Citrus Sinensis ID: 032013


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MGDLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
cccHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHcccccccccEEcccccccccEEEccccccEEEEEccccccHHHHHHHccEEEEEEcEEEEEEc
cccHHHHHHHHHHHHHHHHccccEEEEEcccccccEEEEcccccccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccccHHHHHHEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcc
MGDLEKVKNEALEIIGqfenlprlvvfdldytlwpfyceccyedeipylypHAKGILEALKEKGIHVAvasrspapdiAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
MGDLEKVKNEALEIigqfenlprlVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
MGDLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRlsccimciifflfffsisafilfVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
**********ALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIF*
**********ALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
MGDLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
**DLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFFLFFFSISAFILFVDLFCFMYAAAYVGCDLYVYKRLIKCIFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q9D967164 Magnesium-dependent phosp yes no 0.362 0.329 0.362 7e-05
Q86V88176 Magnesium-dependent phosp yes no 0.436 0.369 0.325 0.0002
O94279172 Putative magnesium-depend yes no 0.503 0.436 0.333 0.0003
P40081178 Putative magnesium-depend yes no 0.516 0.432 0.292 0.0003
>sp|Q9D967|MGDP1_MOUSE Magnesium-dependent phosphatase 1 OS=Mus musculus GN=Mdp1 PE=1 SV=1 Back     alignment and function desciption
 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 15/69 (21%)

Query: 20 NLPRLVVFDLDYTLWPFYCECCYE---------------DEIPYLYPHAKGILEALKEKG 64
           LP+L VFDLDYTLWPF+ +   +                +   LYP    +L  L+  G
Sbjct: 3  RLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLG 62

Query: 65 IHVAVASRS 73
          + VA ASR+
Sbjct: 63 VPVAAASRT 71




Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q86V88|MGDP1_HUMAN Magnesium-dependent phosphatase 1 OS=Homo sapiens GN=MDP1 PE=1 SV=1 Back     alignment and function description
>sp|O94279|MGDP1_SCHPO Putative magnesium-dependent phosphatase P8B7.31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.31 PE=1 SV=2 Back     alignment and function description
>sp|P40081|MGDP1_YEAST Putative magnesium-dependent phosphatase YER134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER134C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
255563310189 Magnesium-dependent phosphatase, putativ 0.617 0.486 0.752 7e-34
225465793165 PREDICTED: magnesium-dependent phosphata 0.590 0.533 0.761 3e-31
4587681151 hypothetical protein [Arabidopsis thalia 0.617 0.609 0.695 7e-31
79555268190 haloacid dehalogenase-like hydrolase dom 0.597 0.468 0.707 2e-30
388504702176 unknown [Lotus japonicus] 0.624 0.528 0.688 3e-30
115455203173 Os03g0737400 [Oryza sativa Japonica Grou 0.617 0.531 0.709 3e-30
224035303129 unknown [Zea mays] gi|413933131|gb|AFW67 0.771 0.891 0.598 3e-30
222625757 327 hypothetical protein OsJ_12493 [Oryza sa 0.617 0.281 0.709 4e-30
388515721176 unknown [Lotus japonicus] 0.624 0.528 0.688 4e-30
449438224188 PREDICTED: magnesium-dependent phosphata 0.597 0.473 0.707 6e-30
>gi|255563310|ref|XP_002522658.1| Magnesium-dependent phosphatase, putative [Ricinus communis] gi|223538134|gb|EEF39745.1| Magnesium-dependent phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (84%), Gaps = 1/93 (1%)

Query: 1  MGDLEKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEAL 60
          MGD EK+K+EAL+IIG F+ LPRLVVFDLDYTLWPFYCEC  + E+P LYPHAKGIL AL
Sbjct: 1  MGD-EKIKDEALQIIGMFQMLPRLVVFDLDYTLWPFYCECRSKREMPSLYPHAKGILYAL 59

Query: 61 KEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFV 93
          K+KGI VA+ASRSP PDIA TFL KL + SMFV
Sbjct: 60 KDKGIDVAIASRSPTPDIANTFLDKLSLKSMFV 92




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225465793|ref|XP_002269091.1| PREDICTED: magnesium-dependent phosphatase 1 [Vitis vinifera] gi|296087423|emb|CBI34012.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|4587681|gb|AAD25851.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79555268|ref|NP_179027.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|48310074|gb|AAT41748.1| At2g14110 [Arabidopsis thaliana] gi|50198845|gb|AAT70452.1| At2g14110 [Arabidopsis thaliana] gi|330251187|gb|AEC06281.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388504702|gb|AFK40417.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|115455203|ref|NP_001051202.1| Os03g0737400 [Oryza sativa Japonica Group] gi|29788863|gb|AAP03409.1| unknown protein [Oryza sativa Japonica Group] gi|37999990|gb|AAR07077.1| unknown protein [Oryza sativa Japonica Group] gi|108710967|gb|ABF98762.1| magnesium-dependent phosphatase-1 family protein, expressed [Oryza sativa Japonica Group] gi|113549673|dbj|BAF13116.1| Os03g0737400 [Oryza sativa Japonica Group] gi|215686587|dbj|BAG88840.1| unnamed protein product [Oryza sativa Japonica Group] gi|218193717|gb|EEC76144.1| hypothetical protein OsI_13434 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|224035303|gb|ACN36727.1| unknown [Zea mays] gi|413933131|gb|AFW67682.1| hypothetical protein ZEAMMB73_293867 [Zea mays] Back     alignment and taxonomy information
>gi|222625757|gb|EEE59889.1| hypothetical protein OsJ_12493 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|388515721|gb|AFK45922.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449438224|ref|XP_004136889.1| PREDICTED: magnesium-dependent phosphatase 1-like [Cucumis sativus] gi|449478847|ref|XP_004155433.1| PREDICTED: magnesium-dependent phosphatase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
TAIR|locus:2059440190 AT2G14110 "AT2G14110" [Arabido 0.597 0.468 0.707 6.2e-30
ASPGD|ASPL0000029748215 AN5512 [Emericella nidulans (t 0.456 0.316 0.392 3.6e-09
UNIPROTKB|F1SGN7164 LOC100520440 "Uncharacterized 0.503 0.457 0.344 4.3e-06
CGD|CAL0000216175 orf19.6929 [Candida albicans ( 0.442 0.377 0.337 9.4e-06
UNIPROTKB|Q59SU0175 CaO19.14191 "Putative uncharac 0.442 0.377 0.337 9.4e-06
UNIPROTKB|F1MXF2164 MDP-1 "Uncharacterized protein 0.489 0.445 0.329 1.5e-05
POMBASE|SPBP8B7.31172 SPBP8B7.31 "acid phosphatase ( 0.120 0.104 0.666 2.9e-05
RGD|1311147164 Mdp1 "magnesium-dependent phos 0.476 0.432 0.344 3e-05
MGI|MGI:1915131164 Mdp1 "magnesium-dependent phos 0.489 0.445 0.318 6.6e-05
SGD|S000000936178 YER134C "Magnesium-dependent a 0.120 0.101 0.611 7e-05
TAIR|locus:2059440 AT2G14110 "AT2G14110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 331 (121.6 bits), Expect = 6.2e-30, P = 6.2e-30
 Identities = 63/89 (70%), Positives = 73/89 (82%)

Query:     5 EKVKNEALEIIGQFENLPRLVVFDLDYTLWPFYCECCYEDEIPYLYPHAKGILEALKEKG 64
             EKVK+EA++I+G F+ LPRLVVFDLDYTLWPFYCEC  + E+P +YP AKGIL ALKEKG
Sbjct:     4 EKVKDEAMQIMGMFQILPRLVVFDLDYTLWPFYCECRSKREMPSMYPQAKGILSALKEKG 63

Query:    65 IHVAVASRSPAPDIAKTFLHKLGIHSMFV 93
             I +A+ASRSP  DIA TFL KL I  MFV
Sbjct:    64 IEMAIASRSPTSDIANTFLDKLNIKPMFV 92




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
ASPGD|ASPL0000029748 AN5512 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGN7 LOC100520440 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
CGD|CAL0000216 orf19.6929 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59SU0 CaO19.14191 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXF2 MDP-1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
POMBASE|SPBP8B7.31 SPBP8B7.31 "acid phosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1311147 Mdp1 "magnesium-dependent phosphatase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915131 Mdp1 "magnesium-dependent phosphatase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
SGD|S000000936 YER134C "Magnesium-dependent acid phosphatase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
pfam12689164 pfam12689, Acid_PPase, Acid Phosphatase 4e-27
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 5e-09
TIGR01685174 TIGR01685, MDP-1, magnesium-dependent phosphatase- 2e-07
TIGR01681128 TIGR01681, HAD-SF-IIIC, HAD-superfamily phosphatas 5e-07
COG0561 264 COG0561, Cof, Predicted hydrolases of the HAD supe 1e-04
TIGR00099 256 TIGR00099, Cof-subfamily, Cof subfamily of IIB sub 0.002
TIGR01662132 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, 0.002
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 0.002
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohex 0.003
pfam13344101 pfam13344, Hydrolase_6, Haloacid dehalogenase-like 0.003
TIGR01668170 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfam 0.003
>gnl|CDD|221713 pfam12689, Acid_PPase, Acid Phosphatase Back     alignment and domain information
 Score = 98.8 bits (247), Expect = 4e-27
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 15/84 (17%)

Query: 21 LPRLVVFDLDYTLWPFYCECCYE---------------DEIPYLYPHAKGILEALKEKGI 65
          LP+L+VFDLDYTLWPF+C+                    E   LYP    IL+ LKEKGI
Sbjct: 2  LPKLIVFDLDYTLWPFWCDTHVGPPFKKDKNGTVVDRRGEELSLYPDVPSILQELKEKGI 61

Query: 66 HVAVASRSPAPDIAKTFLHKLGIH 89
           +AVASR+ APD A+  L  L I+
Sbjct: 62 TIAVASRTDAPDWARELLKLLHIN 85


This family contains phosphatase enzymes and other proteins of the HAD superfamily. It includes MDP-1 which is a eukaryotic magnesium-dependent acid phosphatase. Length = 164

>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|233529 TIGR01685, MDP-1, magnesium-dependent phosphatase-1 Back     alignment and domain information
>gnl|CDD|233526 TIGR01681, HAD-SF-IIIC, HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|233519 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.94
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.87
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.87
PRK14988224 GMP/IMP nucleotidase; Provisional 99.87
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.87
PRK11587218 putative phosphatase; Provisional 99.86
PRK13226229 phosphoglycolate phosphatase; Provisional 99.85
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.85
PRK13288214 pyrophosphatase PpaX; Provisional 99.85
PLN02575381 haloacid dehalogenase-like hydrolase 99.85
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.85
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.84
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.84
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.84
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.84
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.84
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.83
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.82
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.82
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.82
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.82
PRK13225273 phosphoglycolate phosphatase; Provisional 99.81
PLN02940 382 riboflavin kinase 99.81
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.81
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.81
PRK06769173 hypothetical protein; Validated 99.8
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.8
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.8
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.8
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.8
COG0546220 Gph Predicted phosphatases [General function predi 99.79
PRK13223272 phosphoglycolate phosphatase; Provisional 99.78
PRK13222226 phosphoglycolate phosphatase; Provisional 99.78
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.78
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.77
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.76
PRK09449224 dUMP phosphatase; Provisional 99.76
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.75
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.75
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.75
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.75
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.75
PHA02597197 30.2 hypothetical protein; Provisional 99.75
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.74
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.74
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.74
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.74
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.73
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.71
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.71
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.71
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.7
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.69
PLN02954224 phosphoserine phosphatase 99.68
PHA02530300 pseT polynucleotide kinase; Provisional 99.67
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.67
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.67
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.67
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.66
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.66
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.64
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.63
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 99.6
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 99.59
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.59
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.58
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.57
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.55
PLN02811220 hydrolase 99.54
PRK11133322 serB phosphoserine phosphatase; Provisional 99.54
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.51
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.51
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.44
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.41
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.4
TIGR01684301 viral_ppase viral phosphatase. These proteins also 99.37
TIGR01459 242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.34
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.32
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.31
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.3
PTZ00445219 p36-lilke protein; Provisional 99.3
TIGR01457 249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.26
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.25
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.24
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.23
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.21
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 99.21
PHA03398303 viral phosphatase superfamily protein; Provisional 99.21
PLN02645 311 phosphoglycolate phosphatase 99.2
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.19
PRK10976 266 putative hydrolase; Provisional 99.19
PRK01158 230 phosphoglycolate phosphatase; Provisional 99.18
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.18
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.16
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.15
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 99.13
COG0561 264 Cof Predicted hydrolases of the HAD superfamily [G 99.12
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.11
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.1
PRK08238 479 hypothetical protein; Validated 99.1
PRK10513 270 sugar phosphate phosphatase; Provisional 99.09
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.07
COG4996164 Predicted phosphatase [General function prediction 99.05
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 99.03
TIGR02463 221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 99.03
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 99.02
PF08282 254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 99.01
TIGR02461 225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 99.01
TIGR01482 225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.98
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 98.98
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 98.96
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.95
TIGR01458 257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 98.95
PTZ00174 247 phosphomannomutase; Provisional 98.93
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 98.93
PRK10444 248 UMP phosphatase; Provisional 98.92
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 98.92
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 98.89
TIGR01486 256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.88
COG0647 269 NagD Predicted sugar phosphatases of the HAD super 98.83
PLN02887 580 hydrolase family protein 98.82
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.81
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.79
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 98.77
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 98.74
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 98.73
TIGR01485 249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.67
PRK11590211 hypothetical protein; Provisional 98.66
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 98.65
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.62
PLN02423 245 phosphomannomutase 98.61
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 98.61
TIGR01675229 plant-AP plant acid phosphatase. This model explic 98.6
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.59
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.58
PRK10187 266 trehalose-6-phosphate phosphatase; Provisional 98.57
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 98.55
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 98.51
TIGR01460 236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 98.5
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 98.43
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 98.43
TIGR02471 236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.43
COG3769 274 Predicted hydrolase (HAD superfamily) [General fun 98.42
KOG2882 306 consensus p-Nitrophenyl phosphatase [Inorganic ion 98.37
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 98.29
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 98.29
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 98.27
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 98.25
PLN03017 366 trehalose-phosphatase 98.25
PRK10671834 copA copper exporting ATPase; Provisional 98.21
COG4229229 Predicted enolase-phosphatase [Energy production a 98.21
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 98.18
KOG4549144 consensus Magnesium-dependent phosphatase [General 98.17
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 98.15
PLN02151 354 trehalose-phosphatase 98.1
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 98.05
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 98.03
PLN02580 384 trehalose-phosphatase 98.02
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 97.97
PLN02645311 phosphoglycolate phosphatase 97.97
TIGR00685 244 T6PP trehalose-phosphatase. At least 18 distinct s 97.91
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 97.9
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 97.9
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 97.89
PLN02382 413 probable sucrose-phosphatase 97.85
COG1877 266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 97.76
COG2503274 Predicted secreted acid phosphatase [General funct 97.61
COG3700237 AphA Acid phosphatase (class B) [General function 97.61
KOG3040 262 consensus Predicted sugar phosphatase (HAD superfa 97.59
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.49
PF02358 235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 97.44
COG4359220 Uncharacterized conserved protein [Function unknow 97.42
PF05116 247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 97.37
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 97.25
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 97.22
PRK10444248 UMP phosphatase; Provisional 97.2
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 97.19
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 97.14
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 97.11
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 97.06
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 96.95
KOG1618 389 consensus Predicted phosphatase [General function 96.93
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 96.92
COG5663194 Uncharacterized conserved protein [Function unknow 96.68
KOG3189 252 consensus Phosphomannomutase [Lipid transport and 96.67
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 96.4
PF06437 408 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 95.91
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 95.84
KOG2116738 consensus Protein involved in plasmid maintenance/ 95.76
COG4087152 Soluble P-type ATPase [General function prediction 95.69
TIGR01497 675 kdpB K+-transporting ATPase, B subunit. One sequen 95.6
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 95.08
PF04312138 DUF460: Protein of unknown function (DUF460); Inte 95.06
KOG2134 422 consensus Polynucleotide kinase 3' phosphatase [Re 94.78
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 94.5
PRK14010 673 potassium-transporting ATPase subunit B; Provision 93.72
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 93.66
PRK01122 679 potassium-transporting ATPase subunit B; Provision 93.52
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 93.23
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 93.2
PF05761 448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 92.59
COG5083580 SMP2 Uncharacterized protein involved in plasmid m 92.56
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 91.74
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 91.71
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 91.6
PLN02499 498 glycerol-3-phosphate acyltransferase 91.38
COG0647269 NagD Predicted sugar phosphatases of the HAD super 91.2
COG4850373 Uncharacterized conserved protein [Function unknow 91.17
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 91.1
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 89.93
PRK01158230 phosphoglycolate phosphatase; Provisional 88.64
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 88.6
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 88.58
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 88.5
PRK15122 903 magnesium-transporting ATPase; Provisional 87.98
PF02590155 SPOUT_MTase: Predicted SPOUT methyltransferase; In 87.91
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 87.81
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 87.52
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 87.48
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 87.48
PRK00103157 rRNA large subunit methyltransferase; Provisional 87.41
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 87.23
COG1576155 Uncharacterized conserved protein [Function unknow 87.13
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 86.74
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 86.73
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 86.57
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 86.02
TIGR02495191 NrdG2 anaerobic ribonucleoside-triphosphate reduct 85.86
PRK13762322 tRNA-modifying enzyme; Provisional 85.8
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 84.58
KOG3128298 consensus Uncharacterized conserved protein [Funct 84.46
COG2216 681 KdpB High-affinity K+ transport system, ATPase cha 84.02
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 82.42
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 82.41
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 80.96
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
Probab=99.94  E-value=2.6e-27  Score=183.62  Aligned_cols=97  Identities=25%  Similarity=0.181  Sum_probs=84.6

Q ss_pred             CCCccCccHHHHHHHHHHCCceEEEEeCCCchHHHHHHHHHcCCCCCcccc------cccCCChhHHHHHHh--hCCCcc
Q 032013           45 EIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPM------VRLSCCIMCIIFFLF--FFSISA  116 (149)
Q Consensus        45 ~~~~~~pg~~e~L~~Lk~~Gi~i~IaT~~~~~~i~~~~l~~~gl~~~f~~~------~~~~p~p~~~i~~~~--~~~~~~  116 (149)
                      +..++.||+.++|+.|+++|++++++||+++.. ++..++.+|+.+||+.+      ...||+|+++++.+.  +++|++
T Consensus        83 ~~~~~~pGv~~~l~~L~~~~i~~avaS~s~~~~-~~~~L~~~gl~~~f~~~v~~~dv~~~KP~Pd~yL~Aa~~Lgv~P~~  161 (221)
T COG0637          83 EGLKPIPGVVELLEQLKARGIPLAVASSSPRRA-AERVLARLGLLDYFDVIVTADDVARGKPAPDIYLLAAERLGVDPEE  161 (221)
T ss_pred             cCCCCCccHHHHHHHHHhcCCcEEEecCChHHH-HHHHHHHccChhhcchhccHHHHhcCCCCCHHHHHHHHHcCCChHH
Confidence            446899999999999999999999999999988 79999999999999875      244888855555554  488999


Q ss_pred             eEEEeehHhHHHHHHHhCCchhhhhh
Q 032013          117 FILFVDLFCFMYAAAYVGCDLYVYKR  142 (149)
Q Consensus       117 ~l~~eDs~~gi~aa~~ag~~~~~~~~  142 (149)
                      |+|||||++||+||++|||.+|.+..
T Consensus       162 CvviEDs~~Gi~Aa~aAGm~vv~v~~  187 (221)
T COG0637         162 CVVVEDSPAGIQAAKAAGMRVVGVPA  187 (221)
T ss_pred             eEEEecchhHHHHHHHCCCEEEEecC
Confidence            99999999999999999999998753



>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>KOG1618 consensus Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>PF02590 SPOUT_MTase: Predicted SPOUT methyltransferase; InterPro: IPR003742 This family of proteins are predicted to be SPOUT methyltransferases [] Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00103 rRNA large subunit methyltransferase; Provisional Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>COG1576 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1u7o_A164 Magnesium Dependent Phosphatase 1 (Mdp-1) Length = 6e-06
2wm8_A187 Crystal Structure Of Human Magnesium-Dependent Phos 9e-06
>pdb|1U7O|A Chain A, Magnesium Dependent Phosphatase 1 (Mdp-1) Length = 164 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 15/89 (16%) Query: 20 NLPRLVVFDLDYTLWPFYCECCYE---------------DEIPYLYPHAKGILEALKEKG 64 LP+L VFDLDYTLWPF+ + + + LYP +L L+ G Sbjct: 3 RLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLG 62 Query: 65 IHVAVASRSPAPDIAKTFLHKLGIHSMFV 93 + VA ASR+ A L + F+ Sbjct: 63 VPVAAASRTSEIQGANQLLELFDLGKYFI 91
>pdb|2WM8|A Chain A, Crystal Structure Of Human Magnesium-Dependent Phosphatase 1 Of The Haloacid Dehalogenase Superfamily (Mgc5987) Length = 187 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 2e-20
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 2e-06
1te2_A226 Putative phosphatase; structural genomics, phospha 5e-06
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 5e-06
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 3e-05
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 3e-05
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 3e-05
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 3e-05
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 4e-05
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 4e-05
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 5e-05
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 6e-05
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 9e-05
1l6r_A 227 Hypothetical protein TA0175; structural genomics, 1e-04
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 2e-04
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 2e-04
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 3e-04
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 3e-04
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 3e-04
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 4e-04
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 4e-04
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 4e-04
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 5e-04
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 5e-04
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 6e-04
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 8e-04
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Length = 187 Back     alignment and structure
 Score = 81.6 bits (201), Expect = 2e-20
 Identities = 28/97 (28%), Positives = 39/97 (40%), Gaps = 15/97 (15%)

Query: 14  IIGQFENLPRLVVFDLDYTLWPFYCECCYEDEI---------------PYLYPHAKGILE 58
                  LP+L VFDLDYTLWPF+ +   +                    LYP    +L+
Sbjct: 19  YFQSMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLK 78

Query: 59  ALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPM 95
            L+  G+  A ASR+   + A   L    +   FV  
Sbjct: 79  RLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHR 115


>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Length = 258 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} Length = 274 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.89
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.89
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.88
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.87
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.86
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.86
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.86
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.86
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.85
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.83
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.81
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.81
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.81
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.81
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.81
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.81
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.81
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.81
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.81
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.8
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.8
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.8
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.8
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.8
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.8
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.8
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.79
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.79
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.79
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.78
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.78
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.78
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.78
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.77
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.77
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.77
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.77
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.77
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.77
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.77
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.76
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.76
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.76
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.76
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.76
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.76
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.75
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.75
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.75
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.75
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.75
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.75
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.75
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.75
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.75
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.75
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.75
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.75
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.74
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.74
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.74
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.74
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.74
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.74
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.74
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.73
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.72
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.72
3fvv_A232 Uncharacterized protein; unknown function, structu 99.72
1te2_A226 Putative phosphatase; structural genomics, phospha 99.72
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.71
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.7
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.7
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.7
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.7
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.7
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.7
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.7
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.69
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.69
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.69
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.68
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.68
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.68
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.67
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.66
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.66
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.65
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.65
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.65
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.65
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.62
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.61
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 99.61
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.61
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.61
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.59
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.58
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.57
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 99.56
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 99.55
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 99.55
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.55
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.54
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.52
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 99.51
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 99.49
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 99.49
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 99.48
1wr8_A 231 Phosphoglycolate phosphatase; alpha / beta core do 99.45
1zjj_A 263 Hypothetical protein PH1952; alpha/beta hydrolase 99.45
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.45
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.44
1l6r_A 227 Hypothetical protein TA0175; structural genomics, 99.41
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 99.39
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 99.35
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.34
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 99.33
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.25
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 99.16
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.15
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 99.14
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 99.13
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 99.12
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 99.1
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 99.09
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 99.08
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 99.07
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 99.06
3dao_A 283 Putative phosphatse; structural genomics, joint ce 99.03
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 99.0
2zos_A 249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 99.0
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 98.99
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 98.98
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 98.52
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 98.96
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 98.92
3f9r_A 246 Phosphomannomutase; trypanosome glycobiology struc 98.87
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 98.86
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 98.86
1u02_A 239 Trehalose-6-phosphate phosphatase related protein; 98.82
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 98.81
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 98.78
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 98.75
2fue_A 262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 98.73
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 98.72
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 98.64
1s2o_A 244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 98.55
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 98.33
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 98.1
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 97.83
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 97.7
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 97.48
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 97.42
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 97.35
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 97.34
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.31
1y8a_A332 Hypothetical protein AF1437; structural genomics, 97.12
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 96.8
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 96.74
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 96.74
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 96.58
4gxt_A385 A conserved functionally unknown protein; structur 96.26
1yns_A 261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 96.02
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 95.58
3a1c_A 287 Probable copper-exporting P-type ATPase A; ATP-bin 95.03
3dao_A283 Putative phosphatse; structural genomics, joint ce 94.67
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 94.38
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 94.11
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 93.51
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 93.08
1qyi_A 384 ZR25, hypothetical protein; structural genomics, P 92.86
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 92.51
4g63_A 470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 92.18
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 91.64
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 90.51
4fak_A163 Ribosomal RNA large subunit methyltransferase H; a 88.87
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 87.56
2yj3_A 263 Copper-transporting ATPase; hydrolase, P-type ATPa 87.27
2kln_A130 Probable sulphate-transport transmembrane protein; 86.01
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 85.92
3dzc_A 396 UDP-N-acetylglucosamine 2-epimerase; structural ge 85.08
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 84.6
3luf_A259 Two-component system response regulator/ggdef doma 83.71
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 82.14
1ns5_A155 Hypothetical protein YBEA; structural genomics, PS 81.83
1to0_A167 Hypothetical UPF0247 protein YYDA; structural geno 81.03
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.89  E-value=3e-23  Score=154.92  Aligned_cols=90  Identities=24%  Similarity=0.234  Sum_probs=79.3

Q ss_pred             CccCccHHHHHHHHHHCCceEEEEeCCCchHHHHHHHHHcCCCCCccccc------ccCCChhHHHHHH----hhCCCcc
Q 032013           47 PYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFLHKLGIHSMFVPMV------RLSCCIMCIIFFL----FFFSISA  116 (149)
Q Consensus        47 ~~~~pg~~e~L~~Lk~~Gi~i~IaT~~~~~~i~~~~l~~~gl~~~f~~~~------~~~p~p~~~i~~~----~~~~~~~  116 (149)
                      .++.||+.++++.|+++|++++++||+++.. +...++.+|+.++|+.+.      ..||+|  .+|..    .+++|++
T Consensus        83 ~~~~pg~~~~l~~L~~~g~~~~i~tn~~~~~-~~~~l~~~~l~~~fd~~~~~~~~~~~KP~p--~~~~~a~~~lg~~p~e  159 (216)
T 3kbb_A           83 LKENPGVREALEFVKSKRIKLALATSTPQRE-ALERLRRLDLEKYFDVMVFGDQVKNGKPDP--EIYLLVLERLNVVPEK  159 (216)
T ss_dssp             CCBCTTHHHHHHHHHHTTCEEEEECSSCHHH-HHHHHHHTTCGGGCSEEECGGGSSSCTTST--HHHHHHHHHHTCCGGG
T ss_pred             cccCccHHHHHHHHHHcCCCcccccCCcHHH-HHHHHHhcCCCccccccccccccCCCcccH--HHHHHHHHhhCCCccc
Confidence            4688999999999999999999999999988 799999999999998652      347777  55554    6788999


Q ss_pred             eEEEeehHhHHHHHHHhCCchhh
Q 032013          117 FILFVDLFCFMYAAAYVGCDLYV  139 (149)
Q Consensus       117 ~l~~eDs~~gi~aa~~ag~~~~~  139 (149)
                      |++++||+++|++|++|||++|.
T Consensus       160 ~l~VgDs~~Di~aA~~aG~~~i~  182 (216)
T 3kbb_A          160 VVVFEDSKSGVEAAKSAGIERIY  182 (216)
T ss_dssp             EEEEECSHHHHHHHHHTTCCCEE
T ss_pred             eEEEecCHHHHHHHHHcCCcEEE
Confidence            99999999999999999999874



>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4fak_A Ribosomal RNA large subunit methyltransferase H; alpha/beta methyltransferase rossmann fold, rRNA methylation rRNA, ribosomal protein; HET: SAM PG4; 1.70A {Staphylococcus aureus} PDB: 1vh0_A Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>2kln_A Probable sulphate-transport transmembrane protein; SLC26, sulfate, antisigma factor antagonist, ensemble structures, transport protein; NMR {Mycobacterium bovis} Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1ns5_A Hypothetical protein YBEA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.68A {Escherichia coli} SCOP: c.116.1.3 Back     alignment and structure
>1to0_A Hypothetical UPF0247 protein YYDA; structural genomics, unknown function, PSI, protein structure initiative; 2.50A {Bacillus subtilis} SCOP: c.116.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1u7pa_164 c.108.1.17 (A:) Magnesium-dependent phosphatase-1, 2e-10
d2b30a1 283 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod 5e-05
d1rlma_ 269 c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc 4e-04
d2rbka1 260 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B 4e-04
d1nrwa_ 285 c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu 5e-04
d1rkqa_ 271 c.108.1.10 (A:) Hypothetical protein YidA {Escheri 0.001
d2amya1 243 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( 0.003
d1wr8a_ 230 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 0.003
d1xvia_ 232 c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera 0.004
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 0.004
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Magnesium-dependent phosphatase-1, Mdp1
domain: Magnesium-dependent phosphatase-1, Mdp1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 53.7 bits (128), Expect = 2e-10
 Identities = 28/103 (27%), Positives = 39/103 (37%), Gaps = 15/103 (14%)

Query: 21  LPRLVVFDLDYTLWPFYCECCYEDEI---------------PYLYPHAKGILEALKEKGI 65
           LP+L VFDLDYTLWPF+ +   +                    LYP    +L  L+  G+
Sbjct: 4   LPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGV 63

Query: 66  HVAVASRSPAPDIAKTFLHKLGIHSMFVPMVRLSCCIMCIIFF 108
            VA ASR+     A   L    +   F+         +     
Sbjct: 64  PVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFER 106


>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.93
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.89
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.87
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.86
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.86
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.84
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.84
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.84
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.83
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.83
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.83
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.82
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.81
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.8
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.79
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.77
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.76
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.76
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.75
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.73
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.71
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.69
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.65
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.58
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.55
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.53
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 99.51
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.45
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.43
d1yv9a1 253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.4
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 99.39
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.28
d1wr8a_ 230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.24
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.18
d1wzca1 243 Putative mannosyl-3-phosphoglycerate phosphatase M 99.18
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 99.14
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 99.12
d1l6ra_ 225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.05
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.03
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.99
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.9
d2rbka1 260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.88
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.87
d2amya1 243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 98.86
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.82
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 98.78
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 98.73
d1u02a_ 229 Trehalose-6-phosphate phosphatase related protein 98.65
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.64
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 98.57
d2fuea1 244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 98.48
d1s2oa1 244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.4
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.3
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.21
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 98.19
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 97.85
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.4
d2bdea1 458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 91.85
d1jx7a_117 Hypothetical protein YchN {Escherichia coli [TaxId 82.16
d1qyia_ 380 Hypothetical protein MW1667 (SA1546) {Staphylococc 81.34
d1vc1a_110 Anti-sigma factor antagonist SpoIIaa {Thermotoga m 80.23
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Magnesium-dependent phosphatase-1, Mdp1
domain: Magnesium-dependent phosphatase-1, Mdp1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=1.2e-25  Score=162.92  Aligned_cols=123  Identities=26%  Similarity=0.395  Sum_probs=100.2

Q ss_pred             CCCccEEEEecCCcccccccccc---------------ccCCCCccCccHHHHHHHHHHCCceEEEEeCCCchHHHHHHH
Q 032013           19 ENLPRLVVFDLDYTLWPFYCECC---------------YEDEIPYLYPHAKGILEALKEKGIHVAVASRSPAPDIAKTFL   83 (149)
Q Consensus        19 ~~~~k~vifDlDGTLld~~~~~~---------------~~~~~~~~~pg~~e~L~~Lk~~Gi~i~IaT~~~~~~i~~~~l   83 (149)
                      ...||+|+||+|||||+.+...+               ...+...++||+.++|++|+++|++++|+||++....+...+
T Consensus         2 ~~~pK~viFDlDGTL~d~~~~~~~~~~~~~~~~~~~~d~~~~~~~l~pgv~e~L~~L~~~G~~~~v~S~~~~~~~~~~~l   81 (164)
T d1u7pa_           2 TRLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEIQGANQLL   81 (164)
T ss_dssp             CCCCSEEEECCBTTTBSSCTTTTCCSCEEECTTSCEEETTCCEECCCTTHHHHHHHHHHTTCCEEEEECCSCHHHHHHHH
T ss_pred             CCCCCEEEEcCCCcccCCccccccCccHhHHhcchHhhhhccccccchHHHHHHHHHHHCCCcEEEEeccccchhhccch
Confidence            34589999999999999755522               233446899999999999999999999999988765357778


Q ss_pred             HHcCCCCCccccc-ccCCChhHHHHHH--hhCCCcceEEEeehHhHHHHHHHhCCchhhhh
Q 032013           84 HKLGIHSMFVPMV-RLSCCIMCIIFFL--FFFSISAFILFVDLFCFMYAAAYVGCDLYVYK  141 (149)
Q Consensus        84 ~~~gl~~~f~~~~-~~~p~p~~~i~~~--~~~~~~~~l~~eDs~~gi~aa~~ag~~~~~~~  141 (149)
                      +.+++..+|..+. ..+|+|.+...+.  .+++|++|++++|++.++++|++|||++|.+.
T Consensus        82 ~~~~~~~~~~~~~~~~kp~~~~~~~~~~~~~~~~~~~l~igD~~~di~aA~~aG~~~i~v~  142 (164)
T d1u7pa_          82 ELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIR  142 (164)
T ss_dssp             HHTTCGGGCSEEEESSSCHHHHHHHHHHHHCCCGGGEEEEESCHHHHHHHHTTTCEEEECS
T ss_pred             hcccccccceeeecccCCChHHHHHHHHHhCCChHHEEEEcCCHHHHHHHHHcCCEEEEEC
Confidence            9999998888764 5577775544443  66888999999999999999999999998764



>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1jx7a_ c.114.1.1 (A:) Hypothetical protein YchN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vc1a_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure