Citrus Sinensis ID: 032067

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MSDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGCDSHFQSARKKGSC
ccccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccc
ccHccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccccHcccHHHHHccccEEEEEccccccccccccccccccc
msdtgacyysVLGLHKQASASEIRDAYRKLALkwhpdrwmkdptaageANRRFQQIQEAYSVLSDAAKRTVYDAGLLslladdddeEFCDFMQEMALMMesvspqegytLEHLQGLLTDMIANeqrigfgfadgcdshfqsarkkgsc
msdtgacyysvlglhkqasasEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGCDSHFqsarkkgsc
MSDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYdagllslladdddEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGCDSHFQSARKKGSC
*****ACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAG*ANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGCD************
****GAC*YSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQ*******************LQGLLTDMIANEQR**********************
MSDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGCDS***********
*****ACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGC**HF*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMIANEQRIGFGFADGCDSHFQSARKKGSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
O35723 242 DnaJ homolog subfamily B yes no 0.425 0.260 0.636 4e-17
Q0III6 242 DnaJ homolog subfamily B no no 0.425 0.260 0.606 5e-17
Q4R7Y5241 DnaJ homolog subfamily B N/A no 0.425 0.261 0.590 9e-17
O75190 326 DnaJ homolog subfamily B no no 0.425 0.193 0.590 2e-16
Q5R8H0 326 DnaJ homolog subfamily B yes no 0.425 0.193 0.590 2e-16
Q5F3Z5 326 DnaJ homolog subfamily B yes no 0.425 0.193 0.606 2e-16
Q5FWN8 250 DnaJ homolog subfamily B N/A no 0.425 0.252 0.575 2e-16
Q862Z4 242 DnaJ homolog subfamily B N/A no 0.439 0.268 0.602 3e-16
Q6P642 242 DnaJ homolog subfamily B yes no 0.425 0.260 0.575 3e-16
Q8WWF6145 DnaJ homolog subfamily B no no 0.425 0.434 0.606 5e-16
>sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/66 (63%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAA 67
          YY VLG+ +QASA  IR AYRKLALKWHPD   K+P    EA RRF+Q+ +AY VLSD  
Sbjct: 4  YYEVLGVPRQASAEAIRKAYRKLALKWHPD---KNPEHKEEAERRFKQVAQAYEVLSDVR 60

Query: 68 KRTVYD 73
          KR VYD
Sbjct: 61 KREVYD 66
May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins.
Mus musculus (taxid: 10090)
>sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 Back     alignment and function description
>sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 Back     alignment and function description
>sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 Back     alignment and function description
>sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 Back     alignment and function description
>sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
255564274148 heat shock protein binding protein, puta 0.885 0.885 0.725 2e-51
449454042161 PREDICTED: chaperone protein DnaJ-like [ 0.939 0.863 0.555 9e-38
255633060163 unknown [Glycine max] 0.945 0.858 0.551 2e-37
269999990163 DnaJ-like protein [Glycine max] 0.864 0.785 0.576 2e-36
359806699163 chaperone protein DnaJ-like [Glycine max 0.864 0.785 0.576 2e-36
449436763130 PREDICTED: dnaJ homolog subfamily B memb 0.709 0.807 0.676 4e-36
356505600153 PREDICTED: chaperone protein DnaJ-like [ 0.837 0.810 0.6 1e-35
351722303164 DnaJ-like protein [Glycine max] gi|23428 0.858 0.774 0.569 4e-35
359487530161 PREDICTED: chaperone protein DnaJ-like [ 0.918 0.844 0.535 1e-34
388497224161 unknown [Lotus japonicus] 0.797 0.732 0.575 2e-34
>gi|255564274|ref|XP_002523134.1| heat shock protein binding protein, putative [Ricinus communis] gi|223537696|gb|EEF39319.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/131 (72%), Positives = 111/131 (84%)

Query: 1   MSDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAY 60
           M+++  CYYSVLGL KQASA+EIRDAYRKLALKWHPDRWMKDP  +G+ANRRFQQIQEAY
Sbjct: 1   MAESEPCYYSVLGLRKQASATEIRDAYRKLALKWHPDRWMKDPVVSGQANRRFQQIQEAY 60

Query: 61  SVLSDAAKRTVYDAGLLSLLADDDDEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDM 120
           +VLSD  KR +YDAG+LS L DDDDE FC+F+QEM LMME+V+ +EG  LE LQGLL DM
Sbjct: 61  TVLSDKGKRKLYDAGMLSFLGDDDDEGFCNFLQEMLLMMENVNTKEGDNLEDLQGLLMDM 120

Query: 121 IANEQRIGFGF 131
           IA ++RI  GF
Sbjct: 121 IAEDERIKLGF 131

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449454042|ref|XP_004144765.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255633060|gb|ACU16885.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|269999990|gb|ACZ57923.1| DnaJ-like protein [Glycine max] Back     alignment and taxonomy information
>gi|359806699|ref|NP_001241290.1| chaperone protein DnaJ-like [Glycine max] gi|255640851|gb|ACU20708.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449436763|ref|XP_004136162.1| PREDICTED: dnaJ homolog subfamily B member 6-like [Cucumis sativus] gi|449505366|ref|XP_004162447.1| PREDICTED: dnaJ homolog subfamily B member 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356505600|ref|XP_003521578.1| PREDICTED: chaperone protein DnaJ-like [Glycine max] Back     alignment and taxonomy information
>gi|351722303|ref|NP_001238007.1| DnaJ-like protein [Glycine max] gi|23428796|gb|AAM23263.1| DnaJ-like protein [Glycine max] Back     alignment and taxonomy information
>gi|359487530|ref|XP_003633609.1| PREDICTED: chaperone protein DnaJ-like [Vitis vinifera] gi|296089749|emb|CBI39568.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388497224|gb|AFK36678.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2011846156 AT1G56300 [Arabidopsis thalian 0.817 0.775 0.520 7.1e-29
TAIR|locus:2013940165 AT1G71000 [Arabidopsis thalian 0.75 0.672 0.504 4.2e-24
TAIR|locus:2087492230 AT3G14200 "AT3G14200" [Arabido 0.898 0.578 0.410 2.1e-20
RGD|1594215241 Dnajb3 "DnaJ (Hsp40) homolog, 0.418 0.257 0.646 1.8e-16
UNIPROTKB|Q0III6 242 DNAJB6 "DnaJ homolog subfamily 0.418 0.256 0.6 4.7e-16
MGI|MGI:1306822 242 Dnajb3 "DnaJ (Hsp40) homolog, 0.418 0.256 0.630 4.7e-16
UNIPROTKB|Q32L64 244 LOC528549 "Uncharacterized pro 0.418 0.254 0.615 7.7e-16
UNIPROTKB|F1SM19241 DNAJB6 "Uncharacterized protei 0.418 0.257 0.615 7.7e-16
UNIPROTKB|Q5F3Z5 326 DNAJB6 "DnaJ homolog subfamily 0.418 0.190 0.6 1.3e-15
UNIPROTKB|C9J2C4228 DNAJB6 "DnaJ homolog subfamily 0.418 0.271 0.584 1.6e-15
TAIR|locus:2011846 AT1G56300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
 Identities = 64/123 (52%), Positives = 84/123 (68%)

Query:     2 SDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYS 61
             S+  + YY++LG+ K AS S+IR AYRKLA+KWHPDR+ ++P  AGEA RRFQQIQEAYS
Sbjct:     8 SNVRSSYYTILGIRKDASVSDIRTAYRKLAMKWHPDRYARNPGVAGEAKRRFQQIQEAYS 67

Query:    62 VLSDAAKRTVYXXXXXXXXXXXXXEEFCDFMQEMALMMESVSPQEGYTLEHLQGLLTDMI 121
             VL+D  KR++Y             ++FCDFMQEM  MM +V    G +LE LQ + TDM+
Sbjct:    68 VLNDENKRSMYDVGLYDPHEDDD-DDFCDFMQEMISMMNNVK-DAGESLEDLQRMFTDMV 125

Query:   122 ANE 124
               +
Sbjct:   126 GGD 128
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
TAIR|locus:2013940 AT1G71000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087492 AT3G14200 "AT3G14200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1594215 Dnajb3 "DnaJ (Hsp40) homolog, subfamily B, member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q0III6 DNAJB6 "DnaJ homolog subfamily B member 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1306822 Dnajb3 "DnaJ (Hsp40) homolog, subfamily B, member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L64 LOC528549 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SM19 DNAJB6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3Z5 DNAJB6 "DnaJ homolog subfamily B member 6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2C4 DNAJB6 "DnaJ homolog subfamily B member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_1330037
hypothetical protein (160 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIII.1526.1
annotation not avaliable (81 aa)
  •     0.504
grail3.0261001401
hypothetical protein (124 aa)
  •     0.504
eugene3.02610008
hypothetical protein (132 aa)
  •     0.504
eugene3.00130164
hypothetical protein (660 aa)
  •     0.504
eugene3.00120231
hypothetical protein (668 aa)
  •     0.504
estExt_fgenesh4_pm.C_LG_I0291
SubName- Full=Putative uncharacterized protein; (666 aa)
  •     0.504
estExt_Genewise1_v1.C_LG_III0234
hypothetical protein (666 aa)
  •     0.504
grail3.0261001101
hypothetical protein (648 aa)
  •     0.503
grail3.0009008001
hypothetical protein (572 aa)
  •     0.503
fgenesh4_pm.C_LG_III000644
hypothetical protein (651 aa)
  •     0.503

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-26
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 5e-24
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-23
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-23
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-22
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-22
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-20
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 4e-20
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 6e-20
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 3e-19
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-19
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 8e-19
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-18
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-18
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 3e-17
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-17
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 4e-17
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 4e-17
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-16
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-16
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 3e-16
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-16
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 7e-16
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-15
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-15
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-15
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-15
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-14
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-14
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 6e-14
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 8e-14
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 1e-13
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-13
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-13
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-13
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-11
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 2e-06
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 3e-06
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 2e-05
PTZ00100116 PTZ00100, PTZ00100, DnaJ chaperone protein; Provis 0.002
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 94.5 bits (236), Expect = 1e-26
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  CYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDA 66
           YY +LG+ + AS  EI+ AYRKLALK+HPD+   DP     A  +F++I EAY VLSD 
Sbjct: 1  DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDP----AAEEKFKEINEAYEVLSDP 56

Query: 67 AKRTVYD 73
           KR +YD
Sbjct: 57 EKRAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14288 369 chaperone protein DnaJ; Provisional 99.96
PRK14296 372 chaperone protein DnaJ; Provisional 99.96
PRK14286 372 chaperone protein DnaJ; Provisional 99.96
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.96
PRK14285 365 chaperone protein DnaJ; Provisional 99.96
PRK14287 371 chaperone protein DnaJ; Provisional 99.95
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.95
PRK14276 380 chaperone protein DnaJ; Provisional 99.95
PRK14279 392 chaperone protein DnaJ; Provisional 99.95
PRK14301 373 chaperone protein DnaJ; Provisional 99.95
PRK14298 377 chaperone protein DnaJ; Provisional 99.95
PRK14297 380 chaperone protein DnaJ; Provisional 99.95
PRK14294 366 chaperone protein DnaJ; Provisional 99.95
PRK14277 386 chaperone protein DnaJ; Provisional 99.95
PRK10767 371 chaperone protein DnaJ; Provisional 99.95
PRK14295 389 chaperone protein DnaJ; Provisional 99.95
PRK14278 378 chaperone protein DnaJ; Provisional 99.95
PRK14280 376 chaperone protein DnaJ; Provisional 99.95
PRK14282 369 chaperone protein DnaJ; Provisional 99.95
PRK14284 391 chaperone protein DnaJ; Provisional 99.94
PRK14281 397 chaperone protein DnaJ; Provisional 99.94
PRK14291 382 chaperone protein DnaJ; Provisional 99.94
PRK14283 378 chaperone protein DnaJ; Provisional 99.94
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.94
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.94
PRK14300 372 chaperone protein DnaJ; Provisional 99.94
PRK14289 386 chaperone protein DnaJ; Provisional 99.93
PRK14290 365 chaperone protein DnaJ; Provisional 99.93
PRK14293 374 chaperone protein DnaJ; Provisional 99.93
PRK14292 371 chaperone protein DnaJ; Provisional 99.93
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.91
PRK14299 291 chaperone protein DnaJ; Provisional 99.87
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.85
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.84
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.77
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.77
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.75
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.73
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.71
PRK05014171 hscB co-chaperone HscB; Provisional 99.71
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.7
PRK01356166 hscB co-chaperone HscB; Provisional 99.7
PRK03578176 hscB co-chaperone HscB; Provisional 99.69
PRK00294173 hscB co-chaperone HscB; Provisional 99.69
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
PHA03102153 Small T antigen; Reviewed 99.68
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PRK01773173 hscB co-chaperone HscB; Provisional 99.54
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.53
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.52
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
PHA02624 647 large T antigen; Provisional 99.51
PTZ00100116 DnaJ chaperone protein; Provisional 99.49
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.45
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.35
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.34
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.27
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.06
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.69
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.62
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.53
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 98.07
KOG0431453 consensus Auxilin-like protein and related protein 97.96
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.65
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.56
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.7
PF14687112 DUF4460: Domain of unknown function (DUF4460) 96.03
PF1344662 RPT: A repeated domain in UCH-protein 93.87
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 92.56
KOG0724 335 consensus Zuotin and related molecular chaperones 88.02
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-37  Score=248.31  Aligned_cols=140  Identities=34%  Similarity=0.462  Sum_probs=115.8

Q ss_pred             CCcccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCCCchhhHHHHHHHHHHHHHHHccchHHHHHHHhhcccccCCC
Q 032067            4 TGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLLADD   83 (148)
Q Consensus         4 ~~~d~Y~iLgv~~~a~~~eIk~ayr~l~~~~HPDk~~~~~~~~~~a~~~f~~i~~Ay~~Lsd~~~R~~YD~~~~~~~~~~   83 (148)
                      ...|||+||||+++||.+|||+|||+||++||||++++++    +|+++|++|++||+|||||++|+.||+.+..++...
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~----~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~g   77 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDK----EAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAG   77 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCH----HHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccC
Confidence            4689999999999999999999999999999999976655    899999999999999999999999998765543210


Q ss_pred             -------C-cH-HHHHHHHHHHHhhh-----hcCCCCCch-HhHHHHHHHHHhccc-CcccccccCCCCCCCCCCCCCCC
Q 032067           84 -------D-DE-EFCDFMQEMALMME-----SVSPQEGYT-LEHLQGLLTDMIANE-QRIGFGFADGCDSHFQSARKKGS  147 (148)
Q Consensus        84 -------~-~~-~~~~~~~~~~~~~~-----~~~~~~g~~-~~~~~~~f~~~~~g~-~~~~~~~~~~c~~c~g~g~~~g~  147 (148)
                             . .. .|.++|.+++....     +..+..|.+ ..++.+.|+|++.|. +.|.+.+...|++|.|+|+++||
T Consensus        78 g~gg~g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt  157 (371)
T COG0484          78 GFGGFGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGT  157 (371)
T ss_pred             CcCCCCcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCC
Confidence                   0 01 46777777764221     123446666 578999999999998 78999999999999999999995

>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-16
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-14
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 6e-14
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-12
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-12
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-12
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-12
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 5e-12
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 7e-12
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-10
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-10
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 2e-10
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 4e-10
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 7e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 8e-10
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-08
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-08
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 5e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 6e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 8e-07
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 5e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 4e-05
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 7e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 9e-05
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 7e-04
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure 
Iteration: 1

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 3/65 (4%)
Query: 8  YYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAA 67
          YY VL + +QAS+  I+ AYRKLALKWHPD   K+P    EA RRF+Q+ EAY VLSDA 
Sbjct: 11 YYEVLDVPRQASSEAIKKAYRKLALKWHPD---KNPENKEEAERRFKQVAEAYEVLSDAK 67
Query: 68 KRTVY 72
          KR +Y
Sbjct: 68 KRDIY 72
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-27
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 4e-27
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 9e-27
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-26
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-25
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-25
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-25
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-24
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 2e-24
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-24
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 5e-24
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 7e-24
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-24
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 8e-24
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-23
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-23
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-23
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-22
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-22
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-22
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-22
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-20
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-18
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-18
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 3e-16
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-15
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 5e-12
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 9e-12
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 1e-10
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-10
2guz_A71 Mitochondrial import inner membrane translocase su 3e-10
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-09
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
 Score = 96.9 bits (242), Expect = 1e-27
 Identities = 40/66 (60%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAA 67
          YY VL + +QAS+  I+ AYRKLALKWHPD   K+P    EA RRF+Q+ EAY VLSDA 
Sbjct: 11 YYEVLDVPRQASSEAIKKAYRKLALKWHPD---KNPENKEEAERRFKQVAEAYEVLSDAK 67

Query: 68 KRTVYD 73
          KR +YD
Sbjct: 68 KRDIYD 73
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.9
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.9
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.89
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.89
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.89
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.89
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.88
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.88
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.88
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.88
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.88
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.88
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.88
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.87
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.86
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.86
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.85
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.85
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.83
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.82
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.81
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.8
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.78
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.78
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.77
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.76
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.75
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.75
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.74
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.74
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.71
2guz_A71 Mitochondrial import inner membrane translocase su 99.71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.27
2guz_B65 Mitochondrial import inner membrane translocase su 99.17
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 96.81
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 96.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 94.55
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 85.48
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=5.2e-24  Score=137.92  Aligned_cols=73  Identities=47%  Similarity=0.719  Sum_probs=66.1

Q ss_pred             CCCCcccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCCCchhhHHHHHHHHHHHHHHHccchHHHHHHHhhccc
Q 032067            2 SDTGACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLS   78 (148)
Q Consensus         2 ~~~~~d~Y~iLgv~~~a~~~eIk~ayr~l~~~~HPDk~~~~~~~~~~a~~~f~~i~~Ay~~Lsd~~~R~~YD~~~~~   78 (148)
                      +....|||+||||+++++.++||+|||+|++++|||+++.++    .+.+.|++|++||++|+||.+|..||..+..
T Consensus         3 ~~~~~~~y~iLgv~~~a~~~~Ik~ayr~l~~~~HPD~~~~~~----~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~   75 (79)
T 2dn9_A            3 SGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDP----KAKEKFSQLAEAYEVLSDEVKRKQYDAYGSG   75 (79)
T ss_dssp             SSCCSCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCSSCT----THHHHHHHHHHHHHHHHSHHHHHHHHHSCCC
T ss_pred             CCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCH----HHHHHHHHHHHHHHHHCCHHHHHHHHhccCc
Confidence            356789999999999999999999999999999999976554    5789999999999999999999999997654
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-17
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 3e-16
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-14
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 5e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-13
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-13
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 4e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-09
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 70.4 bits (172), Expect = 2e-17
 Identities = 14/68 (20%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 5  GACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLS 64
          G   +  +G+    +  +++  YRK  L  HPD+          A   F ++ +A+S   
Sbjct: 32 GETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKA-TGQPYEQYAKMIFMELNDAWSEFE 90

Query: 65 DAAKRTVY 72
          +  ++ +Y
Sbjct: 91 NQGQKPLY 98
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.93
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.89
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.85
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.84
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.8
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.73
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 90.6
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=2.8e-26  Score=146.02  Aligned_cols=72  Identities=46%  Similarity=0.760  Sum_probs=65.9

Q ss_pred             CcccccccCcCCCCCHHHHHHHHHHHHHHhCCCCCCCCCchhhHHHHHHHHHHHHHHHccchHHHHHHHhhccccc
Q 032067            5 GACYYSVLGLHKQASASEIRDAYRKLALKWHPDRWMKDPTAAGEANRRFQQIQEAYSVLSDAAKRTVYDAGLLSLL   80 (148)
Q Consensus         5 ~~d~Y~iLgv~~~a~~~eIk~ayr~l~~~~HPDk~~~~~~~~~~a~~~f~~i~~Ay~~Lsd~~~R~~YD~~~~~~~   80 (148)
                      .+|||+||||+++||.++||+|||++++++|||+++.++    .+.+.|++|++||+||+||.+|..||..+..++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~----~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK----EAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTC----HHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCCh----HHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            579999999999999999999999999999999976555    677899999999999999999999999876654
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure