Citrus Sinensis ID: 032124

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENSNGMDINFNAQ
cccccccccccHHHHHHHHHHHHHHccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHccccccccccccccccccccHHHHHHHHHHHcccEEEcccccEEEcHHHHHHHHHHHHHHHHHHcccc
ccccEEEEcccHHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccEEEcccccEEEcccccccHHHHHHHHHHHHHHcc
metaknvkdvspHEFVKAYAAHLKrsgkielptwndivktgtlkelapydpdwYYIRAASMARKIYLRGglgvgsfrriygggkrngsrpphfskssgsVARHILHQlqdtniieldskGQSLVLVERLHkldcensngmdinfnaq
metaknvkdvspheFVKAYAAHlkrsgkielptwndivktgtlkelapydPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHkldcensngmdinfnaq
METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENSNGMDINFNAQ
*************EFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGG*******************RHILHQLQDTNIIELDSKGQSLVLVERLHKLDC*************
***AKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGG**************SGSVARHILHQLQDTNIIELD************HKLDCENSNGMDINF***
*********VSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGK***************VARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENSNGMDINFNAQ
***AKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRN*SRPP******GSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENSNGMDINF***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENSNGMDINFNAQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
Q9FNP8143 40S ribosomal protein S19 yes no 0.816 0.839 0.858 6e-58
Q9SGA6143 40S ribosomal protein S19 no no 0.816 0.839 0.841 2e-57
Q9LF30143 40S ribosomal protein S19 no no 0.816 0.839 0.833 2e-56
P40978146 40S ribosomal protein S19 yes no 0.891 0.897 0.679 5e-49
Q94613149 40S ribosomal protein S19 N/A no 0.870 0.859 0.507 1e-35
Q54X51148 40S ribosomal protein S19 yes no 0.891 0.885 0.477 5e-34
Q8T5Z4147 40S ribosomal protein S19 N/A no 0.816 0.816 0.541 7e-34
P17074145 40S ribosomal protein S19 yes no 0.782 0.793 0.573 2e-33
Q9CZX8145 40S ribosomal protein S19 yes no 0.782 0.793 0.573 2e-33
Q9Y0H3145 40S ribosomal protein S19 N/A no 0.782 0.793 0.556 9e-33
>sp|Q9FNP8|RS193_ARATH 40S ribosomal protein S19-3 OS=Arabidopsis thaliana GN=RPS19C PE=2 SV=1 Back     alignment and function desciption
 Score =  222 bits (565), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 108/120 (90%)

Query: 1   METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAAS 60
           M T K VKDVSPHEFVKAYAAHLKRSGKIELP W DIVKTG LKELAPYDPDWYYIRAAS
Sbjct: 1   MATGKTVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAAS 60

Query: 61  MARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKG 120
           MARK+YLRGGLGVG+FRRIYGG KRNGSRPPHF KSSG VARHIL QLQ  NI++LD+KG
Sbjct: 61  MARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKG 120

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SGA6|RS191_ARATH 40S ribosomal protein S19-1 OS=Arabidopsis thaliana GN=RPS19A PE=2 SV=1 Back     alignment and function description
>sp|Q9LF30|RS192_ARATH 40S ribosomal protein S19-2 OS=Arabidopsis thaliana GN=RPS19B PE=2 SV=1 Back     alignment and function description
>sp|P40978|RS19_ORYSJ 40S ribosomal protein S19 OS=Oryza sativa subsp. japonica GN=RPS19A PE=3 SV=1 Back     alignment and function description
>sp|Q94613|RS19_MYAAR 40S ribosomal protein S19 OS=Mya arenaria GN=RPS19 PE=2 SV=1 Back     alignment and function description
>sp|Q54X51|RS19_DICDI 40S ribosomal protein S19 OS=Dictyostelium discoideum GN=rps19 PE=3 SV=1 Back     alignment and function description
>sp|Q8T5Z4|RS19_BRABE 40S ribosomal protein S19 OS=Branchiostoma belcheri GN=RPS19 PE=2 SV=1 Back     alignment and function description
>sp|P17074|RS19_RAT 40S ribosomal protein S19 OS=Rattus norvegicus GN=Rps19 PE=2 SV=3 Back     alignment and function description
>sp|Q9CZX8|RS19_MOUSE 40S ribosomal protein S19 OS=Mus musculus GN=Rps19 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y0H3|RS19_MYXGL 40S ribosomal protein S19 OS=Myxine glutinosa GN=rps19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
255560408143 40S ribosomal protein S19, putative [Ric 0.816 0.839 0.866 2e-57
255570268143 40S ribosomal protein S19, putative [Ric 0.816 0.839 0.85 2e-56
255570270143 40S ribosomal protein S19-3, putative [R 0.816 0.839 0.85 2e-56
225457277143 PREDICTED: 40S ribosomal protein S19-3 [ 0.816 0.839 0.866 3e-56
15240154143 40S ribosomal protein S19-3 [Arabidopsis 0.816 0.839 0.858 4e-56
15232844143 40S ribosomal protein S19-1 [Arabidopsis 0.816 0.839 0.841 1e-55
224141061143 predicted protein [Populus trichocarpa] 0.816 0.839 0.841 1e-55
224077760143 predicted protein [Populus trichocarpa] 0.816 0.839 0.841 6e-55
15242322143 40S ribosomal protein S19-2 [Arabidopsis 0.816 0.839 0.833 1e-54
297832838142 40S ribosomal protein S19 [Arabidopsis l 0.802 0.830 0.838 2e-54
>gi|255560408|ref|XP_002521219.1| 40S ribosomal protein S19, putative [Ricinus communis] gi|223539584|gb|EEF41171.1| 40S ribosomal protein S19, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/120 (86%), Positives = 112/120 (93%)

Query: 1   METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAAS 60
           M TAK VKDVSPHEFVKAYAAHLKRSGKIELP W DIVKTGTLKELAPYDPDWYY+RAAS
Sbjct: 1   MATAKTVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGTLKELAPYDPDWYYVRAAS 60

Query: 61  MARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKG 120
           MARKIYLRGGLGVG+FRRIYGG KRNGSRPPHF KSSG++ARHIL QLQ+ NI+++DSKG
Sbjct: 61  MARKIYLRGGLGVGAFRRIYGGSKRNGSRPPHFGKSSGAIARHILQQLQNMNIVDIDSKG 120

