Citrus Sinensis ID: 032122

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
cccccHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccEEEEEEEEEEEEEEEEEEEEcccccccccccccccccccccccccEEEccEEEEEccccccccccccEEEEEEEEEEEEEc
cccccHHHHHHHHHccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccEcEEEEEEEccEEEEEEEEEEcccccccccccEEccccccccHHHccccEEEEHHcccHHHHccccEEEEEEEEEEEEEc
megwdpntkstltqipllstkagprdgaAWTQRLKEEYKALIAYTQMnksndndwfrisaanpegtrwtgkcwyVHNLLKYEfdlqfdipvtypatapelelpqldgktqkmyrggkicltvhfkplwaknwyfcFTFVDYFVYFRF
megwdpntkstltqipllstkagprdGAAWTQRLKEEYKALIAYTqmnksndndWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
***************************AAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFR*
*******TKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
**********TLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
***WDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYFCFTFVDYFVYFRF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
Q9SXC8174 Ubiquitin-fold modifier-c yes no 0.891 0.752 0.946 5e-72
Q8S625185 Ubiquitin-fold modifier-c yes no 0.891 0.708 0.816 4e-61
A2Z5S8185 Ubiquitin-fold modifier-c N/A no 0.891 0.708 0.816 4e-61
Q178A5169 Ubiquitin-fold modifier-c N/A no 0.857 0.745 0.740 7e-53
B0WVC4169 Ubiquitin-fold modifier-c N/A no 0.857 0.745 0.732 3e-51
A7SM54169 Ubiquitin-fold modifier-c N/A no 0.857 0.745 0.708 2e-50
Q1ZXC9164 Ubiquitin-fold modifier-c yes no 0.857 0.768 0.692 2e-50
B3RTL9168 Ubiquitin-fold modifier-c N/A no 0.857 0.75 0.716 1e-49
Q6DEN0166 Ubiquitin-fold modifier-c yes no 0.857 0.759 0.685 2e-49
B9EM04167 Ubiquitin-fold modifier-c N/A no 0.857 0.754 0.677 2e-49
>sp|Q9SXC8|UFC1_ARATH Ubiquitin-fold modifier-conjugating enzyme 1 OS=Arabidopsis thaliana GN=At1g27530 PE=2 SV=1 Back     alignment and function desciption
 Score =  269 bits (687), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 124/131 (94%), Positives = 131/131 (100%)

Query: 1   MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60
           MEGWDPNTKSTLT+IPLL+TKAGPRDGAAWTQRLKEEYK+LIAYTQMNKSNDNDWFRISA
Sbjct: 1   MEGWDPNTKSTLTRIPLLTTKAGPRDGAAWTQRLKEEYKSLIAYTQMNKSNDNDWFRISA 60

Query: 61  ANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICL 120
           +NPEGTRWTGKCWYVHNLLKYEFDLQFDIP+TYPATAPELELP++DGKTQKMYRGGKICL
Sbjct: 61  SNPEGTRWTGKCWYVHNLLKYEFDLQFDIPITYPATAPELELPEIDGKTQKMYRGGKICL 120

Query: 121 TVHFKPLWAKN 131
           TVHFKPLWAKN
Sbjct: 121 TVHFKPLWAKN 131
E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8S625|UFC1_ORYSJ Ubiquitin-fold modifier-conjugating enzyme 1 OS=Oryza sativa subsp. japonica GN=Os10g0205200 PE=2 SV=1 Back     alignment and function description
>sp|A2Z5S8|UFC1_ORYSI Ubiquitin-fold modifier-conjugating enzyme 1 OS=Oryza sativa subsp. indica GN=OsI_33008 PE=3 SV=1 Back     alignment and function description
>sp|Q178A5|UFC1_AEDAE Ubiquitin-fold modifier-conjugating enzyme 1 OS=Aedes aegypti GN=AAEL005968 PE=3 SV=1 Back     alignment and function description
>sp|B0WVC4|UFC1_CULQU Ubiquitin-fold modifier-conjugating enzyme 1 OS=Culex quinquefasciatus GN=CPIJ011320 PE=3 SV=1 Back     alignment and function description
>sp|A7SM54|UFC1_NEMVE Ubiquitin-fold modifier-conjugating enzyme 1 OS=Nematostella vectensis GN=v1g214407 PE=3 SV=1 Back     alignment and function description
>sp|Q1ZXC9|UFC1_DICDI Ubiquitin-fold modifier-conjugating enzyme 1 OS=Dictyostelium discoideum GN=ufc1 PE=3 SV=1 Back     alignment and function description
>sp|B3RTL9|UFC1_TRIAD Ubiquitin-fold modifier-conjugating enzyme 1 OS=Trichoplax adhaerens GN=TRIADDRAFT_35934 PE=3 SV=1 Back     alignment and function description
>sp|Q6DEN0|UFC1_DANRE Ubiquitin-fold modifier-conjugating enzyme 1 OS=Danio rerio GN=ufc1 PE=2 SV=1 Back     alignment and function description
>sp|B9EM04|UFC1_SALSA Ubiquitin-fold modifier-conjugating enzyme 1 OS=Salmo salar GN=ufc1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
351724683175 uncharacterized protein LOC100527748 [Gl 0.891 0.748 0.977 1e-71
357466793 335 Ubiquitin-fold modifier-conjugating enzy 0.891 0.391 0.954 5e-71
224063339174 predicted protein [Populus trichocarpa] 0.891 0.752 0.969 1e-70
357466797 318 Ubiquitin-fold modifier-conjugating enzy 0.891 0.411 0.954 1e-70
351727451175 uncharacterized protein LOC100499901 [Gl 0.891 0.748 0.969 1e-70
255537868174 Ufm1-conjugating enzyme, putative [Ricin 0.891 0.752 0.954 2e-70
449436920174 PREDICTED: ubiquitin-fold modifier-conju 0.891 0.752 0.954 2e-70
18396376174 ubiquitin-fold modifier-conjugating enzy 0.891 0.752 0.946 3e-70
24899705174 Similar to CGI-126 protein [Arabidopsis 0.891 0.752 0.946 4e-70
388494048174 unknown [Lotus japonicus] gi|388509226|g 0.891 0.752 0.961 5e-70
>gi|351724683|ref|NP_001236810.1| uncharacterized protein LOC100527748 [Glycine max] gi|255633104|gb|ACU16907.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 128/131 (97%), Positives = 131/131 (100%)

Query: 1   MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60
           MEGWDPNTKSTLTQIPLL+TKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA
Sbjct: 1   MEGWDPNTKSTLTQIPLLTTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60

Query: 61  ANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICL 120
           ANPEGTRWTGKCWYVHNLLKYEFDLQFD+PVTYP+TAPELELPQLDGKTQKMYRGGKICL
Sbjct: 61  ANPEGTRWTGKCWYVHNLLKYEFDLQFDVPVTYPSTAPELELPQLDGKTQKMYRGGKICL 120

Query: 121 TVHFKPLWAKN 131
           TVHFKPLWAKN
Sbjct: 121 TVHFKPLWAKN 131

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357466793|ref|XP_003603681.1| Ubiquitin-fold modifier-conjugating enzyme [Medicago truncatula] gi|355492729|gb|AES73932.1| Ubiquitin-fold modifier-conjugating enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|224063339|ref|XP_002301104.1| predicted protein [Populus trichocarpa] gi|118484728|gb|ABK94233.1| unknown [Populus trichocarpa] gi|222842830|gb|EEE80377.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357466797|ref|XP_003603683.1| Ubiquitin-fold modifier-conjugating enzyme [Medicago truncatula] gi|355492731|gb|AES73934.1| Ubiquitin-fold modifier-conjugating enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|351727451|ref|NP_001237673.1| uncharacterized protein LOC100499901 [Glycine max] gi|255627527|gb|ACU14108.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255537868|ref|XP_002509999.1| Ufm1-conjugating enzyme, putative [Ricinus communis] gi|223550700|gb|EEF52186.1| Ufm1-conjugating enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449436920|ref|XP_004136240.1| PREDICTED: ubiquitin-fold modifier-conjugating enzyme 1-like [Cucumis sativus] gi|449502817|ref|XP_004161751.1| PREDICTED: ubiquitin-fold modifier-conjugating enzyme 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18396376|ref|NP_564289.1| ubiquitin-fold modifier-conjugating enzyme 1 [Arabidopsis thaliana] gi|297851184|ref|XP_002893473.1| hypothetical protein ARALYDRAFT_472958 [Arabidopsis lyrata subsp. lyrata] gi|75213217|sp|Q9SXC8.1|UFC1_ARATH RecName: Full=Ubiquitin-fold modifier-conjugating enzyme 1; AltName: Full=Ufm1-conjugating enzyme 1 gi|5668764|gb|AAD45991.1|AC005916_3 Similar to gb|AF151884 CGI-126 protein from Homo sapiens. EST gb|Z18048 comes from this gene [Arabidopsis thaliana] gi|15451104|gb|AAK96823.1| Similar to CGI-126 protein [Arabidopsis thaliana] gi|21553822|gb|AAM62915.1| unknown [Arabidopsis thaliana] gi|297339315|gb|EFH69732.1| hypothetical protein ARALYDRAFT_472958 [Arabidopsis lyrata subsp. lyrata] gi|332192721|gb|AEE30842.1| ubiquitin-fold modifier-conjugating enzyme 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|24899705|gb|AAN65067.1| Similar to CGI-126 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388494048|gb|AFK35090.1| unknown [Lotus japonicus] gi|388509226|gb|AFK42679.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
TAIR|locus:2196879174 AT1G27530 "AT1G27530" [Arabido 0.891 0.752 0.946 8.9e-70
UNIPROTKB|E2RM60167 UFC1 "Uncharacterized protein" 0.857 0.754 0.685 8.5e-49
ZFIN|ZDB-GENE-040801-268166 ufc1 "ubiquitin-fold modifier 0.857 0.759 0.685 1.8e-48
FB|FBgn0034061164 CG8386 [Drosophila melanogaste 0.857 0.768 0.685 2.3e-48
UNIPROTKB|B9EM04167 ufc1 "Ubiquitin-fold modifier- 0.857 0.754 0.677 2.3e-48
UNIPROTKB|Q5E953167 UFC1 "Ubiquitin-fold modifier- 0.857 0.754 0.669 2.9e-48
UNIPROTKB|Q9Y3C8167 UFC1 "Ubiquitin-fold modifier- 0.857 0.754 0.669 2.9e-48
UNIPROTKB|F2Z530167 UFC1 "Uncharacterized protein" 0.857 0.754 0.669 2.9e-48
MGI|MGI:1913405167 Ufc1 "ubiquitin-fold modifier 0.857 0.754 0.653 9.8e-48
UNIPROTKB|C1BZU2167 ufc1 "Ubiquitin-fold modifier- 0.857 0.754 0.669 2e-47
TAIR|locus:2196879 AT1G27530 "AT1G27530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 707 (253.9 bits), Expect = 8.9e-70, P = 8.9e-70
 Identities = 124/131 (94%), Positives = 131/131 (100%)

Query:     1 MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60
             MEGWDPNTKSTLT+IPLL+TKAGPRDGAAWTQRLKEEYK+LIAYTQMNKSNDNDWFRISA
Sbjct:     1 MEGWDPNTKSTLTRIPLLTTKAGPRDGAAWTQRLKEEYKSLIAYTQMNKSNDNDWFRISA 60

Query:    61 ANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICL 120
             +NPEGTRWTGKCWYVHNLLKYEFDLQFDIP+TYPATAPELELP++DGKTQKMYRGGKICL
Sbjct:    61 SNPEGTRWTGKCWYVHNLLKYEFDLQFDIPITYPATAPELELPEIDGKTQKMYRGGKICL 120

Query:   121 TVHFKPLWAKN 131
             TVHFKPLWAKN
Sbjct:   121 TVHFKPLWAKN 131
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
UNIPROTKB|E2RM60 UFC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-268 ufc1 "ubiquitin-fold modifier conjugating enzyme 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0034061 CG8386 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B9EM04 ufc1 "Ubiquitin-fold modifier-conjugating enzyme 1" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E953 UFC1 "Ubiquitin-fold modifier-conjugating enzyme 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y3C8 UFC1 "Ubiquitin-fold modifier-conjugating enzyme 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z530 UFC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913405 Ufc1 "ubiquitin-fold modifier conjugating enzyme 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C1BZU2 ufc1 "Ubiquitin-fold modifier-conjugating enzyme 1" [Esox lucius (taxid:8010)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B3RTL9UFC1_TRIADNo assigned EC number0.71650.85710.75N/Ano
Q9CR09UFC1_MOUSENo assigned EC number0.65350.85710.7544yesno
C3ZDX5UFC1_BRAFLNo assigned EC number0.66140.85710.7455yesno
Q03598UFC1_CAEELNo assigned EC number0.66140.85710.7777yesno
Q1ZXC9UFC1_DICDINo assigned EC number0.69290.85710.7682yesno
Q6BBI8UFC1_RATNo assigned EC number0.65350.85710.7544yesno
Q7K1Z5UFC1_DROMENo assigned EC number0.68500.85710.7682yesno
A2Z5S8UFC1_ORYSINo assigned EC number0.81670.89110.7081N/Ano
Q5E953UFC1_BOVINNo assigned EC number0.66920.85710.7544yesno
Q9SXC8UFC1_ARATHNo assigned EC number0.94650.89110.7528yesno
Q8S625UFC1_ORYSJNo assigned EC number0.81670.89110.7081yesno
A7SM54UFC1_NEMVENo assigned EC number0.70860.85710.7455N/Ano
Q6DEN0UFC1_DANRENo assigned EC number0.68500.85710.7590yesno
Q28X71UFC1_DROPSNo assigned EC number0.68500.85710.7682yesno
Q7PND3UFC1_ANOGANo assigned EC number0.68500.85710.7544yesno
Q9Y3C8UFC1_HUMANNo assigned EC number0.66920.85710.7544yesno
Q178A5UFC1_AEDAENo assigned EC number0.74010.85710.7455N/Ano
B0WVC4UFC1_CULQUNo assigned EC number0.73220.85710.7455N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_II0491
SubName- Full=Putative uncharacterized protein; (174 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_XV2116
hypothetical protein (428 aa)
   •• • 0.760
grail3.0635000201
hypothetical protein (190 aa)
   •    0.452

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
pfam08694161 pfam08694, UFC1, Ubiquitin-fold modifier-conjugati 5e-85
>gnl|CDD|149675 pfam08694, UFC1, Ubiquitin-fold modifier-conjugating enzyme 1 Back     alignment and domain information 
 Score =  245 bits (627), Expect = 5e-85
 Identities = 95/126 (75%), Positives = 107/126 (84%), Gaps = 1/126 (0%)

Query: 6   PNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEG 65
             TKST+++IPLL T AGPRDG  W QRLKEEY+ALI Y + NKS DNDWFR+ + N EG
Sbjct: 1   EATKSTVSRIPLLKTNAGPRDGEKWIQRLKEEYQALIKYVENNKSADNDWFRLES-NKEG 59

Query: 66  TRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFK 125
           TRW GKCWYVHNL KYEFDL+FDIPVTYPAT PE+ LP+LDGKT KMYRGGKICLT+HFK
Sbjct: 60  TRWFGKCWYVHNLKKYEFDLEFDIPVTYPATPPEIALPELDGKTAKMYRGGKICLTIHFK 119

Query: 126 PLWAKN 131
           PLWA+N
Sbjct: 120 PLWARN 125

Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes. Ubiquitin-fold modifier 1 (Ufm1) a ubiquitin-like protein is activated by a novel E1-like enzyme, Uba5, by forming a high-energy thioester bond. Activated Ufm1 is then transferred to its cognate E2-like enzyme, Ufc1, in a similar thioester linkage. This family represents the E2-like enzyme. Length = 161

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 100.0
KOG3357167 consensus Uncharacterized conserved protein [Funct 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.76
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 99.72
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.65
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.64
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.58
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.54
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 99.4
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.31
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 99.04
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 99.02
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 98.99
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 98.98
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 98.98
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 98.89
KOG0894 244 consensus Ubiquitin-protein ligase [Posttranslatio 98.51
KOG0416189 consensus Ubiquitin-protein ligase [Posttranslatio 98.5
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 98.43
KOG0428 314 consensus Non-canonical ubiquitin conjugating enzy 98.3
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 97.63
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 97.35
PF14461133 Prok-E2_B: Prokaryotic E2 family B 97.0
KOG0423223 consensus Ubiquitin-protein ligase [Posttranslatio 96.37
KOG0429 258 consensus Ubiquitin-conjugating enzyme-related pro 96.27
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 95.26
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 95.17
COG3449154 DNA gyrase inhibitor [DNA replication, recombinati 93.59
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 93.05
smart00591107 RWD domain in RING finger and WD repeat containing 92.45
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 88.16
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information 
Probab=100.00  E-value=6e-78  Score=475.57  Aligned_cols=128  Identities=76%  Similarity=1.329  Sum_probs=104.8

Q ss_pred             chhhhhhcccceeeccCCCCChhHHHHHHHHHHHHHHHHHHhcCCCCCCceEEeeCCCCCCeeeeeeeeeecccceeEEE
Q 032122            6 PNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDL   85 (147)
Q Consensus         6 ~~t~~~~~~ipl~~~~agprd~~~w~~RLkeEY~aLikyv~~nk~~d~dwf~Lep~n~dgTrW~gkcw~~~~~~~yeF~l   85 (147)
                      ++||++|++||||+|+|||||+++|++||||||+|||+||++||++|||||+|+| |++||+|+|+|||+|++.+|||+|
T Consensus         1 ~~tk~t~~~IPll~~~AGPrd~~~W~~RLKEEy~aLI~Yv~~nK~~DndWF~les-n~~GT~W~GkCW~~h~l~kYEF~~   79 (161)
T PF08694_consen    1 EATKSTVEKIPLLKTKAGPRDGDLWVQRLKEEYQALIKYVENNKENDNDWFRLES-NKEGTRWFGKCWYIHNLLKYEFDL   79 (161)
T ss_dssp             -HHHHHHHCS---SS---TTSCHHHHHHHHHHHHHHHHHHHHHHHTT---EEEEE--TTSSEEEEEEEEEETTEEEEEEE
T ss_pred             CchHHHHHhCccccccCCCCCHHHHHHHHHHHHHHHHHHHHhcccccCCeEEecc-CCCCCccccEEEEEeeeeeEEEee
Confidence            4799999999999999999999999999999999999999999999999999999 999999999999999999999999


Q ss_pred             EEecCCCCCCCCCeeecCCCCCcccccccCceeeecCCcccccccCCce
Q 032122           86 QFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYF  134 (147)
Q Consensus        86 efdIP~tYP~tpPeI~fPeldgkt~kmYrgGkICL~dHf~PlW~~n~p~  134 (147)
                      |||||+|||+|||||++|||||||+|||||||||||+||+|||+||||-
T Consensus        80 eFdIP~tYP~t~pEi~lPeLdGKTaKMYRGGkIClt~HFkPLWakN~Pk  128 (161)
T PF08694_consen   80 EFDIPVTYPTTAPEIALPELDGKTAKMYRGGKICLTDHFKPLWAKNVPK  128 (161)
T ss_dssp             EEE--TTTTTS----B-GGGTTT-SSBCCCCBB---TTHHHHHHCTTTT
T ss_pred             ecCCCccCCCCCcceeccccCCchhhhhcCceEeeecccchhhhhcCCc
Confidence            9999999999999999999999999999999999999999999999994

Ubiquitin-fold modifier 1 (Ufm1) a ubiquitin-like protein is activated by a novel E1-like enzyme, Uba5, by forming a high-energy thioester bond. Activated Ufm1 is then transferred to its cognate E2-like enzyme, Ufc1, in a similar thioester linkage. This family represents the E2-like enzyme [].; PDB: 2Z6P_A 2K07_A 2Z6O_A 3EVX_D 3KPA_A.
>KOG3357 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3449 DNA gyrase inhibitor [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2k07_A175 Solution Nmr Structure Of Human E2-Like Ubiquitin-F 4e-50
2z6o_A172 Crystal Structure Of The Ufc1, Ufm1 Conjugating Enz 6e-50
3evx_A175 Crystal Structure Of The Human E2-Like Ubiquitin-Fo 3e-49
2z6p_A172 Crystal Structure Of The Ufc1, Ufm1 Conjugating Enz 4e-49
3kpa_A168 Ubiquitin Fold Modifier Conjugating Enzyme From Lei 3e-42
>pdb|2K07|A Chain A, Solution Nmr Structure Of Human E2-Like Ubiquitin-Fold Modifier Conjugating Enzyme 1 (Ufc1). Northeast Structural Genomics Consortium Target Hr41 Length = 175 Back     alignment and structure 
Iteration: 1

 Score =  192 bits (489), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 105/127 (82%), Gaps = 1/127 (0%)
Query: 5   DPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPE 64
           D  T+  +++IP+L T AGPRD   W QRLKEEY++LI Y + NK+ DNDWFR+ + N E
Sbjct: 3   DEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLES-NKE 61
Query: 65  GTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHF 124
           GTRW GKCWY+H+LLKYEFD++FDIP+TYP TAPE+ +P+LDGKT KMYRGGKICLT HF
Sbjct: 62  GTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHF 121
Query: 125 KPLWAKN 131
           KPLWA+N
Sbjct: 122 KPLWARN 128
>pdb|2Z6O|A Chain A, Crystal Structure Of The Ufc1, Ufm1 Conjugating Enzyme 1 Length = 172 Back     alignment and structure
>pdb|3EVX|A Chain A, Crystal Structure Of The Human E2-Like Ubiquitin-Fold Modifier Conjugating Enzyme 1 (Ufc1). Northeast Structural Genomics Consortium Target Hr41 Length = 175 Back     alignment and structure
>pdb|2Z6P|A Chain A, Crystal Structure Of The Ufc1, Ufm1 Conjugating Enzyme 1 Length = 172 Back     alignment and structure
>pdb|3KPA|A Chain A, Ubiquitin Fold Modifier Conjugating Enzyme From Leishmania Major (Probable) Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 5e-82
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 3e-81
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} Length = 168 Back     alignment and structure
 Score =  237 bits (606), Expect = 5e-82
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 1/127 (0%)

Query: 5   DPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPE 64
           +P+ K ++++IPLL TKAGPRDG  WT RLKEEY +LI Y + NK++D+ WF + + NP+
Sbjct: 10  EPSVKESVSRIPLLKTKAGPRDGDKWTARLKEEYASLITYVEHNKASDSHWFHLES-NPQ 68

Query: 65  GTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHF 124
           GTRW G CW  +   KYEF++ FDIPVTYP   PE+ LP+L+GKT KMYRGGKIC+T HF
Sbjct: 69  GTRWYGTCWTYYKNEKYEFEMNFDIPVTYPQAPPEIALPELEGKTVKMYRGGKICMTTHF 128

Query: 125 KPLWAKN 131
            PLWA+N
Sbjct: 129 FPLWARN 135
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Length = 172 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 100.0
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 100.0
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.74
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.73
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.72
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.72
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.71
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.71
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.71
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.71
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.71
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.7
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.7
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.7
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.7
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.7
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.69
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.69
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.68
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.68
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.68
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.67
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.66
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.66
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.66
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.66
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 99.66
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.66
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.66
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.65
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.65
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.64
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.63
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.62
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.61
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.61
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.61
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.61
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.61
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.59
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.59
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.59
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.58
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.57
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.57
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.56
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.55
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.54
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.53
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.53
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.53
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.51
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.5
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 97.96
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 97.11
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 94.76
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 94.2
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 93.45
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 93.19
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 93.09
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 93.01
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 91.47
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
Probab=100.00  E-value=1.7e-71  Score=441.10  Aligned_cols=131  Identities=58%  Similarity=1.164  Sum_probs=126.0

Q ss_pred             CCCchhhhhhcccceeeccCCCCChhHHHHHHHHHHHHHHHHHHhcCCCCCCceEEeeCCCCCCeeeeeeeeeeccccee
Q 032122            3 GWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYE   82 (147)
Q Consensus         3 ~~d~~t~~~~~~ipl~~~~agprd~~~w~~RLkeEY~aLikyv~~nk~~d~dwf~Lep~n~dgTrW~gkcw~~~~~~~ye   82 (147)
                      -|+++.+++|++||||||+|||||+++|++||||||+|||+||++||++|||||+++| |++||+|+|+|||+|++.+|+
T Consensus         8 ~~~~~~~~~~~~ipll~t~agPrd~~~w~~RlkeEy~alI~yv~~nK~~d~dWf~~~s-n~~GT~W~G~cw~~~~~~kye   86 (168)
T 3kpa_A            8 HMEPSVKESVSRIPLLKTKAGPRDGDKWTARLKEEYASLITYVEHNKASDSHWFHLES-NPQGTRWYGTCWTYYKNEKYE   86 (168)
T ss_dssp             ----CHHHHHTTSCCCCCCCCTTSTHHHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEE-CTTSCEEEEEEEEEETTEEEE
T ss_pred             ccChHHHHHHhhCceeeccCCCCCHHHHHHHHHHHHHHHHHHHHhcccccCCeeeecC-CCCCCcccCccceeeccceeE
Confidence            4789999999999999999999999999999999999999999999999999999999 999999999999999999999


Q ss_pred             EEEEEecCCCCCCCCCeeecCCCCCcccccccCceeeecCCcccccccCCce
Q 032122           83 FDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYF  134 (147)
Q Consensus        83 F~lefdIP~tYP~tpPeI~fPeldgkt~kmYrgGkICL~dHf~PlW~~n~p~  134 (147)
                      |+|+|+||++||++||+|+||++||+|+||||||+||||+||+|+|+||||-
T Consensus        87 FkLefdiP~tYP~tPPeI~Fp~ldgkt~kmYr~GkICLdIhwkPlW~~n~P~  138 (168)
T 3kpa_A           87 FEMNFDIPVTYPQAPPEIALPELEGKTVKMYRGGKICMTTHFFPLWARNVPY  138 (168)
T ss_dssp             EEEEEECCTTTTTSCCCCBCGGGTTTCSSEETTTEECCCTTHHHHHHHTTTT
T ss_pred             EEEEEeCCccCCCCCCEeecccccCcCccccCCCcEEeccccchhhHhcCCc
Confidence            9999999999999999999999999999999999999999999999999994
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d2in1a1162 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 2e-86
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UFC1-like
domain: Ufm1-conjugating enzyme 1, UFC1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  247 bits (632), Expect = 2e-86
 Identities = 85/127 (66%), Positives = 105/127 (82%), Gaps = 1/127 (0%)

Query: 5   DPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPE 64
           D  T+  +++IP+L T AGPRD   W QRLKEEY++LI Y + NK+ DNDWFR+ + N E
Sbjct: 1   DEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLES-NKE 59

Query: 65  GTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHF 124
           GTRW GKCWY+H+LLKYEFD++FDIP+TYP TAPE+ +P+LDGKT KMYRGGKICLT HF
Sbjct: 60  GTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHF 119

Query: 125 KPLWAKN 131
           KPLWA+N
Sbjct: 120 KPLWARN 126

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 100.0
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.69
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.68
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.68
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.68
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.67
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.66
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.65
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.63
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.63
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.62
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.61
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.61
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.61
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.6
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.6
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.59
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.58
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.57
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.57
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.55
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.54
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.53
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.53
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.52
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.52
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.48
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.46
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.42
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.36
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 98.55
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 97.71
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 89.97
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 89.79
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 88.94
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 86.51
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UFC1-like
domain: Ufm1-conjugating enzyme 1, UFC1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.7e-79  Score=479.48  Aligned_cols=129  Identities=66%  Similarity=1.263  Sum_probs=127.7

Q ss_pred             CchhhhhhcccceeeccCCCCChhHHHHHHHHHHHHHHHHHHhcCCCCCCceEEeeCCCCCCeeeeeeeeeecccceeEE
Q 032122            5 DPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFD   84 (147)
Q Consensus         5 d~~t~~~~~~ipl~~~~agprd~~~w~~RLkeEY~aLikyv~~nk~~d~dwf~Lep~n~dgTrW~gkcw~~~~~~~yeF~   84 (147)
                      |++|+++|++||||+|+|||||+++|++||||||++||+||++||++|||||+|+| |++||+|+|+|||+|++++|||+
T Consensus         1 d~~tk~t~~~IPll~t~AGPrD~e~W~~RLKEEy~aLI~Yv~nNK~~dndWF~les-n~~GT~W~GkCWyihnl~kYeFd   79 (162)
T d2in1a1           1 DEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLES-NKEGTRWFGKCWYIHDLLKYEFD   79 (162)
T ss_dssp             CCHHHHHTTTSCCCCCCCCTTSHHHHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEE-CTTSSEEEEEEEEEETTEEEEEE
T ss_pred             ChhHHHHHHhCccccccCCCCCHHHHHHHHHHHHHHHHHHHHhcccccCCeEEecc-CCCCCeeeceeeEEEeeeEEEEE
Confidence            78999999999999999999999999999999999999999999999999999999 99999999999999999999999


Q ss_pred             EEEecCCCCCCCCCeeecCCCCCcccccccCceeeecCCcccccccCCce
Q 032122           85 LQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNWYF  134 (147)
Q Consensus        85 lefdIP~tYP~tpPeI~fPeldgkt~kmYrgGkICL~dHf~PlW~~n~p~  134 (147)
                      ||||||+|||+|||||++|+|||||+|||||||||||+||+|||+||||-
T Consensus        80 ~eFdIP~tYP~t~pEi~lPeLdGKTaKMYRGGkIClt~HFkPLWarN~Pk  129 (162)
T d2in1a1          80 IEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPK  129 (162)
T ss_dssp             EEEECCTTTTTSCCCCBCGGGSSSCSSSCGGGBCCCCTTSHHHHHTTTTS
T ss_pred             EEeccCCCCCCCCcceeccccCCchhhhhcCceeeccccchhhhhhcCCc
Confidence            99999999999999999999999999999999999999999999999994
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure