Citrus Sinensis ID: 032042

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIFF
cccccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHccccEEEEcccccccccHHHcccccccccc
cccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEccccccHHccHHHcccccccccccHHHccHHHHHHHcccccHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHccccEEEEccccccHHHHHHHHcEEEEEEc
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVvpegglekgeqqlwedsgspliplaefseptimkkygakpdpetlDIVNTVARQKQIVVVMKIFWGDPREKICEAIDkiplsclvignrglgklkrldfINIELLIFF
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNrglgklkrldfinieLLIFF
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIFF
******VGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEK****LW******LIPLAEF****IMKKY******ETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIF*
**GTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIFF
********VAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIFF
***TRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIFF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
255556366164 conserved hypothetical protein [Ricinus 0.918 0.829 0.816 1e-61
225431940165 PREDICTED: universal stress protein A-li 0.918 0.824 0.786 1e-57
224111960164 predicted protein [Populus trichocarpa] 0.918 0.829 0.764 3e-57
284520976164 universal stress protein [Jatropha curca 0.918 0.829 0.764 8e-57
449432916164 PREDICTED: uncharacterized protein C167. 0.918 0.829 0.720 8e-53
119720802163 unknown [Brassica rapa] 0.898 0.815 0.729 1e-51
297834602163 universal stress protein family protein 0.912 0.828 0.696 4e-51
18401345163 universal stress protein (USP) family pr 0.912 0.828 0.696 6e-51
115462209167 Os05g0157200 [Oryza sativa Japonica Grou 0.898 0.796 0.691 5e-49
218196134169 hypothetical protein OsI_18538 [Oryza sa 0.898 0.786 0.691 9e-49
>gi|255556366|ref|XP_002519217.1| conserved hypothetical protein [Ricinus communis] gi|223541532|gb|EEF43081.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/136 (81%), Positives = 125/136 (91%)

Query: 1   MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSP 60
           M+G RRVGVAVDFS CSKKAL+WA DN+VRNGDHLIL+T++P+G  E+GE QLWE +GSP
Sbjct: 1   MEGERRVGVAVDFSTCSKKALKWAVDNLVRNGDHLILITILPDGYYEEGEMQLWEVTGSP 60

Query: 61  LIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIP 120
           LIPL EFS+P +MKKYG KPDPETLDIVNTVA QKQIVVVMKI+WGDPREKICEAIDKIP
Sbjct: 61  LIPLHEFSDPAVMKKYGVKPDPETLDIVNTVANQKQIVVVMKIYWGDPREKICEAIDKIP 120

Query: 121 LSCLVIGNRGLGKLKR 136
           LSCL+IGNRGLGK+KR
Sbjct: 121 LSCLIIGNRGLGKIKR 136

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431940|ref|XP_002277653.1| PREDICTED: universal stress protein A-like protein isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111960|ref|XP_002316036.1| predicted protein [Populus trichocarpa] gi|118488605|gb|ABK96115.1| unknown [Populus trichocarpa] gi|222865076|gb|EEF02207.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|284520976|gb|ADB93063.1| universal stress protein [Jatropha curcas] Back     alignment and taxonomy information
>gi|449432916|ref|XP_004134244.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus] gi|449503863|ref|XP_004162211.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|119720802|gb|ABL97971.1| unknown [Brassica rapa] Back     alignment and taxonomy information
>gi|297834602|ref|XP_002885183.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297331023|gb|EFH61442.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18401345|ref|NP_566564.1| universal stress protein (USP) family protein [Arabidopsis thaliana] gi|14190421|gb|AAK55691.1|AF378888_1 AT3g17020/K14A17_14 [Arabidopsis thaliana] gi|7670026|dbj|BAA94980.1| unnamed protein product [Arabidopsis thaliana] gi|15215899|gb|AAK91493.1| AT3g17020/K14A17_14 [Arabidopsis thaliana] gi|332642374|gb|AEE75895.1| universal stress protein (USP) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115462209|ref|NP_001054704.1| Os05g0157200 [Oryza sativa Japonica Group] gi|45267868|gb|AAS55767.1| unknown protein [Oryza sativa Japonica Group] gi|113578255|dbj|BAF16618.1| Os05g0157200 [Oryza sativa Japonica Group] gi|215686820|dbj|BAG89670.1| unnamed protein product [Oryza sativa Japonica Group] gi|222630265|gb|EEE62397.1| hypothetical protein OsJ_17188 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218196134|gb|EEC78561.1| hypothetical protein OsI_18538 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.912 0.828 0.696 2.3e-48
TAIR|locus:2097755201 AT3G03270 [Arabidopsis thalian 0.986 0.726 0.455 1.2e-33
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.918 0.85 0.467 3.3e-31
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.837 0.607 0.307 8.4e-10
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.885 0.541 0.272 1.3e-09
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.871 0.754 0.272 2.2e-09
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.891 0.584 0.311 3.5e-09
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.837 0.512 0.318 4.9e-09
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.837 0.476 0.321 6.4e-09
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.831 0.768 0.288 3.8e-07
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 505 (182.8 bits), Expect = 2.3e-48, P = 2.3e-48
 Identities = 94/135 (69%), Positives = 110/135 (81%)

Query:     3 GTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLI 62
             G RR+GVAVDFS CSKKAL WA DNVVR+GDHLIL+T+  +   E+GE QLWE  GSP I
Sbjct:     5 GGRRIGVAVDFSDCSKKALSWAIDNVVRDGDHLILITIAHDMNYEEGEMQLWETVGSPFI 64

Query:    63 PLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLS 122
             P++EFS+  +MKKY  KPD ETLDIVNT AR+K I VVMKI+WGDPREKIC A ++IPLS
Sbjct:    65 PMSEFSDAAVMKKYALKPDAETLDIVNTAARKKTITVVMKIYWGDPREKICAAAEQIPLS 124

Query:   123 CLVIGNRGLGKLKRL 137
              LV+GNRGLG LKR+
Sbjct:   125 SLVMGNRGLGGLKRM 139
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0009409 "response to cold" evidence=IEP
GO:0005886 "plasma membrane" evidence=IDA
GO:0002238 "response to molecule of fungal origin" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2097755 AT3G03270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 7e-17
pfam00582139 pfam00582, Usp, Universal stress protein family 5e-14
COG0589154 COG0589, UspA, Universal stress protein UspA and r 3e-06
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 71.2 bits (175), Expect = 7e-17
 Identities = 37/132 (28%), Positives = 57/132 (43%), Gaps = 22/132 (16%)

Query: 6   RVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLA 65
           R+ VAVD S  S++AL+WAA    R G  L+L+ VV               S + L  L 
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDP----------PPSSAAELAELL 50

Query: 66  EFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLV 125
           E     +++                   +  + V   +  GDP E I EA +++    +V
Sbjct: 51  EEEARALLEALREA------------LAEAGVKVETVVLEGDPAEAILEAAEELGADLIV 98

Query: 126 IGNRGLGKLKRL 137
           +G+RG   L+RL
Sbjct: 99  MGSRGRSGLRRL 110

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
PRK15456142 universal stress protein UspG; Provisional 99.93
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.92
PRK15005144 universal stress protein F; Provisional 99.91
PRK09982142 universal stress protein UspD; Provisional 99.91
PRK15118144 universal stress global response regulator UspA; P 99.88
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.86
PRK11175 305 universal stress protein UspE; Provisional 99.86
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.86
PRK10116142 universal stress protein UspC; Provisional 99.86
cd01987124 USP_OKCHK USP domain is located between the N-term 99.85
cd00293130 USP_Like Usp: Universal stress protein family. The 99.79
PRK11175305 universal stress protein UspE; Provisional 99.78
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.78
COG0589154 UspA Universal stress protein UspA and related nuc 99.74
PRK10490 895 sensor protein KdpD; Provisional 99.31
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.18
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.04
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.48
PLN03159832 cation/H(+) antiporter 15; Provisional 97.25
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.25
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 97.02
PRK03359 256 putative electron transfer flavoprotein FixA; Revi 96.87
PRK12342 254 hypothetical protein; Provisional 96.76
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 96.16
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 95.94
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 95.81
PLN03159 832 cation/H(+) antiporter 15; Provisional 95.75
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 95.2
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 95.03
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 94.92
PRK13820 394 argininosuccinate synthase; Provisional 93.73
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 93.6
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.58
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 93.52
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 93.32
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 92.92
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 92.87
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 92.69
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 91.42
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 91.41
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 90.82
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 90.62
cd01713173 PAPS_reductase This domain is found in phosphoaden 90.42
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 90.09
PLN00200 404 argininosuccinate synthase; Provisional 89.61
PRK10867 433 signal recognition particle protein; Provisional 89.53
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 89.29
PLN02331 207 phosphoribosylglycinamide formyltransferase 88.84
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 88.65
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 88.2
TIGR00959 428 ffh signal recognition particle protein. This mode 87.33
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 87.28
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 86.79
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) 86.62
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 86.61
cd0336479 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The top 85.75
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 85.47
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 85.13
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 84.91
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 84.84
COG1058 255 CinA Predicted nucleotide-utilizing enzyme related 84.7
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 84.32
PF1366281 Toprim_4: Toprim domain; PDB: 1EQN_E 1DD9_A 3B39_B 83.63
PF12683 275 DUF3798: Protein of unknown function (DUF3798); In 83.56
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 83.38
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 83.0
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 82.94
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 82.6
cd01995169 ExsB ExsB is a transcription regulator related pro 81.43
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 80.63
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 80.61
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.93  E-value=2.7e-25  Score=142.05  Aligned_cols=128  Identities=15%  Similarity=0.132  Sum_probs=96.3

Q ss_pred             ccEEEEEecCCH--hHHHHHHHHHhhcccCCCEEEEEEEecCCCCCccccccccCCCCCCcCCCCCchhHHHHhhcCCCC
Q 032042            4 TRRVGVAVDFSA--CSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPD   81 (148)
Q Consensus         4 ~~~ILv~~d~s~--~s~~al~~a~~la~~~~~~v~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (148)
                      |++||+|+|+|+  .+.+++++|..+|+.. ++++++||+++.....     .   ...   ..   +.+...+...+..
T Consensus         2 ~~~ILv~vD~S~~~~s~~al~~A~~la~~~-~~l~llhv~~~~~~~~-----~---~~~---~~---~~~~~~~~~~~~~   66 (142)
T PRK15456          2 YKTIIMPVDVFEMELSDKAVRHAEFLAQDD-GVIHLLHVLPGSASLS-----L---HRF---AA---DVRRFEEHLQHEA   66 (142)
T ss_pred             CccEEEeccCCchhHHHHHHHHHHHHHhcC-CeEEEEEEecCccccc-----c---ccc---cc---chhhHHHHHHHHH
Confidence            699999999994  8999999999999874 6999999998653211     0   000   00   0012333333344


Q ss_pred             hhhHHHHHHHhhhcCceEEEEEeeCChhHHHHHHHhhcCCcEEEEEecCCCccceeeccccccccc
Q 032042           82 PETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIF  147 (148)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~Gs~a~~vl  147 (148)
                      ++.++.+.+.+...+++++.++..|+|.+.|++++++.++||||||++|++ +.+.++|||+++|+
T Consensus        67 ~~~l~~~~~~~~~~~~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~  131 (142)
T PRK15456         67 EERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVI  131 (142)
T ss_pred             HHHHHHHHHHhCCCCcceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHH
Confidence            555666665554457788888989999999999999999999999999987 78899999999885

>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PLN02331 phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>cd03364 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only] Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PF13662 Toprim_4: Toprim domain; PDB: 1EQN_E 1DD9_A 3B39_B 1DDE_A Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 2e-27
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 8e-20
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 9e-15
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 1e-14
2z08_A137 Universal stress protein family; uncharacterized c 2e-12
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 2e-12
3dlo_A155 Universal stress protein; unknown function, struct 7e-12
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 1e-11
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 2e-11
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 4e-04
3loq_A294 Universal stress protein; structural genomics, PSI 5e-11
3loq_A 294 Universal stress protein; structural genomics, PSI 8e-10
3s3t_A146 Nucleotide-binding protein, universal stress PROT 9e-11
3tnj_A150 Universal stress protein (USP); structural genomic 5e-10
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 3e-09
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 3e-05
3fg9_A156 Protein of universal stress protein USPA family; A 3e-09
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 7e-09
3olq_A 319 Universal stress protein E; structural genomics, P 2e-08
3fdx_A143 Putative filament protein / universal stress PROT; 9e-07
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 8e-06
1q77_A138 Hypothetical protein AQ_178; structural genomics, 1e-04
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score = 99.5 bits (248), Expect = 2e-27
 Identities = 31/145 (21%), Positives = 60/145 (41%), Gaps = 21/145 (14%)

Query: 5   RRVGVAVDFSAC---------SKKALQWAADNVVRNGDH---LILVTVVPEGGLEKGEQQ 52
            +V VAV+ S            K+A +W  + +VR+      ++L+ V      E G   
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV--DEDGFDD 63

Query: 53  LWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKI 112
           +     SP        +   M++         L+       +  +     I  GDP++ I
Sbjct: 64  VDSIYASP-------EDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVI 116

Query: 113 CEAIDKIPLSCLVIGNRGLGKLKRL 137
           C+ + ++    LV+G+RGLG+ +++
Sbjct: 117 CQEVKRVRPDFLVVGSRGLGRFQKV 141
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.94
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.93
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.93
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.93
3fg9_A156 Protein of universal stress protein USPA family; A 99.93
3tnj_A150 Universal stress protein (USP); structural genomic 99.93
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.92
3dlo_A155 Universal stress protein; unknown function, struct 99.92
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.92
2z08_A137 Universal stress protein family; uncharacterized c 99.91
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.9
3olq_A 319 Universal stress protein E; structural genomics, P 99.89
3fdx_A143 Putative filament protein / universal stress PROT; 99.88
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.87
3loq_A 294 Universal stress protein; structural genomics, PSI 99.87
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.85
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.84
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.83
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.82
3loq_A294 Universal stress protein; structural genomics, PSI 99.81
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.81
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.79
3olq_A319 Universal stress protein E; structural genomics, P 99.79
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.71
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 95.47
3kcq_A 215 Phosphoribosylglycinamide formyltransferase; struc 95.45
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 95.34
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 94.75
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 94.37
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 94.11
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 94.04
3p9x_A 211 Phosphoribosylglycinamide formyltransferase; struc 93.74
1efp_B 252 ETF, protein (electron transfer flavoprotein); ele 93.21
1efv_B 255 Electron transfer flavoprotein; electron transport 92.88
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 92.69
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 92.62
1meo_A 209 Phosophoribosylglycinamide formyltransferase; puri 92.34
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 92.16
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 91.82
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 91.1
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 91.06
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 90.6
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 90.56
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 90.49
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 90.23
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 89.83
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 89.68
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 89.66
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 89.28
3tqr_A 215 Phosphoribosylglycinamide formyltransferase; purin 89.27
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 88.98
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 88.78
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 88.35
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 88.33
2ywr_A 216 Phosphoribosylglycinamide formyltransferase; rossm 88.23
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 88.19
1jkx_A 212 GART;, phosphoribosylglycinamide formyltransferase 88.0
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 87.53
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 87.41
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 87.36
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 87.09
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 87.03
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 86.95
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 86.94
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 86.76
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 86.58
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 86.56
3q0i_A 318 Methionyl-tRNA formyltransferase; structural genom 86.38
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 86.26
2l69_A134 Rossmann 2X3 fold protein; structural genomics, no 85.24
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 84.51
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 84.1
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 83.59
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 83.4
3av3_A 212 Phosphoribosylglycinamide formyltransferase; struc 81.97
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 81.71
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 81.68
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 80.99
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 80.74
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 80.6
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.94  E-value=1.5e-26  Score=147.12  Aligned_cols=131  Identities=17%  Similarity=0.187  Sum_probs=107.7

Q ss_pred             CCccEEEEEecCCHhHHHHHHHHHhhcccCCCEEEEEEEecCCCCCccccccccCCCCCCcCCCCCchhHHHHhhcCCCC
Q 032042            2 DGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPD   81 (148)
Q Consensus         2 ~~~~~ILv~~d~s~~s~~al~~a~~la~~~~~~v~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (148)
                      |++++||||+|+|+.+..++++|+.+|+..+++++++||.++......          ...+     ..+...+...+..
T Consensus         3 ~~~~~ILv~~D~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~----------~~~~-----~~~~~~~~~~~~~   67 (146)
T 3s3t_A            3 ARYTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTP----------ALDP-----VLSELLDAEAAHA   67 (146)
T ss_dssp             CCCCEEEEECCSSHHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCCG----------GGHH-----HHHHHHHHHHHHH
T ss_pred             CccceEEEEcCCCHHHHHHHHHHHHHHHhcCCEEEEEEEecCcccccc----------cccc-----ccHHHHHHHHHHH
Confidence            458999999999999999999999999999999999999987643210          0000     1112333333455


Q ss_pred             hhhHHHHHHHhhhcCc-eEEEEEeeCChhHHHHH-HHhhcCCcEEEEEecCCCccceeeccccccccc
Q 032042           82 PETLDIVNTVARQKQI-VVVMKIFWGDPREKICE-AIDKIPLSCLVIGNRGLGKLKRLDFINIELLIF  147 (148)
Q Consensus        82 ~~~~~~~~~~~~~~~~-~~~~~~~~g~~~~~I~~-~a~~~~~dliV~g~~~~~~~~~~~~Gs~a~~vl  147 (148)
                      ++.++.+.+.+...|+ +++..+..|++.+.|++ ++++.++||||||+++++.+.++++||++++|+
T Consensus        68 ~~~l~~~~~~~~~~g~~~~~~~~~~g~~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl  135 (146)
T 3s3t_A           68 KDAMRQRQQFVATTSAPNLKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVV  135 (146)
T ss_dssp             HHHHHHHHHHHTTSSCCCCEEEEEEECHHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHH
T ss_pred             HHHHHHHHHHHHhcCCcceEEEEecCChHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHh
Confidence            6778888888888899 89999999999999999 999999999999999999999999999999886
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 8e-16
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 4e-13
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 2e-11
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 9e-11
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 2e-08
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 2e-07
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 68.4 bits (166), Expect = 8e-16
 Identities = 28/142 (19%), Positives = 63/142 (44%), Gaps = 15/142 (10%)

Query: 5   RRVGVAVDFS---------ACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWE 55
            +V VAV+ S            K+A +W  + +VR+      + ++    ++  ++  ++
Sbjct: 2   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLH---VQVVDEDGFD 58

Query: 56  DSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEA 115
           D  S      +F +   M++         L+       +  +     I  GDP++ IC+ 
Sbjct: 59  DVDSIYASPEDFRD---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQE 115

Query: 116 IDKIPLSCLVIGNRGLGKLKRL 137
           + ++    LV+G+RGLG+ +++
Sbjct: 116 VKRVRPDFLVVGSRGLGRFQKV 137
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.96
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.93
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.93
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.93
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.91
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.89
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 96.4
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.14
d1efpb_ 246 Small, beta subunit of electron transfer flavoprot 95.89
d1efvb_ 252 Small, beta subunit of electron transfer flavoprot 94.87
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 94.6
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 93.92
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.96
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.42
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 90.87
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 90.58
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 90.23
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 88.6
d2qy9a2211 GTPase domain of the signal recognition particle r 88.04
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 86.13
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 86.08
d1qzua_181 4'-phosphopantothenoylcysteine decarboxylase (PPC 85.9
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 85.55
d1vmaa2213 GTPase domain of the signal recognition particle r 85.27
d1okkd2207 GTPase domain of the signal recognition particle r 84.55
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 82.51
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.27
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 80.2
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.96  E-value=9.5e-30  Score=163.05  Aligned_cols=143  Identities=17%  Similarity=0.187  Sum_probs=108.0

Q ss_pred             CCccEEEEEecCCHhHHHHHHHHHhhcccCCCEEEEEEEecCCCCCccccccccCCCCCCcCCCCCch--hHHHHhhcCC
Q 032042            2 DGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSE--PTIMKKYGAK   79 (148)
Q Consensus         2 ~~~~~ILv~~d~s~~s~~al~~a~~la~~~~~~v~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~   79 (148)
                      |+|+|||||+|+|+.+++++++|+.+|+..+++++++||.++....... ......+...  .....+  .+.+.+...+
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~-~~~~~~~~~~--~~~~~~~~~~~~~~~~~~   77 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRD-IFSLLLGVAG--LNKSVEEFENELKNKLTE   77 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC--------------------CHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccc-cccccccccc--cchhHHHHHHHHHHHHHH
Confidence            4599999999999999999999999999999999999998875432210 0000000000  011111  1123333344


Q ss_pred             CChhhHHHHHHHhhhcCceEEEEEeeCChhHHHHHHHhhcCCcEEEEEecCCCccceeeccccccccc
Q 032042           80 PDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRLDFINIELLIF  147 (148)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~Gs~a~~vl  147 (148)
                      ..++.++.+.+.+...|++++.++..|+|.+.|++++++.++||||||+++++.++++|+||++++|+
T Consensus        78 ~~~~~l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl  145 (160)
T d1mjha_          78 EAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVI  145 (160)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHH
Confidence            55677777888888889999999999999999999999999999999999999999999999999986
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1qzua_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure