: 62 TIAVASRTDAPDWARELLKLLHIN 85
|
This family contains phosphatase enzymes and other proteins of the HAD superfamily. It includes MDP-1 which is a eukaryotic magnesium-dependent acid phosphatase. Length = 164 |
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|233529 TIGR01685, MDP-1, magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >gnl|CDD|233526 TIGR01681, HAD-SF-IIIC, HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|233519 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.94 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.87 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 99.87 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.87 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.87 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.86 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.85 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.85 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.85 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.85 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.85 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.84 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.84 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 99.84 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.84 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.84 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.83 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.82 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.82 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.82 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.82 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.81 | |
| PLN02940 | 382 | riboflavin kinase | 99.81 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.81 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.81 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.8 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.8 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.8 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.8 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.8 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.79 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.78 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.78 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.78 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.77 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.76 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.76 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.75 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 99.75 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.75 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.75 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.75 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.75 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.74 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 99.74 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.74 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.74 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.73 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.71 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.71 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.71 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.7 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.69 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.68 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.67 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.67 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.67 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.67 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.66 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.66 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.64 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.63 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 99.6 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.59 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.59 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.58 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.57 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.55 | |
| PLN02811 | 220 | hydrolase | 99.54 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.54 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.51 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.51 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.44 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 99.41 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.4 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 99.37 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 99.34 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 99.32 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.31 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 99.3 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 99.3 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 99.26 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.25 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.24 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 99.23 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 99.21 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 99.21 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 99.21 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 99.2 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.19 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.19 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.18 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.18 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.16 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.15 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 99.13 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.12 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.11 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.1 | |
| PRK08238 | 479 | hypothetical protein; Validated | 99.1 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.09 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.07 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 99.05 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 99.03 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.03 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.02 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 99.01 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.01 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 98.98 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.98 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 98.96 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.95 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 98.95 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 98.93 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.93 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 98.92 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 98.92 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.89 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 98.88 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 98.83 | |
| PLN02887 | 580 | hydrolase family protein | 98.82 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 98.81 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.79 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 98.77 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 98.74 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 98.73 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 98.67 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 98.66 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 98.65 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 98.62 | |
| PLN02423 | 245 | phosphomannomutase | 98.61 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 98.61 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 98.6 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 98.59 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 98.58 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 98.57 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 98.55 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 98.51 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 98.5 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 98.43 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 98.43 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 98.43 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 98.42 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 98.37 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 98.29 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 98.29 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 98.27 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 98.25 | |
| PLN03017 | 366 | trehalose-phosphatase | 98.25 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.21 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 98.21 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 98.18 | |
| KOG4549 | 144 | consensus Magnesium-dependent phosphatase [General | 98.17 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 98.15 | |
| PLN02151 | 354 | trehalose-phosphatase | 98.1 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 98.05 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 98.03 | |
| PLN02580 | 384 | trehalose-phosphatase | 98.02 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 97.97 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 97.97 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 97.91 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 97.9 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 97.9 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.89 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 97.85 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 97.76 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 97.61 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 97.61 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 97.59 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.49 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 97.44 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 97.42 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 97.37 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 97.25 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 97.22 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 97.2 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 97.19 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 97.14 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 97.11 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 97.06 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 96.95 | |
| KOG1618 | 389 | consensus Predicted phosphatase [General function | 96.93 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 96.92 | |
| COG5663 | 194 | Uncharacterized conserved protein [Function unknow | 96.68 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 96.67 | |
| KOG2630 | 254 | consensus Enolase-phosphatase E-1 [Amino acid tran | 96.4 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 95.91 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 95.84 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 95.76 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 95.69 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 95.6 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 95.08 | |
| PF04312 | 138 | DUF460: Protein of unknown function (DUF460); Inte | 95.06 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 94.78 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 94.5 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 93.72 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 93.66 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 93.52 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 93.23 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 93.2 | |
| PF05761 | 448 | 5_nucleotid: 5' nucleotidase family; InterPro: IPR | 92.59 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 92.56 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 91.74 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 91.71 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 91.6 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 91.38 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 91.2 | |
| COG4850 | 373 | Uncharacterized conserved protein [Function unknow | 91.17 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 91.1 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 89.93 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 88.64 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 88.6 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 88.58 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 88.5 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 87.98 | |
| PF02590 | 155 | SPOUT_MTase: Predicted SPOUT methyltransferase; In | 87.91 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 87.81 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 87.52 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 87.48 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 87.48 | |
| PRK00103 | 157 | rRNA large subunit methyltransferase; Provisional | 87.41 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 87.23 | |
| COG1576 | 155 | Uncharacterized conserved protein [Function unknow | 87.13 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 86.74 | |
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 86.73 | |
| PF06189 | 264 | 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 | 86.57 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 86.02 | |
| TIGR02495 | 191 | NrdG2 anaerobic ribonucleoside-triphosphate reduct | 85.86 | |
| PRK13762 | 322 | tRNA-modifying enzyme; Provisional | 85.8 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 84.58 | |
| KOG3128 | 298 | consensus Uncharacterized conserved protein [Funct | 84.46 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 84.02 | |
| PF06258 | 311 | Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP | 82.42 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 82.41 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 80.96 |
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.94 E-value=2.6e-27 Score=183.62 Aligned_cols=97 Identities=25% Similarity=0.181 Sum_probs=84.6
Q ss_pred CCCccCccHHHHHHHHHHCCceEEEEeCCCchHHHHHHHHHcCCCCCcccc------cccCCChhHHHHHHh--hCCCcc
Q 032013 45 EIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPM------VRLSCCIMCIIFFLF--FFSISA 116 (149)
Q Consensus 45 ~~~~~~pg~~e~L~~Lk~~Gi~i~IaT~~~~~~i~~~~l~~~gl~~~f~~~------~~~~p~p~~~i~~~~--~~~~~~ 116 (149)
+..++.||+.++|+.|+++|++++++||+++.. ++..++.+|+.+||+.+ ...||+|+++++.+. +++|++
T Consensus 83 ~~~~~~pGv~~~l~~L~~~~i~~avaS~s~~~~-~~~~L~~~gl~~~f~~~v~~~dv~~~KP~Pd~yL~Aa~~Lgv~P~~ 161 (221)
T COG0637 83 EGLKPIPGVVELLEQLKARGIPLAVASSSPRRA-AERVLARLGLLDYFDVIVTADDVARGKPAPDIYLLAAERLGVDPEE 161 (221)
T ss_pred cCCCCCccHHHHHHHHHhcCCcEEEecCChHHH-HHHHHHHccChhhcchhccHHHHhcCCCCCHHHHHHHHHcCCChHH
Confidence 446899999999999999999999999999988 79999999999999875 244888855555554 488999
Q ss_pred eEEEeehHhHHHHHHHhCCchhhhhh
Q 032013 117 FILFVDLFCFMYAAAYVGCDLYVYKR 142 (149)
Q Consensus 117 ~l~~eDs~~gi~aa~~ag~~~~~~~~ 142 (149)
|+|||||++||+||++|||.+|.+..
T Consensus 162 CvviEDs~~Gi~Aa~aAGm~vv~v~~ 187 (221)
T COG0637 162 CVVVEDSPAGIQAAKAAGMRVVGVPA 187 (221)
T ss_pred eEEEecchhHHHHHHHCCCEEEEecC
Confidence 99999999999999999999998753
|
|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG1618 consensus Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG5663 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF02590 SPOUT_MTase: Predicted SPOUT methyltransferase; InterPro: IPR003742 This family of proteins are predicted to be SPOUT methyltransferases [] | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00103 rRNA large subunit methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >COG1576 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein | Back alignment and domain information |
|---|
| >PRK13762 tRNA-modifying enzyme; Provisional | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3128 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 1u7o_A | 164 | Magnesium Dependent Phosphatase 1 (Mdp-1) Length = | 6e-06 | ||
| 2wm8_A | 187 | Crystal Structure Of Human Magnesium-Dependent Phos | 9e-06 |
| >pdb|1U7O|A Chain A, Magnesium Dependent Phosphatase 1 (Mdp-1) Length = 164 | Back alignment and structure |
|
| >pdb|2WM8|A Chain A, Crystal Structure Of Human Magnesium-Dependent Phosphatase 1 Of The Haloacid Dehalogenase Superfamily (Mgc5987) Length = 187 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 2e-20 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 2e-06 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 5e-06 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 5e-06 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 3e-05 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 3e-05 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 3e-05 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 3e-05 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 4e-05 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 4e-05 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 5e-05 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 6e-05 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 9e-05 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 1e-04 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 2e-04 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 2e-04 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 3e-04 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 3e-04 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 3e-04 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 4e-04 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 4e-04 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 4e-04 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 5e-04 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 5e-04 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 6e-04 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 8e-04 |
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Length = 187 | Back alignment and structure |
|---|
Score = 81.6 bits (201), Expect = 2e-20
Identities = 28/97 (28%), Positives = 39/97 (40%), Gaps = 15/97 (15%)
Query: 14 IIGQFENLPRLVVFDLDYTLWPFYCECCYEDEI---------------PYLYPHAKGILE 58
LP+L VFDLDYTLWPF+ + + LYP +L+
Sbjct: 19 YFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLK 78
Query: 59 ALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPM 95
L+ G+ A ASR+ + A L + FV
Sbjct: 79 RLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHR 115
|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Length = 258 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} Length = 274 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.89 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.89 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.88 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.87 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.86 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.86 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.86 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.86 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.85 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.83 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.81 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.81 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.81 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.81 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.81 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.81 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.81 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.81 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.81 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.8 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.8 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.8 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.8 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.8 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.8 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.8 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.79 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.79 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.79 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.78 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.78 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.78 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.78 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.77 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.77 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.77 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.77 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.77 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.77 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.77 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.76 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.76 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.76 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.76 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.76 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.76 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.75 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.75 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.75 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.75 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.75 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.75 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.75 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.75 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.75 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.75 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.75 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.75 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.74 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.74 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.74 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.74 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.74 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.74 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.74 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.73 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.72 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.72 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.72 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.72 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.71 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.7 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.7 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.7 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.7 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.7 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.7 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.7 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.69 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.69 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.69 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.68 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.68 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.68 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.67 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.66 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.66 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.65 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.65 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 99.65 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.65 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.62 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.61 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.61 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.61 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 99.61 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.59 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.58 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.57 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.56 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.55 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.55 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.55 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 99.54 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.52 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.51 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.49 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.49 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 99.48 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.45 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.45 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.45 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.44 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.41 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.39 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.35 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.34 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.33 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.25 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 99.16 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.15 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.14 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 99.13 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 99.12 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.1 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.09 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.08 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.07 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.06 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.03 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.0 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.0 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 98.99 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 98.98 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 98.52 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.96 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.92 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 98.87 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 98.86 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 98.86 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 98.82 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 98.81 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 98.78 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 98.75 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 98.73 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 98.72 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 98.64 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 98.55 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 98.33 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 98.1 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 97.83 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 97.7 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 97.48 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 97.42 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.35 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 97.34 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 97.31 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 97.12 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 96.8 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 96.74 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 96.74 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 96.58 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 96.26 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 96.02 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 95.58 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 95.03 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 94.67 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 94.38 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 94.11 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 93.51 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 93.08 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 92.86 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 92.51 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 92.18 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 91.64 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 90.51 | |
| 4fak_A | 163 | Ribosomal RNA large subunit methyltransferase H; a | 88.87 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 87.56 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 87.27 | |
| 2kln_A | 130 | Probable sulphate-transport transmembrane protein; | 86.01 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 85.92 | |
| 3dzc_A | 396 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 85.08 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 84.6 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 83.71 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 82.14 | |
| 1ns5_A | 155 | Hypothetical protein YBEA; structural genomics, PS | 81.83 | |
| 1to0_A | 167 | Hypothetical UPF0247 protein YYDA; structural geno | 81.03 |
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
Probab=99.89 E-value=3e-23 Score=154.92 Aligned_cols=90 Identities=24% Similarity=0.234 Sum_probs=79.3
Q ss_pred CccCccHHHHHHHHHHCCceEEEEeCCCchHHHHHHHHHcCCCCCccccc------ccCCChhHHHHHH----hhCCCcc
Q 032013 47 PYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMV------RLSCCIMCIIFFL----FFFSISA 116 (149)
Q Consensus 47 ~~~~pg~~e~L~~Lk~~Gi~i~IaT~~~~~~i~~~~l~~~gl~~~f~~~~------~~~p~p~~~i~~~----~~~~~~~ 116 (149)
.++.||+.++++.|+++|++++++||+++.. +...++.+|+.++|+.+. ..||+| .+|.. .+++|++
T Consensus 83 ~~~~pg~~~~l~~L~~~g~~~~i~tn~~~~~-~~~~l~~~~l~~~fd~~~~~~~~~~~KP~p--~~~~~a~~~lg~~p~e 159 (216)
T 3kbb_A 83 LKENPGVREALEFVKSKRIKLALATSTPQRE-ALERLRRLDLEKYFDVMVFGDQVKNGKPDP--EIYLLVLERLNVVPEK 159 (216)
T ss_dssp CCBCTTHHHHHHHHHHTTCEEEEECSSCHHH-HHHHHHHTTCGGGCSEEECGGGSSSCTTST--HHHHHHHHHHTCCGGG
T ss_pred cccCccHHHHHHHHHHcCCCcccccCCcHHH-HHHHHHhcCCCccccccccccccCCCcccH--HHHHHHHHhhCCCccc
Confidence 4688999999999999999999999999988 799999999999998652 347777 55554 6788999
Q ss_pred eEEEeehHhHHHHHHHhCCchhh
Q 032013 117 FILFVDLFCFMYAAAYVGCDLYV 139 (149)
Q Consensus 117 ~l~~eDs~~gi~aa~~ag~~~~~ 139 (149)
|++++||+++|++|++|||++|.
T Consensus 160 ~l~VgDs~~Di~aA~~aG~~~i~ 182 (216)
T 3kbb_A 160 VVVFEDSKSGVEAAKSAGIERIY 182 (216)
T ss_dssp EEEEECSHHHHHHHHHTTCCCEE
T ss_pred eEEEecCHHHHHHHHHcCCcEEE
Confidence 99999999999999999999874
|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4fak_A Ribosomal RNA large subunit methyltransferase H; alpha/beta methyltransferase rossmann fold, rRNA methylation rRNA, ribosomal protein; HET: SAM PG4; 1.70A {Staphylococcus aureus} PDB: 1vh0_A | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >2kln_A Probable sulphate-transport transmembrane protein; SLC26, sulfate, antisigma factor antagonist, ensemble structures, transport protein; NMR {Mycobacterium bovis} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1ns5_A Hypothetical protein YBEA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.68A {Escherichia coli} SCOP: c.116.1.3 | Back alignment and structure |
|---|
| >1to0_A Hypothetical UPF0247 protein YYDA; structural genomics, unknown function, PSI, protein structure initiative; 2.50A {Bacillus subtilis} SCOP: c.116.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1u7pa_ | 164 | c.108.1.17 (A:) Magnesium-dependent phosphatase-1, | 2e-10 | |
| d2b30a1 | 283 | c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod | 5e-05 | |
| d1rlma_ | 269 | c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc | 4e-04 | |
| d2rbka1 | 260 | c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B | 4e-04 | |
| d1nrwa_ | 285 | c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu | 5e-04 | |
| d1rkqa_ | 271 | c.108.1.10 (A:) Hypothetical protein YidA {Escheri | 0.001 | |
| d2amya1 | 243 | c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( | 0.003 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 0.003 | |
| d1xvia_ | 232 | c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera | 0.004 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 0.004 |
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Magnesium-dependent phosphatase-1, Mdp1 domain: Magnesium-dependent phosphatase-1, Mdp1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 53.7 bits (128), Expect = 2e-10
Identities = 28/103 (27%), Positives = 39/103 (37%), Gaps = 15/103 (14%)
Query: 21 LPRLVVFDLDYTLWPFYCECCYEDEI---------------PYLYPHAKGILEALKEKGI 65
LP+L VFDLDYTLWPF+ + + LYP +L L+ G+
Sbjct: 4 LPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGV 63
Query: 66 HVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFF 108
VA ASR+ A L + F+ +
Sbjct: 64 PVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFER 106
|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.93 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 99.89 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.87 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.86 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.86 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.84 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.84 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.84 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.83 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.83 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.82 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.81 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.8 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.79 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.77 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.76 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.76 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.75 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.73 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.71 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.69 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.65 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.58 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.55 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.53 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 99.51 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 99.45 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.43 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 99.4 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 99.39 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.28 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.24 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.18 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.18 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.14 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.12 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.05 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.03 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 98.99 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 98.9 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 98.88 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.87 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 98.86 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 98.82 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 98.78 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 98.73 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 98.65 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 98.64 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.57 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.48 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 98.4 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 98.3 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 98.21 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 98.19 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 97.85 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 97.4 | |
| d2bdea1 | 458 | Cytosolic IMP-GMP specific 5'-nucleotidase {Legion | 91.85 | |
| d1jx7a_ | 117 | Hypothetical protein YchN {Escherichia coli [TaxId | 82.16 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 81.34 | |
| d1vc1a_ | 110 | Anti-sigma factor antagonist SpoIIaa {Thermotoga m | 80.23 |
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Magnesium-dependent phosphatase-1, Mdp1 domain: Magnesium-dependent phosphatase-1, Mdp1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93 E-value=1.2e-25 Score=162.92 Aligned_cols=123 Identities=26% Similarity=0.395 Sum_probs=100.2
Q ss_pred CCCccEEEEecCCcccccccccc---------------ccCCCCccCccHHHHHHHHHHCCceEEEEeCCCchHHHHHHH
Q 032013 19 ENLPRLVVFDLDYTLWPFYCECC---------------YEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFL 83 (149)
Q Consensus 19 ~~~~k~vifDlDGTLld~~~~~~---------------~~~~~~~~~pg~~e~L~~Lk~~Gi~i~IaT~~~~~~i~~~~l 83 (149)
...||+|+||+|||||+.+...+ ...+...++||+.++|++|+++|++++|+||++....+...+
T Consensus 2 ~~~pK~viFDlDGTL~d~~~~~~~~~~~~~~~~~~~~d~~~~~~~l~pgv~e~L~~L~~~G~~~~v~S~~~~~~~~~~~l 81 (164)
T d1u7pa_ 2 TRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEIQGANQLL 81 (164)
T ss_dssp CCCCSEEEECCBTTTBSSCTTTTCCSCEEECTTSCEEETTCCEECCCTTHHHHHHHHHHTTCCEEEEECCSCHHHHHHHH
T ss_pred CCCCCEEEEcCCCcccCCccccccCccHhHHhcchHhhhhccccccchHHHHHHHHHHHCCCcEEEEeccccchhhccch
Confidence 34589999999999999755522 233446899999999999999999999999988765357778
Q ss_pred HHcCCCCCccccc-ccCCChhHHHHHH--hhCCCcceEEEeehHhHHHHHHHhCCchhhhh
Q 032013 84 HKLGIHSMFVPMV-RLSCCIMCIIFFL--FFFSISAFILFVDLFCFMYAAAYVGCDLYVYK 141 (149)
Q Consensus 84 ~~~gl~~~f~~~~-~~~p~p~~~i~~~--~~~~~~~~l~~eDs~~gi~aa~~ag~~~~~~~ 141 (149)
+.+++..+|..+. ..+|+|.+...+. .+++|++|++++|++.++++|++|||++|.+.
T Consensus 82 ~~~~~~~~~~~~~~~~kp~~~~~~~~~~~~~~~~~~~l~igD~~~di~aA~~aG~~~i~v~ 142 (164)
T d1u7pa_ 82 ELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIR 142 (164)
T ss_dssp HHTTCGGGCSEEEESSSCHHHHHHHHHHHHCCCGGGEEEEESCHHHHHHHHTTTCEEEECS
T ss_pred hcccccccceeeecccCCChHHHHHHHHHhCCChHHEEEEcCCHHHHHHHHHcCCEEEEEC
Confidence 9999998888764 5577775544443 66888999999999999999999999998764
|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1jx7a_ c.114.1.1 (A:) Hypothetical protein YchN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1vc1a_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|