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255570268|ref|XP_002526094.1| 40S ribosomal protein S19, putative [Ricinus communis] gi|223534591|gb|EEF36288.1| 40S ribosomal protein S19, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255570270|ref|XP_002526095.1| 40S ribosomal protein S19-3, putative [Ricinus communis] gi|223534592|gb|EEF36289.1| 40S ribosomal protein S19-3, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225457277|ref|XP_002284393.1| PREDICTED: 40S ribosomal protein S19-3 [Vitis vinifera] gi|147858266|emb|CAN83920.1| hypothetical protein VITISV_028810 [Vitis vinifera] gi|297733901|emb|CBI15148.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15240154|ref|NP_200925.1| 40S ribosomal protein S19-3 [Arabidopsis thaliana] gi|297793669|ref|XP_002864719.1| 40S ribosomal protein S19 [Arabidopsis lyrata subsp. lyrata] gi|27923837|sp|Q9FNP8.1|RS193_ARATH RecName: Full=40S ribosomal protein S19-3 gi|9759463|dbj|BAB10379.1| 40S ribosomal protein S19 [Arabidopsis thaliana] gi|34365671|gb|AAQ65147.1| At5g61170 [Arabidopsis thaliana] gi|51970120|dbj|BAD43752.1| 40S ribosomal protein S19 - like [Arabidopsis thaliana] gi|297310554|gb|EFH40978.1| 40S ribosomal protein S19 [Arabidopsis lyrata subsp. lyrata] gi|332010047|gb|AED97430.1| 40S ribosomal protein S19-3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15232844|ref|NP_186857.1| 40S ribosomal protein S19-1 [Arabidopsis thaliana] gi|27923843|sp|Q9SGA6.1|RS191_ARATH RecName: Full=40S ribosomal protein S19-1 gi|6513924|gb|AAF14828.1|AC011664_10 putative 40S ribosomal protein S19 [Arabidopsis thaliana] gi|13878029|gb|AAK44092.1|AF370277_1 putative 40S ribosomal protein S19 [Arabidopsis thaliana] gi|17104595|gb|AAL34186.1| putative 40S ribosomal protein S19 [Arabidopsis thaliana] gi|21593712|gb|AAM65679.1| putative 40S ribosomal protein S19 [Arabidopsis thaliana] gi|332640239|gb|AEE73760.1| 40S ribosomal protein S19-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224141061|ref|XP_002323893.1| predicted protein [Populus trichocarpa] gi|118487378|gb|ABK95517.1| unknown [Populus trichocarpa] gi|222866895|gb|EEF04026.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224077760|ref|XP_002305397.1| predicted protein [Populus trichocarpa] gi|222848361|gb|EEE85908.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15242322|ref|NP_197056.1| 40S ribosomal protein S19-2 [Arabidopsis thaliana] gi|297811693|ref|XP_002873730.1| 40S ribosomal protein S19 [Arabidopsis lyrata subsp. lyrata] gi|27923841|sp|Q9LF30.1|RS192_ARATH RecName: Full=40S ribosomal protein S19-2 gi|9755807|emb|CAC01751.1| 40S RIBOSOMAL PROTEIN S19-like [Arabidopsis thaliana] gi|21554401|gb|AAM63506.1| 40S ribosomal protein S19-like [Arabidopsis thaliana] gi|28466827|gb|AAO44022.1| At5g15520 [Arabidopsis thaliana] gi|110735905|dbj|BAE99928.1| 40S ribosomal protein S19 - like [Arabidopsis thaliana] gi|297319567|gb|EFH49989.1| 40S ribosomal protein S19 [Arabidopsis lyrata subsp. lyrata] gi|332004789|gb|AED92172.1| 40S ribosomal protein S19-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297832838|ref|XP_002884301.1| 40S ribosomal protein S19 [Arabidopsis lyrata subsp. lyrata] gi|297330141|gb|EFH60560.1| 40S ribosomal protein S19 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
TAIR|locus:2159486143 AT5G61170 [Arabidopsis thalian 0.816 0.839 0.858 1.9e-53
TAIR|locus:2078633143 AT3G02080 [Arabidopsis thalian 0.816 0.839 0.841 2.4e-53
TAIR|locus:2180912143 AT5G15520 [Arabidopsis thalian 0.816 0.839 0.833 2.7e-52
DICTYBASE|DDB_G0279207148 rps19 "40S ribosomal protein S 0.891 0.885 0.477 7.7e-32
MGI|MGI:1333780145 Rps19 "ribosomal protein S19" 0.775 0.786 0.578 1.6e-31
RGD|68440145 Rps19 "ribosomal protein S19" 0.775 0.786 0.578 1.6e-31
RGD|2318347145 LOC100362339 "ribosomal protei 0.775 0.786 0.578 2.6e-31
RGD|2321315145 LOC100360843 "ribosomal protei 0.775 0.786 0.578 4.2e-31
UNIPROTKB|Q29308136 RPS19 "40S ribosomal protein S 0.775 0.838 0.570 5.4e-31
UNIPROTKB|Q32PD5145 RPS19 "40S ribosomal protein S 0.775 0.786 0.570 6.9e-31
TAIR|locus:2159486 AT5G61170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 553 (199.7 bits), Expect = 1.9e-53, P = 1.9e-53
 Identities = 103/120 (85%), Positives = 108/120 (90%)

Query:     1 METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAAS 60
             M T K VKDVSPHEFVKAYAAHLKRSGKIELP W DIVKTG LKELAPYDPDWYYIRAAS
Sbjct:     1 MATGKTVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAAS 60

Query:    61 MARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKG 120
             MARK+YLRGGLGVG+FRRIYGG KRNGSRPPHF KSSG VARHIL QLQ  NI++LD+KG
Sbjct:    61 MARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKG 120
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005840 "ribosome" evidence=IEA;ISS
GO:0006412 "translation" evidence=IEA;ISS
GO:0005773 "vacuole" evidence=IDA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0022627 "cytosolic small ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2078633 AT3G02080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180912 AT5G15520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279207 rps19 "40S ribosomal protein S19" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1333780 Rps19 "ribosomal protein S19" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|68440 Rps19 "ribosomal protein S19" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2318347 LOC100362339 "ribosomal protein S19-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2321315 LOC100360843 "ribosomal protein S19-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q29308 RPS19 "40S ribosomal protein S19" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q32PD5 RPS19 "40S ribosomal protein S19" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P39019RS19_HUMANNo assigned EC number0.56520.78230.7931yesno
P40978RS19_ORYSJNo assigned EC number0.67930.89110.8972yesno
Q5R8M9RS19_PONABNo assigned EC number0.56520.78230.7931yesno
O15631RS19_ENTHINo assigned EC number0.51210.83670.8310N/Ano
Q54X51RS19_DICDINo assigned EC number0.47720.89110.8851yesno
O28210RS19E_ARCFUNo assigned EC number0.37870.87070.8707yesno
Q8T5Z4RS19_BRABENo assigned EC number0.54160.81630.8163N/Ano
Q9DFR5RS19_GILMINo assigned EC number0.51560.87070.8707N/Ano
O27653RS19E_METTHNo assigned EC number0.39490.80950.8206yesno
Q9FNP8RS193_ARATHNo assigned EC number0.85830.81630.8391yesno
Q9LF30RS192_ARATHNo assigned EC number0.83330.81630.8391nono
Q9CZX8RS19_MOUSENo assigned EC number0.57390.78230.7931yesno
Q29308RS19_PIGNo assigned EC number0.56520.78230.8455yesno
Q94613RS19_MYAARNo assigned EC number0.50780.87070.8590N/Ano
P58234RS19A_SCHPONo assigned EC number0.54780.78230.7986yesno
Q9SGA6RS191_ARATHNo assigned EC number0.84160.81630.8391nono
O18650RS19_CAEELNo assigned EC number0.4640.84350.8493yesno
P17074RS19_RATNo assigned EC number0.57390.78230.7931yesno
Q32PD5RS19_BOVINNo assigned EC number0.56520.78230.7931yesno
P79016RS19B_SCHPONo assigned EC number0.54780.78230.8041yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016251001
SubName- Full=Putative uncharacterized protein (Chromosome chr17 scaffold_12, whole genome shotgun sequence); (143 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00031140001
SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (234 aa)
   •••• 0.956
GSVIVG00023139001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (136 aa)
   •••• 0.944
GSVIVG00025575001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (307 aa)
   •••• 0.933
GSVIVG00019318001
SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_20, whole genome shotg [...] (245 aa)
•  •  • 0.924
GSVIVG00024035001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (246 aa)
  ••••• 0.924
GSVIVG00001285001
SubName- Full=Chromosome chr8 scaffold_115, whole genome shotgun sequence; (246 aa)
  ••••• 0.921
GSVIVG00019030001
SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (103 aa)
   • •• 0.918
GSVIVG00016417001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (83 aa)
   •••• 0.915
GSVIVG00003384001
SubName- Full=Putative uncharacterized protein (Chromosome undetermined scaffold_143, whole gen [...] (133 aa)
  •• •• 0.908
GSVIVG00004884001
SubName- Full=Chromosome undetermined scaffold_840, whole genome shotgun sequence; (133 aa)
  •• •• 0.907

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
pfam01090140 pfam01090, Ribosomal_S19e, Ribosomal protein S19e 1e-65
COG2238147 COG2238, RPS19A, Ribosomal protein S19E (S16A) [Tr 6e-48
PRK09333150 PRK09333, PRK09333, 30S ribosomal protein S19e; Pr 3e-45
PTZ00095169 PTZ00095, PTZ00095, 40S ribosomal protein S19; Pro 1e-40
>gnl|CDD|144617 pfam01090, Ribosomal_S19e, Ribosomal protein S19e Back     alignment and domain information 
 Score =  195 bits (499), Expect = 1e-65
 Identities = 67/125 (53%), Positives = 83/125 (66%), Gaps = 8/125 (6%)

Query: 7   VKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIY 66
           VKDV   E +KA A  LK+SGKI++P W D VKTG  KEL P DPDW+Y+RAAS+ RK+Y
Sbjct: 3   VKDVPADELIKALAEFLKKSGKIKVPEWADFVKTGVHKELPPEDPDWWYVRAASILRKLY 62

Query: 67  LRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIE--------LDS 118
           LRG +GVG  R+IYGG KR G RP HF K SGS+ R  L QL+   ++E        L  
Sbjct: 63  LRGPVGVGRLRKIYGGRKRRGVRPSHFVKGSGSIIRKALQQLEKAGLVEKDPKGGRRLTP 122

Query: 119 KGQSL 123
           +G+S 
Sbjct: 123 QGRSD 127

Length = 140
>gnl|CDD|225147 COG2238, RPS19A, Ribosomal protein S19E (S16A) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236470 PRK09333, PRK09333, 30S ribosomal protein S19e; Provisional Back     alignment and domain information
>gnl|CDD|140127 PTZ00095, PTZ00095, 40S ribosomal protein S19; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
PF01090139 Ribosomal_S19e: Ribosomal protein S19e; InterPro: 100.0
PTZ00095169 40S ribosomal protein S19; Provisional 100.0
PRK09333150 30S ribosomal protein S19e; Provisional 100.0
KOG3411143 consensus 40S ribosomal protein S19 [Translation, 100.0
COG2238147 RPS19A Ribosomal protein S19E (S16A) [Translation, 100.0
PF0846166 HTH_12: Ribonuclease R winged-helix domain; InterP 97.37
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 97.37
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 96.67
COG1420 346 HrcA Transcriptional regulator of heat shock gene 96.57
TIGR02702 203 SufR_cyano iron-sulfur cluster biosynthesis transc 96.51
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 96.51
PRK11050152 manganese transport regulator MntR; Provisional 96.39
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 96.39
PF0163890 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 96.37
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 96.27
COG1846126 MarR Transcriptional regulators [Transcription] 96.24
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 96.12
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 96.11
PF0549176 RuvB_C: Holliday junction DNA helicase ruvB C-term 96.11
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 95.9
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 95.86
PRK10870176 transcriptional repressor MprA; Provisional 95.7
PRK03902142 manganese transport transcriptional regulator; Pro 95.49
PRK03911 260 heat-inducible transcription repressor; Provisiona 95.44
PRK13777185 transcriptional regulator Hpr; Provisional 95.21
TIGR00331 337 hrcA heat shock gene repressor HrcA. In Bacillus s 95.07
PRK03573144 transcriptional regulator SlyA; Provisional 95.05
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 94.99
PRK00082 339 hrcA heat-inducible transcription repressor; Provi 94.99
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 94.81
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 94.57
PF1433892 Mrr_N: Mrr N-terminal domain 94.46
PRK05638442 threonine synthase; Validated 94.14
COG3388101 Predicted transcriptional regulator [Transcription 94.09
TIGR03433100 padR_acidobact transcriptional regulator, Acidobac 93.8
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 93.78
COG343295 Predicted transcriptional regulator [Transcription 93.59
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 93.48
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 93.35
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 93.34
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 93.03
TIGR03338 212 phnR_burk phosphonate utilization associated trans 92.98
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 92.9
PF0355175 PadR: Transcriptional regulator PadR-like family; 92.75
PF10711102 DUF2513: Hypothetical protein (DUF2513); InterPro: 92.7
COG1733120 Predicted transcriptional regulators [Transcriptio 92.59
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 92.55
COG1693 325 Repressor of nif and glnA expression [Transcriptio 92.47
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 92.45
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 92.41
PRK11014141 transcriptional repressor NsrR; Provisional 92.14
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 91.78
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 91.68
TIGR02812 235 fadR_gamma fatty acid metabolism transcriptional r 91.42
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 91.32
COG1725125 Predicted transcriptional regulators [Transcriptio 91.3
TIGR02719138 repress_PhaQ poly-beta-hydroxybutyrate-responsive 91.25
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 91.21
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 91.06
PF0696966 HemN_C: HemN C-terminal domain; InterPro: IPR01072 90.84
PRK09990 251 DNA-binding transcriptional regulator GlcC; Provis 90.82
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 90.81
PRK03837 241 transcriptional regulator NanR; Provisional 90.64
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 90.28
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 90.28
PRK04984 239 fatty acid metabolism regulator; Provisional 90.22
PRK11569 274 transcriptional repressor IclR; Provisional 90.2
PRK10421 253 DNA-binding transcriptional repressor LldR; Provis 90.08
PRK10225 257 DNA-binding transcriptional repressor UxuR; Provis 90.0
PRK11534 224 DNA-binding transcriptional regulator CsiR; Provis 89.91
COG1802 230 GntR Transcriptional regulators [Transcription] 89.89
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 89.69
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 89.61
PRK09464 254 pdhR transcriptional regulator PdhR; Reviewed 89.48
PRK11523 253 DNA-binding transcriptional repressor ExuR; Provis 89.13
PRK11414 221 colanic acid/biofilm transcriptional regulator; Pr 89.08
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 89.02
PF1000792 DUF2250: Uncharacterized protein conserved in arch 88.98
COG1414 246 IclR Transcriptional regulator [Transcription] 88.93
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 88.75
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 88.72
TIGR02018 230 his_ut_repres histidine utilization repressor, pro 88.68
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 87.48
TIGR02277 280 PaaX_trns_reg phenylacetic acid degradation operon 86.93
PRK14165 217 winged helix-turn-helix domain-containing protein/ 86.21
TIGR02325 238 C_P_lyase_phnF phosphonates metabolism transcripti 85.94
COG2186 241 FadR Transcriptional regulators [Transcription] 85.94
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 85.7
PF13814 191 Replic_Relax: Replication-relaxation 85.54
PF09382106 RQC: RQC domain; InterPro: IPR018982 This entry re 85.54
PRK09416135 lstR lineage-specific thermal regulator protein; P 85.5
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 84.56
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 83.87
PRK14999 241 histidine utilization repressor; Provisional 83.82
COG4901107 Ribosomal protein S25 [Translation, ribosomal stru 83.59
PRK11920153 rirA iron-responsive transcriptional regulator; Re 83.59
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 83.25
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 82.54
PRK11886 319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 82.04
TIGR02404 233 trehalos_R_Bsub trehalose operon repressor, B. sub 81.87
COG1959150 Predicted transcriptional regulator [Transcription 81.71
PF0911496 MotA_activ: Transcription factor MotA, activation 81.43
PRK09764 240 DNA-binding transcriptional repressor MngR; Provis 81.36
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 81.28
PRK0933486 30S ribosomal protein S25e; Provisional 81.08
COG3355126 Predicted transcriptional regulator [Transcription 80.31
>PF01090 Ribosomal_S19e: Ribosomal protein S19e; InterPro: IPR001266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information 
Probab=100.00  E-value=3.7e-74  Score=445.18  Aligned_cols=133  Identities=56%  Similarity=0.956  Sum_probs=122.5

Q ss_pred             ccccccChhHHHHHHHHHHHHcCCCCCCCceeeeccCCCCCCCCCCCchhHHhHHHHHHHHHHhCCCchhhHHHHhcCCC
Q 032124            5 KNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGK   84 (147)
Q Consensus         5 ~tVkDV~~~~fI~~~A~~LK~~gki~~P~W~d~vKTg~~kElaP~~~DW~YiRaASi~RklYl~g~vGV~~lr~~YGg~k   84 (147)
                      +||||||||+||++||+|||++|+|++|+|+||||||++||+||+||||||+||||||||||++||+||++||++|||+|
T Consensus         1 vtvkDV~a~~fI~~~A~~LK~~gki~~P~w~d~vKTg~~kE~~P~~~DW~Y~RaASilRklY~~g~~GV~~lr~~YGg~k   80 (139)
T PF01090_consen    1 VTVKDVPADEFIKALAEFLKKSGKIEPPEWADIVKTGSHKELAPYDPDWWYIRAASILRKLYIRGPVGVGRLRKIYGGRK   80 (139)
T ss_dssp             HCGGGSSHHHHHHHHHHHHTCSSTS--TSCGGGTSSSSS-SSTTCHHTHHHHHHHHHHHHHHHCTSB-HHHHHHHH--EE
T ss_pred             CcceecCHHHHHHHHHHHHHHcCCcCCcchHHHHhhcccccCCCCCCCeeeeeHHHHHHHHHHhcCcchHHHHHHhCCCC
Confidence            49999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCchhHHHHHHHHhHhCCceeeCCCCCeeeChhhhhhhhhhhc
Q 032124           85 RNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENS  137 (147)
Q Consensus        85 rrG~~P~h~~~asgsiiR~~LqqLE~~glV~k~~~~GR~lT~~G~~~LDri~~  137 (147)
                      |||++|+||++|||+|||+||||||++|||++++++||+|||+||++||+||.
T Consensus        81 ~~G~~p~h~~~asg~iiR~~LqqLE~~glv~k~~~~GR~lT~~G~~~lD~iA~  133 (139)
T PF01090_consen   81 RRGVRPSHFVKASGSIIRKILQQLEKAGLVEKDPKGGRRLTPKGQRDLDRIAG  133 (139)
T ss_dssp             EETSSCCEE--CHHHHHHHHHHHHHHTTSEEEETTTEEEE-HHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCcHHHHHHHHHHHHCCCEEecCCCCCEECHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999986

The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family includes a number of eukaryotic and archaebacterial ribosomal proteins; mammalian S19, Drosophila S19, Ascaris lumbricoides S19g (ALEP-1) and S19s, yeast YS16 (RP55A and RP55B), Aspergillus S16 and Haloarcula marismortui HS12.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZ6_S 3U5G_T 3U5C_T 3O30_M 3O2Z_M 3IZB_S 2XZN_T 2XZM_T 2V7F_A.
>PTZ00095 40S ribosomal protein S19; Provisional Back     alignment and domain information
>PRK09333 30S ribosomal protein S19e; Provisional Back     alignment and domain information
>KOG3411 consensus 40S ribosomal protein S19 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2238 RPS19A Ribosomal protein S19E (S16A) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>COG1420 HrcA Transcriptional regulator of heat shock gene [Transcription] Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF05491 RuvB_C: Holliday junction DNA helicase ruvB C-terminus; InterPro: IPR008823 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PRK03911 heat-inducible transcription repressor; Provisional Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>TIGR00331 hrcA heat shock gene repressor HrcA Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK00082 hrcA heat-inducible transcription repressor; Provisional Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PF14338 Mrr_N: Mrr N-terminal domain Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>COG3388 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03433 padR_acidobact transcriptional regulator, Acidobacterial, PadR-family Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>COG3432 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>PF03551 PadR: Transcriptional regulator PadR-like family; InterPro: IPR005149 Phenolic acids, also called substituted hydroxycinnamic acids, are abundant in the plant kingdom because they are involved in the structure of plant cell walls and are present in some vacuoles Back     alignment and domain information
>PF10711 DUF2513: Hypothetical protein (DUF2513); InterPro: IPR019650 The function of this family is not known Back     alignment and domain information
>COG1733 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>COG1693 Repressor of nif and glnA expression [Transcription] Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>TIGR02812 fadR_gamma fatty acid metabolism transcriptional regulator FadR Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>COG1725 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02719 repress_PhaQ poly-beta-hydroxybutyrate-responsive repressor Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PF06969 HemN_C: HemN C-terminal domain; InterPro: IPR010723 Proteins containing this domain are all oxygen-independent coproporphyrinogen-III oxidases (HemN) Back     alignment and domain information
>PRK09990 DNA-binding transcriptional regulator GlcC; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK03837 transcriptional regulator NanR; Provisional Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PRK04984 fatty acid metabolism regulator; Provisional Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PRK10421 DNA-binding transcriptional repressor LldR; Provisional Back     alignment and domain information
>PRK10225 DNA-binding transcriptional repressor UxuR; Provisional Back     alignment and domain information
>PRK11534 DNA-binding transcriptional regulator CsiR; Provisional Back     alignment and domain information
>COG1802 GntR Transcriptional regulators [Transcription] Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PRK09464 pdhR transcriptional regulator PdhR; Reviewed Back     alignment and domain information
>PRK11523 DNA-binding transcriptional repressor ExuR; Provisional Back     alignment and domain information
>PRK11414 colanic acid/biofilm transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>TIGR02018 his_ut_repres histidine utilization repressor, proteobacterial Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>TIGR02277 PaaX_trns_reg phenylacetic acid degradation operon negative regulatory protein PaaX Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>TIGR02325 C_P_lyase_phnF phosphonates metabolism transcriptional regulator PhnF Back     alignment and domain information
>COG2186 FadR Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF13814 Replic_Relax: Replication-relaxation Back     alignment and domain information
>PF09382 RQC: RQC domain; InterPro: IPR018982 This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes Back     alignment and domain information
>PRK09416 lstR lineage-specific thermal regulator protein; Provisional Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>PRK14999 histidine utilization repressor; Provisional Back     alignment and domain information
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>TIGR02404 trehalos_R_Bsub trehalose operon repressor, B Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF09114 MotA_activ: Transcription factor MotA, activation domain; InterPro: IPR015198 Transcription factor MotA is required for the activation of middle promoters in Bacteriophage T4, in addition to phage T4 co-activator AsiA, and sigma-70-containing Escherichia coli RNA polymerase Back     alignment and domain information
>PRK09764 DNA-binding transcriptional repressor MngR; Provisional Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
3iz6_S146 Localization Of The Small Subunit Ribosomal Protein 5e-50
3jyv_T141 Structure Of The 40s Rrna And Proteins And PE TRNA 3e-25
3izb_S144 Localization Of The Small Subunit Ribosomal Protein 3e-25
2xzm_T155 Crystal Structure Of The Eukaryotic 40s Ribosomal S 3e-20
3zey_O167 High-resolution Cryo-electron Microscopy Structure 2e-17
2v7f_A150 Structure Of P. Abyssi Rps19 Protein Length = 150 5e-17
3j20_U150 Promiscuous Behavior Of Proteins In Archaeal Riboso 5e-17
>pdb|3IZ6|S Chain S, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 146 Back     alignment and structure 
Iteration: 1

 Score =  192 bits (489), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 89/131 (67%), Positives = 106/131 (80%)
Query: 3   TAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMA 62
           TA+ VKDV+PHEFVKAY+AHLKRSGK+ELP W DIVKT   KEL PYDPDWYY RAAS+A
Sbjct: 5   TARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIA 64
Query: 63  RKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQS 122
           RKIYLR G+GVG F++IYGG +RNGSRPPHF KSSG+++R+IL QLQ   II++D KG  
Sbjct: 65  RKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDPKGGR 124
Query: 123 LVLVERLHKLD 133
           L+  +    LD
Sbjct: 125 LITSQGRRDLD 135
>pdb|3JYV|T Chain T, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 141 Back     alignment and structure
>pdb|3IZB|S Chain S, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 144 Back     alignment and structure
>pdb|2XZM|T Chain T, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 155 Back     alignment and structure
>pdb|3ZEY|O Chain O, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 167 Back     alignment and structure
>pdb|2V7F|A Chain A, Structure Of P. Abyssi Rps19 Protein Length = 150 Back     alignment and structure
>pdb|3J20|U Chain U, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (30s Ribosomal Subunit) Length = 150 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2v7f_A150 RPS19, RPS19E SSU ribosomal protein S19E; diamond 4e-53
3iz6_S146 40S ribosomal protein S19 (S19E); eukaryotic ribos 5e-53
2xzm_T155 RPS19E; ribosome, translation; 3.93A {Tetrahymena 1e-50
3u5c_T144 40S ribosomal protein S19-A; translation, ribosome 7e-50
>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 Length = 150 Back     alignment and structure
 Score =  163 bits (415), Expect = 4e-53
 Identities = 44/115 (38%), Positives = 57/115 (49%)

Query: 6   NVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKI 65
            V DV     V+  A  LK   +I+ P W   VKTG  KE  P   DW+Y R AS+ R++
Sbjct: 3   TVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRV 62

Query: 66  YLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKG 120
           YL G +G+   R  YGG K  G  P  F K+ GS+ R  L QL+    +E     
Sbjct: 63  YLDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGK 117
>3iz6_S 40S ribosomal protein S19 (S19E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 146 Back     alignment and structure
>2xzm_T RPS19E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_T Length = 155 Back     alignment and structure
>3u5c_T 40S ribosomal protein S19-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_S 3o30_M 3o2z_M 3u5g_T 3jyv_T* Length = 144 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
3u5c_T144 40S ribosomal protein S19-A; translation, ribosome 100.0
2xzm_T155 RPS19E; ribosome, translation; 3.93A {Tetrahymena 100.0
3iz6_S146 40S ribosomal protein S19 (S19E); eukaryotic ribos 100.0
2v7f_A150 RPS19, RPS19E SSU ribosomal protein S19E; diamond 100.0
2pg4_A95 Uncharacterized protein; structural genomics, join 97.33
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 97.21
2h09_A155 Transcriptional regulator MNTR; transcription regu 97.2
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 97.12
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 97.06
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 96.92
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 96.91
3oop_A143 LIN2960 protein; protein structure initiative, PSI 96.91
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 96.89
2nyx_A168 Probable transcriptional regulatory protein, RV14; 96.75
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 96.74
2hr3_A147 Probable transcriptional regulator; MCSG, structur 96.71
3s2w_A159 Transcriptional regulator, MARR family; structural 96.7
3ech_A142 MEXR, multidrug resistance operon repressor; winge 96.7
2frh_A127 SARA, staphylococcal accessory regulator A; winged 96.69
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 96.69
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 96.69
3e6m_A161 MARR family transcriptional regulator; APC88769, s 96.67
2gxg_A146 146AA long hypothetical transcriptional regulator; 96.67
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 96.67
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 96.65
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 96.64
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 96.62
1sfx_A109 Conserved hypothetical protein AF2008; structural 96.59
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 96.59
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 96.56
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 96.56
3bja_A139 Transcriptional regulator, MARR family, putative; 96.54
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 96.53
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 96.51
2eth_A154 Transcriptional regulator, putative, MAR family; M 96.51
2nnn_A140 Probable transcriptional regulator; structural gen 96.47
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 96.47
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 96.46
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 96.45
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 96.44
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 96.43
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 96.43
3cjn_A162 Transcriptional regulator, MARR family; silicibact 96.42
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 96.39
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 96.39
1z91_A147 Organic hydroperoxide resistance transcriptional; 96.38
1stz_A 338 Heat-inducible transcription repressor HRCA homol; 96.37
2pex_A153 Transcriptional regulator OHRR; transcription regu 96.36
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 96.34
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 96.32
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 96.31
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 96.3
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 96.3
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 96.25
3bdd_A142 Regulatory protein MARR; putative multiple antibio 96.24
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 96.23
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 96.2
1y0u_A96 Arsenical resistance operon repressor, putative; s 96.19
1s3j_A155 YUSO protein; structural genomics, MARR transcript 96.18
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 96.14
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 96.14
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 96.12
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 96.11
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.09
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 95.98
3df8_A111 Possible HXLR family transcriptional factor; APC89 95.95
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 95.87
2o0m_A 345 Transcriptional regulator, SORC family; structural 95.84
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 95.8
2p8t_A 200 Hypothetical protein PH0730; pyrococcus horikoshii 95.78
3nqo_A189 MARR-family transcriptional regulator; structural 95.78
3f3x_A144 Transcriptional regulator, MARR family, putative; 95.76
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 95.73
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 95.67
3boq_A160 Transcriptional regulator, MARR family; MARR famil 95.66
1bja_A95 Transcription regulatory protein MOTA; activation 95.51
1yyv_A131 Putative transcriptional regulator; reductive meth 95.42
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 95.36
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependen 95.29
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 95.27
2fxa_A207 Protease production regulatory protein HPR; protea 95.2
2obp_A96 Putative DNA-binding protein; structural genomics, 95.11
2wte_A244 CSA3; antiviral protein, viral resistance, winged 94.96
1okr_A123 MECI, methicillin resistance regulatory protein ME 94.86
2qq9_A 226 Diphtheria toxin repressor; regulator, DTXR, helix 94.78
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 94.69
3f8b_A116 Transcriptional regulator, PADR-like family; winge 94.66
4aik_A151 Transcriptional regulator SLYA; transcription, tra 94.5
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 94.49
1yg2_A179 Gene activator APHA; virulence factor, winged heli 94.46
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 94.37
3ic7_A126 Putative transcriptional regulator; helix-turn-hel 94.36
3by6_A126 Predicted transcriptional regulator; structural ge 94.3
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 94.18
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 94.1
2jt1_A77 PEFI protein; solution structure, winged helix-tur 93.86
1mkm_A 249 ICLR transcriptional regulator; structural genomic 93.78
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 93.76
3f6v_A151 Possible transcriptional regulator, ARSR family pr 93.65
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 93.64
4esb_A115 Transcriptional regulator, PADR family; DNA bindin 93.39
2kko_A108 Possible transcriptional regulatory protein (possi 93.35
4fx0_A148 Probable transcriptional repressor protein; helix- 93.35
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 93.3
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 93.26
1hsj_A487 Fusion protein consisting of staphylococcus access 93.12
3f6o_A118 Probable transcriptional regulator, ARSR family pr 92.97
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 92.97
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 92.89
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 92.85
3ihu_A 222 Transcriptional regulator, GNTR family; YP_298823. 92.85
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 92.8
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 92.69
3jth_A98 Transcription activator HLYU; transcription factor 92.67
1xma_A145 Predicted transcriptional regulator; southea colla 92.57
4esf_A117 PADR-like transcriptional regulator; PADR family, 92.46
1ylf_A149 RRF2 family protein; structural genomics, transcri 92.41
1ku9_A152 Hypothetical protein MJ223; putative transcription 92.35
2co5_A99 Viral protein F93; viral protein-winged helix comp 92.16
3eet_A 272 Putative GNTR-family transcriptional regulator; st 91.99
3cta_A 230 Riboflavin kinase; structural genomics, transferas 91.88
3sxy_A 218 Transcriptional regulator, GNTR family; transcript 91.84
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 91.61
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 91.56
2hs5_A 239 Putative transcriptional regulator GNTR; APC6050, 91.48
3c7j_A 237 Transcriptional regulator, GNTR family; structural 91.48
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 91.33
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 91.27
3elk_A117 Putative transcriptional regulator TA0346; structu 91.21
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 91.14
2dql_A115 PEX protein; circadian clock associated protein, c 91.07
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 91.03
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 90.95
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 90.13
3k69_A162 Putative transcription regulator; putative transcr 90.09
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 90.09
1hw1_A 239 FADR, fatty acid metabolism regulator protein; hel 90.06
2g7u_A 257 Transcriptional regulator; ICLR family, structural 90.02
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 90.0
2zfw_A148 PEX; five alpha-helices + one beta-sheet, circadia 89.9
2di3_A 239 Bacterial regulatory proteins, GNTR family; helix- 89.72
3l9f_A204 Putative uncharacterized protein SMU.1604C; PADR, 89.68
1p6r_A82 Penicillinase repressor; transcription regulation, 89.59
3edp_A 236 LIN2111 protein; APC88337, listeria innocua CLIP11 89.56
3lwf_A159 LIN1550 protein, putative transcriptional regulato 88.92
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 88.82
2wv0_A 243 YVOA, HTH-type transcriptional repressor YVOA; DNA 88.66
3ri2_A123 Transcriptional regulator, PADR-like family; PSI-b 88.56
2e1n_A138 PEX, period extender; circadian clock, DNA binding 88.18
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 87.42
3l09_A 266 Putative transcriptional regulator; structural gen 87.13
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 86.91
3aaf_A134 Werner syndrome ATP-dependent helicase; helix-turn 86.87
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, st 86.85
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 86.84
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 86.27
1p4x_A 250 Staphylococcal accessory regulator A homologue; wi 84.79
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 84.79
1xd7_A145 YWNA; structural genomics, protein structure initi 84.14
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 83.64
3bwg_A 239 Uncharacterized HTH-type transcriptional regulato; 83.42
3f8m_A 248 GNTR-family protein transcriptional regulator; PHN 82.84
2qm3_A 373 Predicted methyltransferase; putative methyltransf 81.93
2p4w_A 202 Transcriptional regulatory protein ARSR family; ar 80.87
>3u5c_T 40S ribosomal protein S19-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_S 3o30_M 3o2z_M 3u5g_T 3jyv_T* Back     alignment and structure
Probab=100.00  E-value=7.3e-76  Score=455.80  Aligned_cols=136  Identities=40%  Similarity=0.753  Sum_probs=133.4

Q ss_pred             CCCCccccccChhHHHHHHHHHHHHcCCCCCCCceeeeccCCCCCCCCCCCc-hhHHhHHHHHHHHHHhCCCchhhHHHH
Q 032124            1 METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPD-WYYIRAASMARKIYLRGGLGVGSFRRI   79 (147)
Q Consensus         1 m~~~~tVkDV~~~~fI~~~A~~LK~~gki~~P~W~d~vKTg~~kElaP~~~D-W~YiRaASi~RklYl~g~vGV~~lr~~   79 (147)
                      ||++ ||||||||+||++||+|||++|||++|+|+||||||++||+||+||| |||+||||||||||++||+||++||++
T Consensus         1 m~~~-tvkDV~a~~fI~~~A~~LK~~gki~~P~W~d~vKTg~~kEl~P~d~D~W~Y~RaASi~R~lYl~g~vGV~~lrk~   79 (144)
T 3u5c_T            1 MPGV-SVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAASVARHIYMRKQVGVGKLNKL   79 (144)
T ss_dssp             -CCC-CSTTSCHHHHHHHHHHHHHHHCCCCCTTTTTSCCSCTTCSSCCSSCSSSHHHHHHHHHHHHHTSSBCCHHHHHHH
T ss_pred             CCCC-ceeecCHHHHHHHHHHHHHHcCCCCCCchHhHhhccccccCCCCCCcchHHHHHHHHHHHHHhcCCCcHHHHHHH
Confidence            8887 99999999999999999999999999999999999999999999999 999999999999999999999999999


Q ss_pred             hcCCCCCCCCCCCCCCCchhHHHHHHHHhHhCCceeeCCCCCeeeChhhhhhhhhhhc
Q 032124           80 YGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENS  137 (147)
Q Consensus        80 YGg~krrG~~P~h~~~asgsiiR~~LqqLE~~glV~k~~~~GR~lT~~G~~~LDri~~  137 (147)
                      |||+||||++|+||++|||+|||+||||||++|||++++++||+|||+||++||+||.
T Consensus        80 YGg~krrG~~P~h~~~asg~iiR~~LQqLE~~g~vek~~~~GR~lT~~G~~~LD~iA~  137 (144)
T 3u5c_T           80 YGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAA  137 (144)
T ss_dssp             HCCEEEETTEEEEECCCCHHHHHHHHHHHHHTTSEECCSSSSCEECHHHHHHHHHHHH
T ss_pred             HCCCCCCCCCCccccccCcHHHHHHHHHHHHCCCeeecCCCCcEECHhHHHHHHHHHH
Confidence            9999999999999999999999999999999999999998999999999999999985
>2xzm_T RPS19E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_T Back     alignment and structure
>3iz6_S 40S ribosomal protein S19 (S19E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>1stz_A Heat-inducible transcription repressor HRCA homol; circe element, structural genomics, BSGC structure FUN NIH, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.51 d.110.2.3 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>3ihu_A Transcriptional regulator, GNTR family; YP_298823.1, DNA binding protein, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.92A {Ralstonia eutropha} Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 Back     alignment and structure
>3eet_A Putative GNTR-family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.97A {Streptomyces avermitilis} Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>3sxy_A Transcriptional regulator, GNTR family; transcription factor, metal-binding, structur genomics, PSI-2, protein structure initiative; 1.65A {Thermotoga maritima} PDB: 3dbw_A 3fms_A* Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>2hs5_A Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RH structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} SCOP: a.4.5.6 a.78.1.1 Back     alignment and structure
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, PSI-2, protein structure initiative, midwest center for STR genomics; HET: MSE; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2dql_A PEX protein; circadian clock associated protein, circadian clock protein; 1.70A {Anabaena SP} Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2zfw_A PEX; five alpha-helices + one beta-sheet, circadian clock protein; 2.90A {Synechococcus SP} Back     alignment and structure
>2di3_A Bacterial regulatory proteins, GNTR family; helix-turn-helix, transcription; 2.05A {Corynebacterium glutamicum} Back     alignment and structure
>3l9f_A Putative uncharacterized protein SMU.1604C; PADR, transcription regulator; 1.80A {Streptococcus mutans} Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>3edp_A LIN2111 protein; APC88337, listeria innocua CLIP11262, structural GE PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.09A {Listeria innocua} Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2wv0_A YVOA, HTH-type transcriptional repressor YVOA; DNA-binding, transcription regulation, transcriptional regulator, GNTR/HUTC family; 2.40A {Bacillus subtilis} Back     alignment and structure
>2e1n_A PEX, period extender; circadian clock, DNA binding protein, circadian clock protei; 1.80A {Synechococcus elongatus pcc 7942} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3l09_A Putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG, protein structure initiative transcription regulator; 2.81A {Jannaschia SP} Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>3aaf_A Werner syndrome ATP-dependent helicase; helix-turn-helix, winged-helix, protein-DNA complex, DNA-BIN helicase; HET: DNA; 1.90A {Homo sapiens} PDB: 2axl_A Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3bwg_A Uncharacterized HTH-type transcriptional regulato; APC85486, YYDK, transcriptional regulator, structural genomi 2; 2.09A {Bacillus subtilis subsp} SCOP: a.4.5.6 d.190.1.2 Back     alignment and structure
>3f8m_A GNTR-family protein transcriptional regulator; PHNF, HUTC, winged helix-TUR UTRA, DNA-binding, transcription regulation; 1.80A {Mycobacterium smegmatis} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d2v7fa1149 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococ 3e-58
>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]} Length = 149 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Rps19E-like
domain: Ribosomal protein S19e
species: Pyrococcus abyssi [TaxId: 29292]

 Score =  175 bits (446), Expect = 3e-58
 Identities = 44/114 (38%), Positives = 57/114 (50%)

Query: 7   VKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIY 66
           V DV     V+  A  LK   +I+ P W   VKTG  KE  P   DW+Y R AS+ R++Y
Sbjct: 3   VYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVY 62

Query: 67  LRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKG 120
           L G +G+   R  YGG K  G  P  F K+ GS+ R  L QL+    +E     
Sbjct: 63  LDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGK 116

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d2v7fa1149 Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 100.0
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 97.61
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 96.81
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 96.77
d2p8ta169 Hypothetical protein PH0730 {Pyrococcus horikoshii 96.74
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 96.72
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 96.7
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 96.6
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 96.39
d1mkma175 Transcriptional regulator IclR, N-terminal domain 96.36
d1z91a1137 Organic hydroperoxide resistance transcriptional r 96.33
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 96.21
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 96.07
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 95.85
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 95.75
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 95.72
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 95.45
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 95.35
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 95.33
d1in4a175 Holliday junction helicase RuvB {Thermotoga mariti 95.18
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 95.0
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 94.69
d1xd7a_127 Hypothetical protein ywnA {Bacillus subtilis [TaxI 94.66
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 94.55
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 94.46
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 94.4
d1z7ua1108 Hypothetical protein EF0647 {Enterococcus faecalis 94.33
d1xmaa_103 Predicted transcriptional regulator {Clostridium t 94.25
d1ixsb176 Holliday junction helicase RuvB {Thermus thermophi 94.22
d2hzta195 Putative transcriptional regulator YtcD {Bacillus 94.14
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 94.05
d1v4ra1100 Transcriptional repressor TraR, N-terminal domain 93.98
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 93.52
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 93.43
d1yyva1114 Putative transcriptional regulator YtfH {Salmonell 93.42
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 93.34
d1yg2a_178 Hypothetical protein AphA {Vibrio cholerae [TaxId: 93.25
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 93.08
d2fswa1102 Hypothetical protein PG0823 {Porphyromonas gingiva 92.84
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 92.67
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 91.75
d2f2ea1142 Hypothetical protein PA1607 {Pseudomonas aeruginos 91.55
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 90.58
d2axla1144 Werner syndrome ATP-dependent helicase WRN {Human 90.25
d2esha1114 Hypothetical protein TM0937 {Thermotoga maritima [ 89.22
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 89.16
d1hw1a174 Fatty acid responsive transcription factor FadR, N 88.49
d1ylfa1138 Hypothetical protein BC1842 {Bacillus cereus [TaxI 86.43
d2obpa181 Putative DNA-binding protein ReutB4095 {Ralstonia 85.29
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 84.88
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 82.28
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 82.02
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 82.0
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 81.81
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 81.29
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 80.42
d2fnaa173 Hypothetical protein SSO1545, C-terminal domain {S 80.21
>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Rps19E-like
domain: Ribosomal protein S19e
species: Pyrococcus abyssi [TaxId: 29292]

Probab=100.00  E-value=1.4e-73  Score=443.20  Aligned_cols=133  Identities=35%  Similarity=0.574  Sum_probs=121.3

Q ss_pred             cccccChhHHHHHHHHHHHHcCCCCCCCceeeeccCCCCCCCCCCCchhHHhHHHHHHHHHHhCCCchhhHHHHhcCCCC
Q 032124            6 NVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKR   85 (147)
Q Consensus         6 tVkDV~~~~fI~~~A~~LK~~gki~~P~W~d~vKTg~~kElaP~~~DW~YiRaASi~RklYl~g~vGV~~lr~~YGg~kr   85 (147)
                      ||||||||+||++||+|||++|+|++|+|+||||||++||+||+||||||+||||||||||++||+||++||++|||+||
T Consensus         2 Tv~DVpa~~~I~~lA~~LK~~~ki~~P~W~~~vKTg~~kE~~P~~~DW~y~RaASilRkiY~~gpvGv~~Lr~~YGg~k~   81 (149)
T d2v7fa1           2 TVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKN   81 (149)
T ss_dssp             CGGGSCHHHHHHHHHHHHTTCTTCCCCSCGGGCCC------CHHHHTHHHHHHHHHHHHHHHHCSBCHHHHHHHHCC---
T ss_pred             CccccCHHHHHHHHHHHHHhcCCCCCCcchhhhcccccccCCCCCCchHHHHHHHHHHHHHHcCCccHHHHHHHHCCCCC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCchhHHHHHHHHhHhCCceeeCCCCCeeeChhhhhhhhhhhcC
Q 032124           86 NGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGQSLVLVERLHKLDCENSN  138 (147)
Q Consensus        86 rG~~P~h~~~asgsiiR~~LqqLE~~glV~k~~~~GR~lT~~G~~~LDri~~~  138 (147)
                      ||++|+||++|||+|||+||||||++|||++++++||+||++||++||+||..
T Consensus        82 rG~~P~h~~~~Sg~iiR~~LQqLE~~glVek~~~~GR~lT~~G~~~LD~iA~~  134 (149)
T d2v7fa1          82 RGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATE  134 (149)
T ss_dssp             -CCCTTSCCCHHHHHHHHHHHHHHHTTSEEEETTTEEEECHHHHHHHHHHHHH
T ss_pred             CCCCCCCcCCCccHHHHHHHHHHHhCCCeeEcCCCCcEECHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999989999999999999999863
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1in4a1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ixsb1 a.4.5.11 (B:243-318) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yg2a_ a.4.5.61 (A:) Hypothetical protein AphA {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa1 a.4.5.11 (A:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure