Citrus Sinensis ID: 032040

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEKRDYDMMLAQQMSMEREAGGPQAAPSGFR
cccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccEEEEEHHHHHHHHHHHHHccccccEEEccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHccHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccc
mayckskvytvncgmAYGQAAMLLSVGakgyrglqpnsstklylpvvgrssgpvtdMWRKAKDLEANAESYIELLAkgtgkpkeeiakdiqrpkymQAKEAIVYGLADKIIDSQDAAYEKRDYDMMLAQQMSMereaggpqaapsgfr
MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLqpnsstklylpvvgrssgpvtDMWRKAKDLEANAESYIELlakgtgkpkeeiakdiqrpkyMQAKEAIVYGLADKIIDSQDAAYEKRDYDMMLAQQMSMEreaggpqaapsgfr
MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEKRDYDMMLAQQMSMEREAGGPQAAPSGFR
**YCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLA*****************KYMQAKEAIVYGLADKIIDSQDAAY******************************
MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKI**************************************
MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEKRDYDMMLAQQMSM***************
*AYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDA********************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEKRDYDMMLAQQMSMEREAGGPQAAPSGFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q9XJ35387 ATP-dependent Clp proteas yes no 0.986 0.377 0.682 2e-53
Q7N0L3207 ATP-dependent Clp proteas yes no 0.770 0.550 0.408 2e-16
Q8LB10305 ATP-dependent Clp proteas no no 0.743 0.360 0.369 3e-15
Q9L4P4228 Putative ATP-dependent Cl yes no 0.763 0.495 0.368 4e-15
P74466225 Putative ATP-dependent Cl N/A no 0.756 0.497 0.371 5e-15
B2KCS5195 ATP-dependent Clp proteas yes no 0.756 0.574 0.368 1e-14
Q60107207 ATP-dependent Clp proteas yes no 0.770 0.550 0.382 1e-14
A1JNN2207 ATP-dependent Clp proteas yes no 0.770 0.550 0.382 1e-14
Q9K709194 ATP-dependent Clp proteas yes no 0.756 0.577 0.389 1e-14
O67357201 ATP-dependent Clp proteas yes no 0.770 0.567 0.391 2e-14
>sp|Q9XJ35|CLPR1_ARATH ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic OS=Arabidopsis thaliana GN=CLPR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  207 bits (528), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (81%), Gaps = 2/148 (1%)

Query: 1   MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
           ++YCKS VYT+NCGMA+GQAAMLLS+G KGYR +QP+SSTKLYLP V RSSG   DMW K
Sbjct: 242 ISYCKSDVYTINCGMAFGQAAMLLSLGKKGYRAVQPHSSTKLYLPKVNRSSGAAIDMWIK 301

Query: 61  AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEK 120
           AK+L+AN E YIELLAKGTGK KE+I +DI+RPKY+QA+ AI YG+ADKI DSQD+++EK
Sbjct: 302 AKELDANTEYYIELLAKGTGKSKEQINEDIKRPKYLQAQAAIDYGIADKIADSQDSSFEK 361

Query: 121 RDYDMMLAQQMSMEREAGGPQAAPSGFR 148
           RDYD  LAQ+    R  GG  AAP+G R
Sbjct: 362 RDYDGTLAQRAM--RPGGGSPAAPAGLR 387
Required for chloroplast development and differentiation.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7N0L3|CLPP_PHOLL ATP-dependent Clp protease proteolytic subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q8LB10|CLPR4_ARATH ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic OS=Arabidopsis thaliana GN=CLPR4 PE=1 SV=1 Back     alignment and function description
>sp|Q9L4P4|CLPR_SYNE7 Putative ATP-dependent Clp protease proteolytic subunit-like OS=Synechococcus elongatus (strain PCC 7942) GN=clpR PE=3 SV=1 Back     alignment and function description
>sp|P74466|CLPR_SYNY3 Putative ATP-dependent Clp protease proteolytic subunit-like OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpR PE=3 SV=1 Back     alignment and function description
>sp|B2KCS5|CLPP_ELUMP ATP-dependent Clp protease proteolytic subunit OS=Elusimicrobium minutum (strain Pei191) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q60107|CLPP_YEREN ATP-dependent Clp protease proteolytic subunit OS=Yersinia enterocolitica GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|A1JNN2|CLPP_YERE8 ATP-dependent Clp protease proteolytic subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q9K709|CLPP1_BACHD ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=clpP1 PE=3 SV=1 Back     alignment and function description
>sp|O67357|CLPP_AQUAE ATP-dependent Clp protease proteolytic subunit OS=Aquifex aeolicus (strain VF5) GN=clpP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
224103735 391 predicted protein [Populus trichocarpa] 1.0 0.378 0.736 9e-59
356536107 372 PREDICTED: ATP-dependent Clp protease pr 1.0 0.397 0.748 5e-58
356575728 372 PREDICTED: ATP-dependent Clp protease pr 1.0 0.397 0.741 3e-57
225428973 388 PREDICTED: ATP-dependent Clp protease pr 1.0 0.381 0.785 5e-55
255639455 364 unknown [Glycine max] 0.939 0.381 0.737 2e-53
255573147 308 ATP-dependent Clp protease proteolytic s 1.0 0.480 0.756 2e-53
18402863 387 ATP-dependent Clp protease proteolytic s 0.986 0.377 0.682 1e-51
297852688 387 hypothetical protein ARALYDRAFT_891918 [ 0.986 0.377 0.675 3e-51
449438329 381 PREDICTED: ATP-dependent Clp protease pr 0.986 0.383 0.651 7e-48
449478766 381 PREDICTED: ATP-dependent Clp protease pr 0.986 0.383 0.651 7e-48
>gi|224103735|ref|XP_002313173.1| predicted protein [Populus trichocarpa] gi|222849581|gb|EEE87128.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 109/148 (73%), Positives = 127/148 (85%)

Query: 1   MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
           M+YCKS +YTVNCGMAYGQAAMLLS+GAKGYR LQPNSSTKLYLP V RSSG   DMW K
Sbjct: 244 MSYCKSTIYTVNCGMAYGQAAMLLSLGAKGYRALQPNSSTKLYLPKVNRSSGAAVDMWIK 303

Query: 61  AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEK 120
           AK+L+AN E YIELLAKGTGKPKEE+ KDIQRPKY++A+EAI YG+ADK++ S D A+EK
Sbjct: 304 AKELDANTEYYIELLAKGTGKPKEELVKDIQRPKYLKAQEAIDYGIADKLLSSNDDAFEK 363

Query: 121 RDYDMMLAQQMSMEREAGGPQAAPSGFR 148
           RDYD +LAQ  +M+ +A GP+AAPSG R
Sbjct: 364 RDYDALLAQTKAMKAQAAGPRAAPSGSR 391

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356536107|ref|XP_003536581.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356575728|ref|XP_003555989.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225428973|ref|XP_002264383.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic [Vitis vinifera] gi|296083061|emb|CBI22465.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255639455|gb|ACU20022.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255573147|ref|XP_002527503.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223533143|gb|EEF34901.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18402863|ref|NP_564560.1| ATP-dependent Clp protease proteolytic subunit-related protein 1 [Arabidopsis thaliana] gi|75315328|sp|Q9XJ35.1|CLPR1_ARATH RecName: Full=ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic; Short=ClpR1; AltName: Full=nClpP5; Flags: Precursor gi|8569101|gb|AAF76446.1|AC015445_13 Identical to nClpP5 from Arabidopsis thaliana gb|AB022330 and contains prenyltransferase PF|00432 and CLP protease PF|00574 domains. ESTs gb|H76908, gb|AA605567, gb|T21932, gb|T22976 come from this gene [Arabidopsis thaliana] gi|5360595|dbj|BAA82069.1| nClpP5 [Arabidopsis thaliana] gi|15010752|gb|AAK74035.1| At1g49970/F2J10_5 [Arabidopsis thaliana] gi|23308343|gb|AAN18141.1| At1g49970/F2J10_5 [Arabidopsis thaliana] gi|332194380|gb|AEE32501.1| ATP-dependent Clp protease proteolytic subunit-related protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297852688|ref|XP_002894225.1| hypothetical protein ARALYDRAFT_891918 [Arabidopsis lyrata subsp. lyrata] gi|297340067|gb|EFH70484.1| hypothetical protein ARALYDRAFT_891918 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449438329|ref|XP_004136941.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449478766|ref|XP_004155413.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2031070387 CLPR1 "CLP protease proteolyti 0.986 0.377 0.689 3.6e-50
TAIR|locus:2130449305 CLPR4 "CLP protease R subunit 0.804 0.390 0.341 1.4e-16
TAIR|locus:2034625279 CLP2 "CLP protease proteolytic 0.743 0.394 0.414 8.8e-15
TIGR_CMR|BA_5380193 BA_5380 "ATP-dependent Clp pro 0.763 0.585 0.359 2.1e-13
TIGR_CMR|CHY_0325195 CHY_0325 "ATP-dependent Clp pr 0.743 0.564 0.378 2.7e-13
TIGR_CMR|CJE_0185194 CJE_0185 "ATP-dependent Clp pr 0.75 0.572 0.383 2.7e-13
TAIR|locus:2033344309 CLPP3 "CLP protease proteolyti 0.75 0.359 0.348 5.9e-13
UNIPROTKB|P0A6G7207 clpP [Escherichia coli K-12 (t 0.743 0.531 0.360 9.1e-13
TAIR|locus:2163538292 CLPP4 "CLP protease P4" [Arabi 0.722 0.366 0.342 1e-12
TAIR|locus:2178282241 NCLPP7 "nuclear-encoded CLP pr 0.763 0.468 0.324 1.5e-12
TAIR|locus:2031070 CLPR1 "CLP protease proteolytic subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 522 (188.8 bits), Expect = 3.6e-50, P = 3.6e-50
 Identities = 102/148 (68%), Positives = 123/148 (83%)

Query:     1 MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
             ++YCKS VYT+NCGMA+GQAAMLLS+G KGYR +QP+SSTKLYLP V RSSG   DMW K
Sbjct:   242 ISYCKSDVYTINCGMAFGQAAMLLSLGKKGYRAVQPHSSTKLYLPKVNRSSGAAIDMWIK 301

Query:    61 AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAAYEK 120
             AK+L+AN E YIELLAKGTGK KE+I +DI+RPKY+QA+ AI YG+ADKI DSQD+++EK
Sbjct:   302 AKELDANTEYYIELLAKGTGKSKEQINEDIKRPKYLQAQAAIDYGIADKIADSQDSSFEK 361

Query:   121 RDYDMMLAQQMSMEREAGGPQAAPSGFR 148
             RDYD  LAQ+ +M R  GG  AAP+G R
Sbjct:   362 RDYDGTLAQR-AM-RPGGGSPAAPAGLR 387
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009840 "chloroplastic endopeptidase Clp complex" evidence=IDA
GO:0009532 "plastid stroma" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
TAIR|locus:2130449 CLPR4 "CLP protease R subunit 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034625 CLP2 "CLP protease proteolytic subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5380 BA_5380 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0325 CHY_0325 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0185 CJE_0185 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TAIR|locus:2033344 CLPP3 "CLP protease proteolytic subunit 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6G7 clpP [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TAIR|locus:2163538 CLPP4 "CLP protease P4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178282 NCLPP7 "nuclear-encoded CLP protease P7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!
3rd Layer3.4.21.92LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd07017171 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) 6e-36
pfam00574182 pfam00574, CLP_protease, Clp protease 7e-26
PRK12552222 PRK12552, PRK12552, ATP-dependent Clp protease-lik 1e-25
COG0740200 COG0740, ClpP, Protease subunit of ATP-dependent C 8e-25
PRK12553207 PRK12553, PRK12553, ATP-dependent Clp protease pro 1e-21
PRK00277200 PRK00277, clpP, ATP-dependent Clp protease proteol 3e-20
TIGR00493192 TIGR00493, clpP, ATP-dependent Clp endopeptidase, 2e-18
CHL00028200 CHL00028, clpP, ATP-dependent Clp protease proteol 4e-15
PRK12551196 PRK12551, PRK12551, ATP-dependent Clp protease pro 3e-14
PRK14513201 PRK14513, PRK14513, ATP-dependent Clp protease pro 2e-13
cd07013162 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is 5e-12
PRK14514221 PRK14514, PRK14514, ATP-dependent Clp protease pro 7e-12
PRK14512197 PRK14512, PRK14512, ATP-dependent Clp protease pro 1e-09
cd07016160 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) 2e-06
cd00394161 cd00394, Clp_protease_like, Caseinolytic protease 1e-05
>gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information 
 Score =  121 bits (306), Expect = 6e-36
 Identities = 46/110 (41%), Positives = 64/110 (58%), Gaps = 1/110 (0%)

Query: 1   MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
           M Y K  V T+  G+A    A+LL+ G KG R   PNS   ++ P+ G + G  +D+  +
Sbjct: 63  MQYIKPPVSTICLGLAASMGALLLAAGTKGKRYALPNSRIMIHQPLGG-AGGQASDIEIQ 121

Query: 61  AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKI 110
           AK++        E+LAK TG+P E+I KD  R +YM A+EA  YGL DKI
Sbjct: 122 AKEILRLRRRLNEILAKHTGQPLEKIEKDTDRDRYMSAEEAKEYGLIDKI 171

Clp protease (caseinolytic protease; ClpP; Peptidase S14) is a highly conserved serine protease present throughout in bacteria and eukaryota, but seems to be absent in archaea, mollicutes and some fungi. Clp proteases are involved in a number of cellular processes such as degradation of misfolded proteins, regulation of short-lived proteins and housekeeping removal of dysfunctional proteins. They are also implicated in the control of cell growth, targeting DNA-binding protein from starved cells. ClpP has also been linked to the tight regulation of virulence genes in the pathogens Listeria monocytogenes and Salmonella typhimurium. This enzyme belong to the family of ATP-dependent proteases; the functional Clp protease is comprised of two components: a proteolytic component and one of several regulatory ATPase components, both of which are required for effective levels of protease activity in the presence of ATP, although the proteolytic subunit alone does possess some catalytic activity. Active site consists of the triad Ser, His and Asp; some members have lost all of these active site residues and are therefore inactive, while others may have one or two large insertions. ClpP seems to prefer hydrophobic or non-polar residues at P1 or P1' positions in its substrate. The protease exists as a tetradecamer made up of two heptameric rings stacked back-to-back such that the catalytic triad of each subunit is located at the interface between three monomers, thus making oligomerization essential for function. Length = 171
>gnl|CDD|201316 pfam00574, CLP_protease, Clp protease Back     alignment and domain information
>gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP Back     alignment and domain information
>gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 100.0
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 100.0
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 100.0
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 100.0
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 100.0
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 99.98
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 99.98
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 99.98
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 99.97
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.9
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 99.87
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.84
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.69
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.65
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.42
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.16
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.13
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.04
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.0
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 98.83
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 98.62
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 98.56
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.09
PRK08258277 enoyl-CoA hydratase; Provisional 97.83
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 97.83
PRK05869222 enoyl-CoA hydratase; Validated 97.8
PRK06495257 enoyl-CoA hydratase; Provisional 97.79
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 97.78
PRK06563255 enoyl-CoA hydratase; Provisional 97.77
PRK06213229 enoyl-CoA hydratase; Provisional 97.74
PRK11778330 putative inner membrane peptidase; Provisional 97.72
PRK08139266 enoyl-CoA hydratase; Validated 97.7
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 97.7
PRK06494259 enoyl-CoA hydratase; Provisional 97.69
PRK06210272 enoyl-CoA hydratase; Provisional 97.66
PRK08150255 enoyl-CoA hydratase; Provisional 97.66
PRK07511260 enoyl-CoA hydratase; Provisional 97.64
PRK09245266 enoyl-CoA hydratase; Provisional 97.63
PRK06143256 enoyl-CoA hydratase; Provisional 97.62
PRK07799263 enoyl-CoA hydratase; Provisional 97.61
PRK03580261 carnitinyl-CoA dehydratase; Provisional 97.6
PRK06688259 enoyl-CoA hydratase; Provisional 97.6
PRK05981266 enoyl-CoA hydratase; Provisional 97.59
PRK08260296 enoyl-CoA hydratase; Provisional 97.59
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 97.59
PRK05862257 enoyl-CoA hydratase; Provisional 97.59
PRK07938249 enoyl-CoA hydratase; Provisional 97.58
PRK10949618 protease 4; Provisional 97.58
PRK06023251 enoyl-CoA hydratase; Provisional 97.57
PRK06127269 enoyl-CoA hydratase; Provisional 97.56
PLN02888265 enoyl-CoA hydratase 97.53
PRK06144262 enoyl-CoA hydratase; Provisional 97.53
PRK06142272 enoyl-CoA hydratase; Provisional 97.53
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 97.53
PRK05980260 enoyl-CoA hydratase; Provisional 97.52
PRK12478298 enoyl-CoA hydratase; Provisional 97.52
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 97.51
PLN02921327 naphthoate synthase 97.51
PRK05995262 enoyl-CoA hydratase; Provisional 97.5
PRK08138261 enoyl-CoA hydratase; Provisional 97.5
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 97.49
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 97.48
PRK09076258 enoyl-CoA hydratase; Provisional 97.48
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 97.48
PRK08259254 enoyl-CoA hydratase; Provisional 97.47
PRK07260255 enoyl-CoA hydratase; Provisional 97.46
PRK06190258 enoyl-CoA hydratase; Provisional 97.46
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 97.45
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 97.45
PRK08140262 enoyl-CoA hydratase; Provisional 97.45
PRK07468262 enoyl-CoA hydratase; Provisional 97.44
PRK07657260 enoyl-CoA hydratase; Provisional 97.43
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 97.43
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 97.41
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 97.39
PRK08290288 enoyl-CoA hydratase; Provisional 97.39
PRK08252254 enoyl-CoA hydratase; Provisional 97.39
PRK07658257 enoyl-CoA hydratase; Provisional 97.39
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 97.38
PRK07327268 enoyl-CoA hydratase; Provisional 97.36
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 97.36
PLN02600251 enoyl-CoA hydratase 97.36
PRK08788287 enoyl-CoA hydratase; Validated 97.36
PRK07659260 enoyl-CoA hydratase; Provisional 97.33
PRK07509262 enoyl-CoA hydratase; Provisional 97.32
PRK05864276 enoyl-CoA hydratase; Provisional 97.28
PRK08272302 enoyl-CoA hydratase; Provisional 97.24
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 97.2
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 97.2
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 97.2
PRK08321302 naphthoate synthase; Validated 97.16
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 97.13
PRK06072248 enoyl-CoA hydratase; Provisional 97.12
PRK07854243 enoyl-CoA hydratase; Provisional 97.12
PRK05870249 enoyl-CoA hydratase; Provisional 97.07
PLN02267239 enoyl-CoA hydratase/isomerase family protein 97.01
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 96.89
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 96.88
TIGR03200 360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 96.87
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 96.8
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 96.77
PRK07827260 enoyl-CoA hydratase; Provisional 96.69
PRK11730 715 fadB multifunctional fatty acid oxidation complex 96.63
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 96.6
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 96.53
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 96.51
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 96.35
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 96.32
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 96.31
PRK05617 342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 96.28
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 96.24
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 96.13
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 96.1
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 95.95
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 95.8
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 95.75
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 95.36
PRK10949 618 protease 4; Provisional 95.27
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 95.25
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 95.15
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 94.57
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 94.21
COG3904245 Predicted periplasmic protein [Function unknown] 93.5
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 90.8
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 89.69
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 88.89
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 87.59
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 85.45
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-42  Score=269.22  Aligned_cols=116  Identities=35%  Similarity=0.500  Sum_probs=112.7

Q ss_pred             CccccCceEEEehhhhHHHHHHHHhcCCCCceeecccCeeeeecCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhcC
Q 032040            1 MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTG   80 (148)
Q Consensus         1 m~~i~~~V~T~~~G~AaS~AslIl~aG~~~~R~a~pna~iMIH~p~~~~~~G~~~dl~~~a~~l~~~~~~l~~iya~~Tg   80 (148)
                      |+|+++||+|+|+|+|||||++|++||++++|+++|||++|||||+ |+.+|+++|++++++++.+++..+.++|+++||
T Consensus        81 m~~ik~~V~ti~~G~AaSmgs~l~~aG~~g~r~~lPnsrimIHqP~-gg~~G~a~Di~i~A~ei~~~~~~l~~i~a~~TG  159 (200)
T COG0740          81 MQFIKPPVSTICMGQAASMGSVLLMAGDKGKRFALPNARIMIHQPS-GGAQGQASDIEIHAREILKIKERLNRIYAEHTG  159 (200)
T ss_pred             HHhcCCCeEEEEecHHHhHHHHHHhcCCCCCceeCCCceEEEecCC-ccCccCHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            6899999999999999999999999999999999999999999999 889999999999999999999999999999999


Q ss_pred             CCHHHHHHhhcCCCcccHHHHHHcCCceeeecCchhh
Q 032040           81 KPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQDAA  117 (148)
Q Consensus        81 ~~~e~i~~~m~rd~~lta~EA~eyGlID~Ii~~~~~~  117 (148)
                      ++.++|.++|+||+||||+||++|||||+|++.....
T Consensus       160 q~~e~i~~d~drd~~msa~eA~~yGLiD~V~~~~~~~  196 (200)
T COG0740         160 QTLEKIEKDTDRDTWMSAEEAKEYGLIDKVIESREAA  196 (200)
T ss_pred             CCHHHHHHhhcccccCCHHHHHHcCCcceeccccccc
Confidence            9999999999999999999999999999999876543

>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>COG3904 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3mt6_R207 Structure Of Clpp From Escherichia Coli In Complex 3e-13
1tyf_A193 The Structure Of Clpp At 2.3 Angstrom Resolution Su 3e-13
1yg8_A193 The Structure Of A V6a Variant Of Clpp. Length = 19 3e-13
3tt6_A196 Structure Of Clpp From Bacillus Subtilis In Compres 4e-13
3kti_A199 Structure Of Clpp In Complex With Adep1 Length = 19 4e-13
3tt7_A197 Structure Of Clpp From Bacillus Subtilis In Complex 4e-13
3ktg_A199 Structure Of Clpp From Bacillus Subtilis In Monocli 4e-13
3hln_A193 Crystal Structure Of Clpp A153c Mutant With Inter-H 1e-12
3p2l_A201 Crystal Structure Of Atp-Dependent Clp Protease Sub 2e-11
2zl3_A196 Crystal Structure Of H.Pylori Clpp S99a Length = 19 3e-11
2zl0_A196 Crystal Structure Of H.Pylori Clpp Length = 196 3e-11
3v5i_A203 The Crystal Structure Of The Mutant Clpp S98a (Stap 7e-11
3st9_A197 Crystal Structure Of Clpp In Heptameric Form From S 8e-11
3qwd_A203 Crystal Structure Of Clpp From Staphylococcus Aureu 8e-11
4hnk_A219 Crystal Structure Of An Enzyme Length = 219 5e-10
4gm2_A205 The Crystal Structure Of A Peptidase From Plasmodiu 6e-10
2f6i_A215 Crystal Structure Of The Clpp Protease Catalytic Do 1e-08
2c8t_A206 The 3.0 A Resolution Structure Of Caseinolytic Clp 2e-08
2ce3_A200 Crystal Structure Of The Atp-Dependent Clp Protease 2e-08
2cby_A208 Crystal Structure Of The Atp-Dependent Clp Protease 2e-08
3q7h_A195 Structure Of The Clpp Subunit Of The Atp-Dependent 6e-08
1tg6_A277 Crystallography And Mutagenesis Point To An Essenti 3e-06
1y7o_A218 The Structure Of Streptococcus Pneumoniae A153p Clp 5e-06
>pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 Back     alignment and structure 
Iteration: 1

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 62/115 (53%), Gaps = 1/115 (0%)
Query: 1   MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
           M + K  V T+  G A    A LL+ GAKG R   PNS   ++ P+ G   G  TD+   
Sbjct: 94  MQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPL-GGYQGQATDIEIH 152
Query: 61  AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQD 115
           A+++        EL+A  TG+  E+I +D +R +++ A EA+ YGL D I+  ++
Sbjct: 153 AREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN 207
>pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 Back     alignment and structure
>pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 Back     alignment and structure
>pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 Back     alignment and structure
>pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 Back     alignment and structure
>pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 Back     alignment and structure
>pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 Back     alignment and structure
>pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 Back     alignment and structure
>pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 Back     alignment and structure
>pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 Back     alignment and structure
>pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 Back     alignment and structure
>pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 Back     alignment and structure
>pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 Back     alignment and structure
>pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 Back     alignment and structure
>pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme Length = 219 Back     alignment and structure
>pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium Falciparum Length = 205 Back     alignment and structure
>pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 Back     alignment and structure
>pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 Back     alignment and structure
>pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 Back     alignment and structure
>pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 Back     alignment and structure
>pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 Back     alignment and structure
>pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 3e-23
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 1e-22
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 1e-22
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 3e-22
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 2e-21
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 6e-21
2f6i_A215 ATP-dependent CLP protease, putative; structural g 1e-20
3viv_A230 441AA long hypothetical NFED protein; protein-pept 2e-09
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 Back     alignment and structure
 Score = 89.1 bits (222), Expect = 3e-23
 Identities = 40/115 (34%), Positives = 62/115 (53%), Gaps = 1/115 (0%)

Query: 1   MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
           M + K  V T+  G A    A LL+ GAKG R   PNS   ++ P+ G   G  TD+   
Sbjct: 80  MQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPL-GGYQGQATDIEIH 138

Query: 61  AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQD 115
           A+++        EL+A  TG+  E+I +D +R +++ A EA+ YGL D I+  ++
Sbjct: 139 AREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN 193
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 100.0
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 100.0
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 100.0
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 99.97
2f6i_A215 ATP-dependent CLP protease, putative; structural g 99.97
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 99.96
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 99.95
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.95
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.81
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 99.38
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.17
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 98.96
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 97.73
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 97.67
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 97.67
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 97.65
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 97.65
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 97.64
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 97.63
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 97.63
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 97.61
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 97.61
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 97.6
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 97.6
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 97.6
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 97.59
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 97.59
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 97.59
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 97.59
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 97.58
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 97.58
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 97.57
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 97.55
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 97.55
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 97.54
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 97.54
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 97.53
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 97.52
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 97.52
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 97.51
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 97.51
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 97.51
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 97.5
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 97.5
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 97.5
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 97.49
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 97.47
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 97.47
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 97.47
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 97.47
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 97.46
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 97.46
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 97.44
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 97.42
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 97.41
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 97.39
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 97.39
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 97.38
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 97.37
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 97.37
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 97.37
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 97.36
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 97.36
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 97.36
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 97.34
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 97.33
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 97.33
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 97.29
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 97.29
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 97.29
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 97.23
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 97.22
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 97.22
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 97.21
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 97.2
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 97.19
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 97.18
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 97.1
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 97.05
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 97.04
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 97.03
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 96.92
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 96.92
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 96.75
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 96.73
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 96.58
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 96.57
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 96.55
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 96.46
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 96.34
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 95.86
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 94.34
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 94.04
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 93.17
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 92.82
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 91.83
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 87.76
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 86.7
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 83.48
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 83.34
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
Probab=100.00  E-value=1.3e-39  Score=257.38  Aligned_cols=112  Identities=34%  Similarity=0.454  Sum_probs=108.9

Q ss_pred             CccccCceEEEehhhhHHHHHHHHhcCCCCceeecccCeeeeecCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 032040            1 MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRS-SGPVTDMWRKAKDLEANAESYIELLAKGT   79 (148)
Q Consensus         1 m~~i~~~V~T~~~G~AaS~AslIl~aG~~~~R~a~pna~iMIH~p~~~~~-~G~~~dl~~~a~~l~~~~~~l~~iya~~T   79 (148)
                      |+++++||+|+|+|+|+|||++||++|++++|+++|||++|||||+ ++. +|++.|+++++++|+++++.+.++|+++|
T Consensus        92 m~~~~~~V~t~~~G~AaS~as~il~aG~~gkR~~lP~a~iMIHqP~-~~~~~G~a~di~i~a~el~~~~~~i~~iya~~T  170 (205)
T 4gm2_A           92 INYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSY-SIIPFNQATNIEIQNKEIMNTKKKVIEIISKNT  170 (205)
T ss_dssp             HHHSSSCEEEEEEEEEETHHHHHHTTSCTTCEEECTTCEEEECCCC-CCCCSSCCSCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHhcCCCEEEEEEeeehhHHHHHHhcCCCCCEEecCCCEEEEecCc-ccccccCHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6789999999999999999999999999999999999999999999 667 99999999999999999999999999999


Q ss_pred             CCCHHHHHHhhcCCCcccHHHHHHcCCceeeecC
Q 032040           80 GKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDS  113 (148)
Q Consensus        80 g~~~e~i~~~m~rd~~lta~EA~eyGlID~Ii~~  113 (148)
                      |++.++|.++|+||+||||+||++|||||+|+++
T Consensus       171 G~~~e~I~~~m~rd~~msa~EA~eyGlID~V~~~  204 (205)
T 4gm2_A          171 EKDTNVISNVLERDKYFNADEAVDFKLIDHILEK  204 (205)
T ss_dssp             TCCHHHHHHHTTSCEEEEHHHHHHTTSCSEECCC
T ss_pred             CCCHHHHHHHhcCCcccCHHHHHHcCCccEeecC
Confidence            9999999999999999999999999999999875
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1yg6a1183 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es 1e-30
d1tg6a1193 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum 2e-25
d2cbya1179 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My 2e-21
d2f6ia1190 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {P 2e-20
d1y7oa1192 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str 3e-20
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Escherichia coli [TaxId: 562]

 Score =  106 bits (266), Expect = 1e-30
 Identities = 40/115 (34%), Positives = 62/115 (53%), Gaps = 1/115 (0%)

Query: 1   MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRK 60
           M + K  V T+  G A    A LL+ GAKG R   PNS   ++ P+ G   G  TD+   
Sbjct: 70  MQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGG-YQGQATDIEIH 128

Query: 61  AKDLEANAESYIELLAKGTGKPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQD 115
           A+++        EL+A  TG+  E+I +D +R +++ A EA+ YGL D I+  ++
Sbjct: 129 AREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN 183
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Length = 190 Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 100.0
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 100.0
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 100.0
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 100.0
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 97.9
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 97.75
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 97.64
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 97.64
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 97.58
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 97.57
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 97.5
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 97.47
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 97.43
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 97.4
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 97.27
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 97.23
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 96.99
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 96.93
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 95.84
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 92.64
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 92.42
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 88.93
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 80.42
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=100.00  E-value=4.1e-38  Score=244.24  Aligned_cols=113  Identities=27%  Similarity=0.417  Sum_probs=109.9

Q ss_pred             CccccCceEEEehhhhHHHHHHHHhcCCCCceeecccCeeeeecCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhcC
Q 032040            1 MAYCKSKVYTVNCGMAYGQAAMLLSVGAKGYRGLQPNSSTKLYLPVVGRSSGPVTDMWRKAKDLEANAESYIELLAKGTG   80 (148)
Q Consensus         1 m~~i~~~V~T~~~G~AaS~AslIl~aG~~~~R~a~pna~iMIH~p~~~~~~G~~~dl~~~a~~l~~~~~~l~~iya~~Tg   80 (148)
                      |+++++||+|+|+|+|+|||++|+++|++++|+++|||++|||||+ ++++|++.|++.++++++++++.+.++|+++||
T Consensus        80 i~~~~~~V~tv~~G~aaS~a~~il~aG~~g~R~~~pns~~miHq~~-~~~~G~~~di~~~~~el~~~~~~i~~i~a~~Tg  158 (193)
T d1tg6a1          80 MQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPS-GGARGQATDIAIQAEEIMKLKKQLYNIYAKHTK  158 (193)
T ss_dssp             HHHSCSCEEEEEEEEEETHHHHHHHTSCTTCEEECTTCEEEECCCC-CCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHhhcCceEEEEccchHHHHHHHhhcCccCccccCcccHHHhcCCc-cCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            5789999999999999999999999999999999999999999999 779999999999999999999999999999999


Q ss_pred             CCHHHHHHhhcCCCcccHHHHHHcCCceeeecCc
Q 032040           81 KPKEEIAKDIQRPKYMQAKEAIVYGLADKIIDSQ  114 (148)
Q Consensus        81 ~~~e~i~~~m~rd~~lta~EA~eyGlID~Ii~~~  114 (148)
                      ++.++|+++|++|+||||+||++|||||+|++.+
T Consensus       159 ~~~~~i~~~~~rD~~lta~EAl~yGliD~Ii~~~  192 (193)
T d1tg6a1         159 QSLQVIESAMERDRYMSPMEAQEFGILDKVLVHP  192 (193)
T ss_dssp             CCHHHHHHHHSSCEEECHHHHHHHTSCSEECSSC
T ss_pred             CCHHHHHHHhccCccCCHHHHHHcCCCCEEccCC
Confidence            9999999999999999999999999999999865
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure