Citrus Sinensis ID: 032065


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MRMKEDDDALQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTSKL
cccccccHHHHHHHHHHHHHccccccccHHHHHHccEEEEEEEccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEEEEccccEEEEEEEEEEEEcc
cccccccHHHHHHHHHHHHHHHHccccccccEEcccEEEEEccccEEEEEEEEcHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEcccccccEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEccc
MRMKEDDDALQASIKMLERtskgvecseleaITFQGIQAVELRTGFLrcyfvipihaadqdgnwhAGAIATLIDGLgaltvnsftgkskasVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGknwmtskl
mrmkedddalQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEieakvvgsrgkltsvlvevkrkgngelialgknwmtskl
MRMKEDDDALQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTSKL
**********************GVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNW*****
***********************VECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTSKL
*********LQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTSKL
*****DDDALQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTSK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRMKEDDDALQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTSKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
P34419169 Putative esterase F42H10. yes no 0.743 0.650 0.288 0.0002
Q9CQR4140 Acyl-coenzyme A thioester yes no 0.648 0.685 0.298 0.0003
>sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 1/111 (0%)

Query: 35  QGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVN-SFTGKSKASVD 93
           + +  VE+    L C  V+     +  G  H G  ATL D + A  V  +   K  ASV+
Sbjct: 42  EDVYPVEVTKSKLVCEMVVQHQHLNSKGTLHGGQTATLTDVITARAVGVTVKDKGMASVE 101

Query: 94  LTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWM 144
           L +S     K+ + +EI A V+     +     E +RK +G++ A GK+ +
Sbjct: 102 LAVSYLLPVKVGDVLEITAHVLKVGRTMAFTDCEFRRKSDGKMSAKGKHTL 152





Caenorhabditis elegans (taxid: 6239)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
225442577153 PREDICTED: acyl-coenzyme A thioesterase 0.952 0.921 0.524 6e-38
297743246 301 unnamed protein product [Vitis vinifera] 0.952 0.468 0.524 9e-38
225442579156 PREDICTED: acyl-coenzyme A thioesterase 0.891 0.846 0.598 5e-37
147828266 847 hypothetical protein VITISV_010506 [Viti 0.891 0.155 0.598 6e-37
255549930156 acyl-CoA thioesterase, putative [Ricinus 0.959 0.910 0.514 3e-34
224070923151 predicted protein [Populus trichocarpa] 0.945 0.927 0.560 7e-31
388506386163 unknown [Lotus japonicus] 0.959 0.871 0.440 3e-27
358248327158 uncharacterized protein LOC100809050 [Gl 0.959 0.898 0.436 4e-27
356522254152 PREDICTED: uncharacterized protein LOC10 0.952 0.927 0.422 9e-24
18401037157 thioredoxin family protein [Arabidopsis 0.932 0.878 0.398 1e-22
>gi|225442577|ref|XP_002284369.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera] gi|147828265|emb|CAN75402.1| hypothetical protein VITISV_010505 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 103/141 (73%)

Query: 6   DDDALQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWH 65
           +DD  + + K +E  S+G     LE +  +G+QA+ ++ G + C  V+P   +D+DGNWH
Sbjct: 2   EDDPPREAQKWIEDLSRGASSHGLETLNLKGLQAIYVQKGLIHCDLVVPDCVSDKDGNWH 61

Query: 66  AGAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVL 125
            GAI+TLID +GA  + SF G  KASVD ++S Y +AKIQEEVEIEAKVVG RG+L+SV+
Sbjct: 62  VGAISTLIDDVGAAAIFSFAGHVKASVDFSVSFYSTAKIQEEVEIEAKVVGHRGRLSSVV 121

Query: 126 VEVKRKGNGELIALGKNWMTS 146
           VE++RK NGELIALG+ WM++
Sbjct: 122 VEIRRKSNGELIALGRQWMSA 142




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297743246|emb|CBI36113.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442579|ref|XP_002279118.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147828266|emb|CAN75403.1| hypothetical protein VITISV_010506 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549930|ref|XP_002516016.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223544921|gb|EEF46436.1| acyl-CoA thioesterase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224070923|ref|XP_002303296.1| predicted protein [Populus trichocarpa] gi|222840728|gb|EEE78275.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388506386|gb|AFK41259.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|358248327|ref|NP_001240118.1| uncharacterized protein LOC100809050 [Glycine max] gi|255641238|gb|ACU20896.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356522254|ref|XP_003529762.1| PREDICTED: uncharacterized protein LOC100805653 [Glycine max] Back     alignment and taxonomy information
>gi|18401037|ref|NP_566538.1| thioredoxin family protein [Arabidopsis thaliana] gi|15450573|gb|AAK96558.1| unknown protein [Arabidopsis thaliana] gi|20466095|gb|AAM19969.1| At3g16179/At3g16179 [Arabidopsis thaliana] gi|332642259|gb|AEE75780.1| thioredoxin family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:505006353157 AT3G16175 "AT3G16175" [Arabido 0.932 0.878 0.398 4.2e-24
TAIR|locus:4515102668138 AT1G52191 "AT1G52191" [Arabido 0.743 0.797 0.428 2.1e-20
TAIR|locus:2043002158 AT2G29590 [Arabidopsis thalian 0.777 0.727 0.356 2.6e-15
TAIR|locus:2018294155 AT1G04290 "AT1G04290" [Arabido 0.763 0.729 0.318 2.5e-10
UNIPROTKB|A6QQ83155 THEM2 "THEM2 protein" [Bos tau 0.716 0.683 0.317 4.2e-08
UNIPROTKB|P34419169 F42H10.6 "Putative esterase F4 0.729 0.639 0.293 7.8e-07
RGD|1306513140 Acot13 "acyl-CoA thioesterase 0.648 0.685 0.288 1.6e-06
MGI|MGI:1914084140 Acot13 "acyl-CoA thioesterase 0.641 0.678 0.316 2.1e-06
UNIPROTKB|Q9NPJ3140 ACOT13 "Acyl-coenzyme A thioes 0.709 0.75 0.296 2.6e-06
UNIPROTKB|F1NW39113 ACOT13 "Uncharacterized protei 0.655 0.858 0.29 3.4e-06
TAIR|locus:505006353 AT3G16175 "AT3G16175" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
 Identities = 55/138 (39%), Positives = 83/138 (60%)

Query:     7 DDALQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHA 66
             D  +  +   LE  +KG   +E E +  +G++ + +  G LRC  ++  H   +DG+W+A
Sbjct:     3 DPTIHNTTTYLEEIAKGNGQTEFEILILKGLELIHVGKGILRCKLLVTDHVVGEDGSWNA 62

Query:    67 GAIATLIDGLGALTVNSFTGKSKASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLV 126
             G I  ++D +GA  V S  G    SVDL  S Y +AKI E VEIEA+V GS G L S ++
Sbjct:    63 GVITAVMDSIGASAVYSSGGGLHISVDLNSSFYSTAKIHETVEIEARVNGSNGGLKSAVI 122

Query:   127 EVKRKGNGELIALGKNWM 144
             E++R+ +GE+IA G+ WM
Sbjct:   123 EIRRETSGEIIATGRLWM 140




GO:0008150 "biological_process" evidence=ND
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=ISS
GO:0047617 "acyl-CoA hydrolase activity" evidence=ISS
TAIR|locus:4515102668 AT1G52191 "AT1G52191" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043002 AT2G29590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018294 AT1G04290 "AT1G04290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQ83 THEM2 "THEM2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P34419 F42H10.6 "Putative esterase F42H10.6" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1306513 Acot13 "acyl-CoA thioesterase 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914084 Acot13 "acyl-CoA thioesterase 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NPJ3 ACOT13 "Acyl-coenzyme A thioesterase 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NW39 ACOT13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034364001
SubName- Full=Putative uncharacterized protein (Chromosome chr9 scaffold_7, whole genome shotgun sequence); (153 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd03443113 cd03443, PaaI_thioesterase, PaaI_thioesterase is a 3e-11
COG2050141 COG2050, PaaI, HGG motif-containing thioesterase, 4e-08
pfam0306179 pfam03061, 4HBT, Thioesterase superfamily 2e-06
cd03440100 cd03440, hot_dog, The hotdog fold was initially id 2e-05
>gnl|CDD|239527 cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
 Score = 56.4 bits (137), Expect = 3e-11
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 36  GIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFTGKSK--ASVD 93
           GI+ VE+  G +     +     +  G  H GAIATL D  G L   S         +VD
Sbjct: 3   GIRVVEVGPGRVVLRLPVRPRHLNPGGIVHGGAIATLADTAGGLAALSALPPGALAVTVD 62

Query: 94  LTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALG 140
           L ++ Y       ++   A+VV    +L  V VEV    +G+L+A  
Sbjct: 63  LNVN-YLRPARGGDLTARARVVKLGRRLAVVEVEV-TDEDGKLVATA 107


Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ). Length = 113

>gnl|CDD|224961 COG2050, PaaI, HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|217345 pfam03061, 4HBT, Thioesterase superfamily Back     alignment and domain information
>gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
PRK10293136 acyl-CoA esterase; Provisional 99.97
PRK10254137 thioesterase; Provisional 99.96
KOG3328148 consensus HGG motif-containing thioesterase [Gener 99.96
PRK11688154 hypothetical protein; Provisional 99.96
PLN02322154 acyl-CoA thioesterase 99.96
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 99.95
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 99.95
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 99.94
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 99.89
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 99.86
PRK10694133 acyl-CoA esterase; Provisional 99.79
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 99.79
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 99.75
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 99.7
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 99.65
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 99.62
PRK04424185 fatty acid biosynthesis transcriptional regulator; 99.56
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 99.51
PLN02647 437 acyl-CoA thioesterase 99.51
COG4109432 Predicted transcriptional regulator containing CBS 99.48
PLN02647437 acyl-CoA thioesterase 99.4
cd03440100 hot_dog The hotdog fold was initially identified i 99.32
KOG4781237 consensus Uncharacterized conserved protein [Funct 99.31
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is 99.12
PF13622 255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 99.08
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 99.0
PF09500144 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In 98.99
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 98.98
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 98.85
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 98.8
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 98.79
COG0824137 FcbC Predicted thioesterase [General function pred 98.7
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 98.67
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 98.64
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 98.64
TIGR00189 271 tesB acyl-CoA thioesterase II. Subunit: homotetram 98.6
KOG2763357 consensus Acyl-CoA thioesterase [Lipid transport a 98.48
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 98.4
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 98.34
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 98.33
PRK10526 286 acyl-CoA thioesterase II; Provisional 98.3
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 98.3
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 98.22
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 98.19
PLN02868 413 acyl-CoA thioesterase family protein 98.17
cd01289138 FabA_like Domain of unknown function, appears to b 98.11
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 98.08
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 98.04
COG5496130 Predicted thioesterase [General function predictio 97.95
cd03444104 Thioesterase_II_repeat1 Thioesterase II (TEII) is 97.94
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 97.93
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 97.92
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 97.91
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 97.9
PLN02370 419 acyl-ACP thioesterase 97.83
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 97.79
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 97.73
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier prote 97.65
TIGR00189271 tesB acyl-CoA thioesterase II. Subunit: homotetram 97.61
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 97.56
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 97.28
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro 97.27
KOG2763 357 consensus Acyl-CoA thioesterase [Lipid transport a 97.23
PF01643 261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 97.22
PF13622255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 97.19
cd03450149 NodN NodN (nodulation factor N) contains a single 97.1
COG1946 289 TesB Acyl-CoA thioesterase [Lipid metabolism] 97.05
PRK10526286 acyl-CoA thioesterase II; Provisional 97.01
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold 96.91
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca 96.89
PF03756132 AfsA: A-factor biosynthesis hotdog domain; InterPr 96.65
PF02551131 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP 96.62
KOG3016 294 consensus Acyl-CoA thioesterase [Lipid transport a 96.62
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 96.58
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 96.51
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 96.29
PLN02864310 enoyl-CoA hydratase 96.21
PLN02868413 acyl-CoA thioesterase family protein 96.19
TIGR01749169 fabA beta-hydroxyacyl-[acyl carrier protein] dehyd 96.1
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 96.05
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 96.02
COG1946289 TesB Acyl-CoA thioesterase [Lipid metabolism] 95.49
PLN02864 310 enoyl-CoA hydratase 94.76
KOG3016294 consensus Acyl-CoA thioesterase [Lipid transport a 93.56
PF14765295 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_ 92.39
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 91.23
PLN02370419 acyl-ACP thioesterase 82.74
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
Probab=99.97  E-value=8.3e-29  Score=174.19  Aligned_cols=110  Identities=15%  Similarity=0.123  Sum_probs=100.8

Q ss_pred             cccEEEEeeCCEEEEEEEccCCCCCCCCcchHHHHHHHHHHHhHHHHHhcc--CCceEEEEEEeeeeecccCCCEEEEEE
Q 032065           35 QGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFT--GKSKASVDLTISLYYSAKIQEEVEIEA  112 (148)
Q Consensus        35 ~g~~~~~~~~g~~~~~~~v~~~~~n~~G~lHGG~la~l~D~~~~~a~~~~~--~~~~vT~~l~i~fl~p~~~g~~l~~~a  112 (148)
                      .|+++.+.++|++++++++.|+|+|++|.+|||++++|+|.+++.++....  +...+|+++++||++|++. +.|.++|
T Consensus        24 LGi~i~~~~~g~~~~~~~v~~~~~n~~G~lHGGv~~tLaD~a~~~a~~~~~~~~~~~vTiel~infl~p~~~-g~l~a~a  102 (136)
T PRK10293         24 LDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSARE-GRVRGVC  102 (136)
T ss_pred             cCcEEEEEeCCEEEEEEEcCHHHcCCcCcccHHHHHHHHHHHHHHHHHhcccCCceEEEEEEEeEEecccCC-ceEEEEE
Confidence            499999999999999999999999999999999999999999988876543  3467899999999999995 4899999


Q ss_pred             EEEeecCcEEEEEEEEEECCCCcEEEEEEEEEEe
Q 032065          113 KVVGSRGKLTSVLVEVKRKGNGELIALGKNWMTS  146 (148)
Q Consensus       113 ~v~~~gr~~~~~~~~i~~~~~g~lvA~a~~t~~~  146 (148)
                      ++++.||+++++++++++ ++|+++|.++.|+.-
T Consensus       103 ~vv~~Gr~~~~~~~~v~d-~~g~l~A~~~~t~~i  135 (136)
T PRK10293        103 KPLHLGSRHQVWQIEIFD-EKGRLCCSSRLTTAI  135 (136)
T ss_pred             EEEecCCCEEEEEEEEEe-CCCCEEEEEEEEEEE
Confidence            999999999999999995 589999999999863



>PRK10254 thioesterase; Provisional Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>KOG4781 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>PF03756 AfsA: A-factor biosynthesis hotdog domain; InterPro: IPR005509 The AfsA family are key enzymes in A-factor biosynthesis, which is essential for streptomycin production and resistance Back     alignment and domain information
>PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH) Back     alignment and domain information
>KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>PF14765 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_D 3KG9_A 3KG8_B 3HRR_A 3HRQ_A 3EL6_A 3KG6_B 2VZ8_A 2VZ9_A Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3f5o_A148 Crystal Structure Of Hthem2(Undecan-2-One-Coa) Comp 1e-04
2h4u_A145 Crystal Structure Of Human Thioesterase Superfamily 2e-04
2cy9_A140 Crystal Structure Of Thioesterase Superfamily Membe 4e-04
>pdb|3F5O|A Chain A, Crystal Structure Of Hthem2(Undecan-2-One-Coa) Complex Length = 148 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 1/107 (0%) Query: 37 IQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTV-NSFTGKSKASVDLT 95 I V G + C + + G H G ATL+D + + + + G SVD+ Sbjct: 28 ITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAPGVSVDMN 87 Query: 96 ISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKN 142 I+ AK+ E++ I A V+ L V++ K G+LIA G++ Sbjct: 88 ITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRH 134
>pdb|2H4U|A Chain A, Crystal Structure Of Human Thioesterase Superfamily Member 2 (Casp Target) Length = 145 Back     alignment and structure
>pdb|2CY9|A Chain A, Crystal Structure Of Thioesterase Superfamily Member2 From Mus Musculus Length = 140 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2h4u_A145 Thioesterase superfamily member 2; structural geno 3e-18
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 4e-18
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 9e-13
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 3e-10
2qwz_A159 Phenylacetic acid degradation-related protein; put 3e-09
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 6e-09
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 2e-08
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 4e-08
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 6e-08
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 1e-07
2pim_A141 Phenylacetic acid degradation-related protein; thi 2e-07
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 2e-07
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 4e-07
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 5e-07
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 6e-07
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 7e-07
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 8e-07
3e1e_A141 Thioesterase family protein; structural genomics, 1e-06
1zki_A133 Hypothetical protein PA5202; structural genomics, 2e-06
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 2e-06
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 4e-06
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 4e-06
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 5e-06
1o0i_A138 Hypothetical protein HI1161; structural genomics, 5e-06
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 4e-04
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Length = 145 Back     alignment and structure
 Score = 74.8 bits (184), Expect = 3e-18
 Identities = 30/108 (27%), Positives = 46/108 (42%), Gaps = 1/108 (0%)

Query: 34  FQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFT-GKSKASV 92
              I  V    G + C   +     +  G  H G  ATL+D +  + +     G    SV
Sbjct: 30  LGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAPGVSV 89

Query: 93  DLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALG 140
           D+ I+    AK+ E++ I A V+     L    V++  K  G+LIA G
Sbjct: 90  DMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQG 137


>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Length = 148 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Length = 163 Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Length = 151 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Length = 159 Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Length = 148 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Length = 142 Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Length = 131 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Length = 158 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Length = 136 Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Length = 141 Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} Length = 144 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Length = 216 Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} Length = 144 Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Length = 151 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} Length = 211 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Length = 176 Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Length = 141 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 133 Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Length = 149 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Length = 145 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Length = 148 Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Length = 220 Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 1sc0_A 2b6e_A 3lz7_A Length = 138 Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
1sc0_A138 Hypothetical protein HI1161; structural genomics, 99.97
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 99.97
3e1e_A141 Thioesterase family protein; structural genomics, 99.97
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 99.96
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 99.96
3hdu_A157 Putative thioesterase; structural genomics, joint 99.96
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 99.96
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 99.96
1o0i_A138 Hypothetical protein HI1161; structural genomics, 99.96
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 99.96
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 99.95
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 99.95
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 99.95
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 99.95
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 99.95
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 99.94
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 99.94
2qwz_A159 Phenylacetic acid degradation-related protein; put 99.94
2pim_A141 Phenylacetic acid degradation-related protein; thi 99.93
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 99.93
1yoc_A147 Hypothetical protein PA1835; structural genomics, 99.93
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 99.93
2h4u_A145 Thioesterase superfamily member 2; structural geno 99.93
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 99.92
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 99.92
1zki_A133 Hypothetical protein PA5202; structural genomics, 99.92
1sh8_A154 Hypothetical protein PA5026; structural genomics, 99.91
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 99.91
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 99.91
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 99.89
1t82_A155 Hypothetical acetyltransferase; structural genomic 99.88
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 99.88
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 99.87
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.85
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 99.85
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 99.85
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 99.84
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 99.82
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.82
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 99.8
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 99.8
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 99.79
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 99.78
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.78
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 99.78
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 99.77
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.75
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 99.75
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.74
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.73
3lmb_A165 Uncharacterized protein; protein OLEI01261, unknow 99.71
2cye_A133 TTHA1846, putative thioesterase; structural genomi 99.59
2cwz_A141 Thioesterase family protein; structural genomics, 99.59
1njk_A156 Hypothetical protein YBAW; structural genomics, th 99.57
3bbj_A 272 Putative thioesterase II; structural genomics, joi 99.54
2fuj_A137 Conserved hypothetical protein; structural genomic 99.52
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 99.47
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 99.47
2q78_A153 Uncharacterized protein; structural genomics, join 99.45
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 99.44
3ck1_A150 Putative thioesterase; structural genomics, joint 99.42
2hlj_A157 Hypothetical protein; putative thioesterase, struc 99.41
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 99.4
2ali_A158 Hypothetical protein PA2801; structural genomics, 99.39
1z54_A132 Probable thioesterase; hypothetical protein, struc 99.39
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 99.38
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 99.38
2gf6_A135 Conserved hypothetical protein; putative thioester 99.36
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 99.34
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 99.34
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 99.32
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 99.3
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 99.28
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 99.28
3r87_A135 Putative uncharacterized protein; unknown function 99.21
3cjy_A 259 Putative thioesterase; YP_496845.1, structural gen 99.2
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 99.15
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 99.09
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 99.05
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 99.05
3rqb_A 275 Uncharacterized protein; structural genomics, PSI- 98.96
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 98.83
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; 98.83
2b3n_A159 Hypothetical protein AF1124; structural genomics, 98.77
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrol 98.71
3u0a_A 285 Acyl-COA thioesterase II TESB2; structural genomic 98.7
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 98.68
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 98.68
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 98.65
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 98.62
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 98.61
3rd7_A 286 Acyl-COA thioesterase; seattle structur genomics c 98.56
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 98.49
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 98.48
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 98.43
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 98.41
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 98.4
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 98.38
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 98.33
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 98.3
4ffu_A176 Oxidase; structural genomics, protein structure in 98.21
3k67_A159 Putative dehydratase AF1124; hypothetical protein 98.17
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 97.64
3q62_A175 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 97.63
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 97.51
3rqb_A275 Uncharacterized protein; structural genomics, PSI- 97.45
3u0a_A285 Acyl-COA thioesterase II TESB2; structural genomic 97.45
3cjy_A259 Putative thioesterase; YP_496845.1, structural gen 97.37
3rd7_A286 Acyl-COA thioesterase; seattle structur genomics c 97.34
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetica 97.3
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty 97.22
4gak_A250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 97.19
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 97.16
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 97.12
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 97.12
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 97.05
4b0b_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 97.02
1c8u_A285 Acyl-COA thioesterase II; internal repeats, hydrol 97.0
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty 96.77
2bi0_A337 Hypothetical protein RV0216; conserved hypothetica 96.67
3bbj_A272 Putative thioesterase II; structural genomics, joi 96.62
3esi_A129 Uncharacterized protein; protein from erwinia caro 96.12
1pn2_A 280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 95.95
4e3e_A352 MAOC domain protein dehydratase; structural genomi 95.82
4b8u_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 95.81
3khp_A 311 MAOC family protein; dehydrogenase, oxidoreductase 95.36
1s9c_A 298 Peroxisomal multifunctional enzyme type 2; hot-DOG 94.94
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 93.93
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 93.77
3kh8_A 332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 92.73
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 92.67
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 89.85
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 88.48
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 87.74
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 83.55
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
Probab=99.97  E-value=1.6e-29  Score=177.29  Aligned_cols=109  Identities=13%  Similarity=0.246  Sum_probs=101.0

Q ss_pred             cccEEEEeeCCEEEEEEEccCCCCCCCCcchHHHHHHHHHHHhHHHHHhcc--CCceEEEEEEeeeeecccCCCEEEEEE
Q 032065           35 QGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFT--GKSKASVDLTISLYYSAKIQEEVEIEA  112 (148)
Q Consensus        35 ~g~~~~~~~~g~~~~~~~v~~~~~n~~G~lHGG~la~l~D~~~~~a~~~~~--~~~~vT~~l~i~fl~p~~~g~~l~~~a  112 (148)
                      .|+++.+.++|++++++++.++|+|+.|++|||++++|+|.++++++....  +...+|++++++|+||++. +.+.++|
T Consensus        24 LGi~~~~~~~g~~~~~~~v~~~~~n~~G~~HGG~~~~l~D~a~~~a~~~~~~~~~~~vt~~l~i~flrpa~~-g~l~a~a  102 (138)
T 1sc0_A           24 LGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRS-GKVTARA  102 (138)
T ss_dssp             TTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHHTSCTTCEEEEEEEEEEECSCCCS-SEEEEEE
T ss_pred             cCCEEEEEeCCEEEEEEEcCHHHcCCCCcCcHHHHHHHHHHHHHHHHHHhCCCCceeeeeEEEEEEEccCCC-CcEEEEE
Confidence            499999999999999999999999999999999999999999999987654  3467899999999999994 5899999


Q ss_pred             EEEeecCcEEEEEEEEEECCCCcEEEEEEEEEE
Q 032065          113 KVVGSRGKLTSVLVEVKRKGNGELIALGKNWMT  145 (148)
Q Consensus       113 ~v~~~gr~~~~~~~~i~~~~~g~lvA~a~~t~~  145 (148)
                      +++|.||+++++++++++ ++|+++|+|++|+.
T Consensus       103 ~v~~~Gr~~~~~~~~i~d-~~g~lvA~a~~T~~  134 (138)
T 1sc0_A          103 TPINLGRNIQVWQIDIRT-EENKLCCVSRLTLS  134 (138)
T ss_dssp             EEEEECSSEEEEEEEEEC-TTSCEEEEEEEEEE
T ss_pred             EEEEcCCCEEEEEEEEEc-CCCCEEEEEEEEEE
Confidence            999999999999999994 58999999999985



>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d2f0xa1136 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Hum 7e-10
d2ov9a1203 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro058 3e-09
d2fs2a1131 d.38.1.5 (A:1-131) Phenylacetic acid degradation p 1e-08
d1wlua1116 d.38.1.5 (A:2-117) Phenylacetic acid degradation p 1e-07
d1ixla_130 d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeo 1e-07
d1vh9a_138 d.38.1.5 (A:) Hypothetical protein YbdB {Escherich 8e-07
d1vh5a_138 d.38.1.5 (A:) Hypothetical protein YdiI {Escherich 6e-06
d1zkia1126 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Ps 6e-05
d1t82a_143 d.38.1.5 (A:) Putative thioesterase SO4397 {Shewan 2e-04
d2f41a1111 d.38.1.5 (A:73-183) Transcription factor FapR, C-t 2e-04
d1sc0a_137 d.38.1.5 (A:) Hypothetical protein HI1161 {Haemoph 7e-04
d1q4ua_140 d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {A 0.001
d1sh8a_153 d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudom 0.003
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: PaaI/YdiI-like
domain: Hypothetical protein Them2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.5 bits (123), Expect = 7e-10
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 1/110 (0%)

Query: 33  TFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTV-NSFTGKSKAS 91
               I  V    G + C   +     +  G  H G  ATL+D +  + +  +  G    S
Sbjct: 22  VLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAPGVS 81

Query: 92  VDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGK 141
           VD+ I+    AK+ E++ I A V+     L    V++  K  G+LIA G+
Sbjct: 82  VDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGR 131


>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Length = 203 Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Length = 131 Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Length = 116 Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 130 Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Length = 126 Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Length = 143 Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 111 Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Length = 137 Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Length = 140 Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 99.97
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 99.97
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 99.97
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 99.96
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 99.96
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 99.96
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 99.96
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 99.96
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 99.95
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 99.95
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 99.92
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 99.9
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 99.88
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 99.87
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 99.85
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 99.85
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 99.83
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 99.83
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 99.8
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 99.77
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 99.14
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 99.11
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 99.1
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 99.08
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 99.05
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 99.04
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.04
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 99.0
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 99.0
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 98.95
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 98.94
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 98.92
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 98.9
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 98.85
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 98.83
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 98.83
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 98.79
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TE 98.77
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 98.75
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 98.68
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 98.48
d1c8ua1114 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 98.43
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 98.38
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 98.21
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 98.1
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 98.03
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 98.01
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 97.84
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 97.76
d1c8ua2171 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 97.61
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 97.58
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional pe 97.07
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 96.86
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 96.72
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 96.71
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escheri 95.64
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: PaaI/YdiI-like
domain: Hypothetical protein Them2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.5e-30  Score=180.29  Aligned_cols=131  Identities=25%  Similarity=0.383  Sum_probs=113.9

Q ss_pred             HHHHHHHHHHhhCCCCCcccceeeecccEEEEeeCCEEEEEEEccCCCCCCCCcchHHHHHHHHHHHhHHHHHhcc-CCc
Q 032065           10 LQASIKMLERTSKGVECSELEAITFQGIQAVELRTGFLRCYFVIPIHAADQDGNWHAGAIATLIDGLGALTVNSFT-GKS   88 (148)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~~v~~~~~n~~G~lHGG~la~l~D~~~~~a~~~~~-~~~   88 (148)
                      .|..+++++.+.+..   .|..+ +.++++.+.++|++++++++.|+|+|+.|++|||++++|+|.++++++.... +..
T Consensus         3 ~~~~~e~~~~~~~~~---~f~~~-lg~i~~~~~~~g~~~~~~~v~~~~~n~~G~lhGG~i~~l~D~~~~~a~~~~~~~~~   78 (136)
T d2f0xa1           3 TQSLREVIKAMTKAR---NFERV-LGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAP   78 (136)
T ss_dssp             HHHHHHHHHHHHHCS---SGGGG-GTTCEEEEEETTEEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHTSSSCCC
T ss_pred             hHHHHHHHHHhhccC---CHHHH-hCCEEEEEEcCCEEEEEEEcCHHHcCCCCccchhHHHHHHHHHHHHHHHhhCCCCc
Confidence            355667777776432   24333 2348999999999999999999999999999999999999999999887653 457


Q ss_pred             eEEEEEEeeeeecccCCCEEEEEEEEEeecCcEEEEEEEEEECCCCcEEEEEEEEE
Q 032065           89 KASVDLTISLYYSAKIQEEVEIEAKVVGSRGKLTSVLVEVKRKGNGELIALGKNWM  144 (148)
Q Consensus        89 ~vT~~l~i~fl~p~~~g~~l~~~a~v~~~gr~~~~~~~~i~~~~~g~lvA~a~~t~  144 (148)
                      .+|++++++|++|++.|++|.+++++++.||++++++++++++++|+++|+|++|+
T Consensus        79 ~vT~~l~i~fl~p~~~G~~v~~~a~v~~~gr~~~~~~~~i~~~~~~~liA~~~~T~  134 (136)
T d2f0xa1          79 GVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTK  134 (136)
T ss_dssp             CEEEEEEEEECSCCBTTCEEEEEEEEEEECSSEEEEEEEEEETTTCCEEEEEEEEE
T ss_pred             ceeeeEEEEEEecCCCCCEEEEEEEEEEeCCCEEEEEEEEEECCCCEEEEEEEEEE
Confidence            78999999999999999999999999999999999999999877899999999996



>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure