Citrus Sinensis ID: 032161


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MGMGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILLSSS
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MGMGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLsfflnrknrppltFALLCKVFILSLIGITLMQICVYtgvsfssptlvsatnnlIPAFTFLLAVIFRFFFFFIFVVFYFLIILLSSS
MGMGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILLSSS
MGMGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAftfllavifrfffffifvvfyfliillSSS
****VKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILL***
*************PYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILLSS*
MGMGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILLSSS
****VKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILLS**
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILLSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q945L4 339 WAT1-related protein At5g yes no 0.746 0.321 0.513 4e-22
Q8GXB4 374 WAT1-related protein At1g no no 0.787 0.307 0.443 1e-19
Q9FL08 368 WAT1-related protein At5g no no 0.821 0.326 0.459 5e-19
Q9FL41 402 WAT1-related protein At5g no no 0.773 0.281 0.389 6e-19
F4KHA8 370 WAT1-related protein At5g no no 0.773 0.305 0.470 3e-18
F4HZQ7 389 WAT1-related protein At1g no no 0.842 0.316 0.380 3e-17
O80638 374 WAT1-related protein At2g no no 0.773 0.302 0.362 4e-17
Q94JU2 367 WAT1-related protein At3g no no 0.835 0.332 0.444 2e-16
F4I5D5 375 WAT1-related protein At1g no no 0.835 0.325 0.368 3e-16
Q94AP3 389 Protein WALLS ARE THIN 1 no no 0.767 0.287 0.401 6e-16
>sp|Q945L4|WTR40_ARATH WAT1-related protein At5g40210 OS=Arabidopsis thaliana GN=At5g40210 PE=2 SV=1 Back     alignment and function desciption
 Score =  103 bits (257), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 2/111 (1%)

Query: 17  AMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNR-KNRPPLTFA 75
           AMV  +   VG+ TL KAA S+G +P ++ VY+    SL+LLPL+FF  R ++ PPLTF+
Sbjct: 16  AMVVTEFSNVGVNTLVKAATSKGLSPFVVLVYSYTFGSLLLLPLTFFSFRSRSLPPLTFS 75

Query: 76  LLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFR 126
           +LC + IL LI  +  QI  Y G+ +SSPTL SA +N+ PAFTF+LAV+FR
Sbjct: 76  ILCNMGILGLIA-SAFQILGYNGIKYSSPTLSSAMSNVNPAFTFILAVVFR 125





Arabidopsis thaliana (taxid: 3702)
>sp|Q8GXB4|WTR2_ARATH WAT1-related protein At1g09380 OS=Arabidopsis thaliana GN=At1g09380 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL08|WTR42_ARATH WAT1-related protein At5g40240 OS=Arabidopsis thaliana GN=At5g40240 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL41|WTR38_ARATH WAT1-related protein At5g07050 OS=Arabidopsis thaliana GN=At5g07050 PE=2 SV=1 Back     alignment and function description
>sp|F4KHA8|WTR41_ARATH WAT1-related protein At5g40230 OS=Arabidopsis thaliana GN=At5g40230 PE=2 SV=1 Back     alignment and function description
>sp|F4HZQ7|WTR5_ARATH WAT1-related protein At1g21890 OS=Arabidopsis thaliana GN=At1g21890 PE=2 SV=1 Back     alignment and function description
>sp|O80638|WTR14_ARATH WAT1-related protein At2g39510 OS=Arabidopsis thaliana GN=At2g39510 PE=2 SV=1 Back     alignment and function description
>sp|Q94JU2|WTR18_ARATH WAT1-related protein At3g28050 OS=Arabidopsis thaliana GN=At3g28050 PE=2 SV=1 Back     alignment and function description
>sp|F4I5D5|WTR11_ARATH WAT1-related protein At1g70260 OS=Arabidopsis thaliana GN=At1g70260 PE=2 SV=1 Back     alignment and function description
>sp|Q94AP3|WAT1_ARATH Protein WALLS ARE THIN 1 OS=Arabidopsis thaliana GN=WAT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
224135771 355 predicted protein [Populus trichocarpa] 0.842 0.346 0.637 1e-36
225457103 362 PREDICTED: auxin-induced protein 5NG4-li 0.849 0.342 0.637 3e-36
357477327 353 Auxin-induced protein 5NG4 [Medicago tru 0.849 0.351 0.568 8e-32
297733820 338 unnamed protein product [Vitis vinifera] 0.849 0.366 0.580 2e-31
359491260 359 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.746 0.303 0.587 1e-26
356565026 565 PREDICTED: auxin-induced protein 5NG4-li 0.732 0.189 0.522 8e-25
255581160 356 Auxin-induced protein 5NG4, putative [Ri 0.780 0.320 0.495 2e-23
224099697 355 predicted protein [Populus trichocarpa] 0.821 0.338 0.5 3e-23
449449196 377 PREDICTED: auxin-induced protein 5NG4-li 0.856 0.331 0.456 2e-22
357463769 345 Auxin-induced protein 5NG4 [Medicago tru 0.773 0.327 0.491 2e-22
>gi|224135771|ref|XP_002322156.1| predicted protein [Populus trichocarpa] gi|222869152|gb|EEF06283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 3   MGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSF 62
           MGVK +++ L+P+AAMV V+C+ VG+TTLSKAA+S+G +  +  VY++A+A+LILLP S 
Sbjct: 1   MGVKSVLLNLLPFAAMVMVECLDVGLTTLSKAAMSKGMSQFVFVVYSNALATLILLP-SL 59

Query: 63  FLNRKNRPPLTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLA 122
              R  RPP+T++LLCK F+LSL+GITLMQ CV+TGVS+SSPTL SA   LIPAFTFLLA
Sbjct: 60  IFYRTKRPPVTYSLLCKFFLLSLVGITLMQNCVFTGVSYSSPTLASAMGQLIPAFTFLLA 119

Query: 123 VIFR 126
           VIFR
Sbjct: 120 VIFR 123




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225457103|ref|XP_002283377.1| PREDICTED: auxin-induced protein 5NG4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357477327|ref|XP_003608949.1| Auxin-induced protein 5NG4 [Medicago truncatula] gi|355510004|gb|AES91146.1| Auxin-induced protein 5NG4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297733820|emb|CBI15067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491260|ref|XP_003634251.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356565026|ref|XP_003550746.1| PREDICTED: auxin-induced protein 5NG4-like [Glycine max] Back     alignment and taxonomy information
>gi|255581160|ref|XP_002531393.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223528986|gb|EEF30977.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224099697|ref|XP_002311582.1| predicted protein [Populus trichocarpa] gi|222851402|gb|EEE88949.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449449196|ref|XP_004142351.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357463769|ref|XP_003602166.1| Auxin-induced protein 5NG4 [Medicago truncatula] gi|355491214|gb|AES72417.1| Auxin-induced protein 5NG4 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2173737 339 UMAMIT42 "Usually multiple aci 0.678 0.292 0.485 8.3e-19
TAIR|locus:2012255 374 UMAMIT25 "Usually multiple aci 0.719 0.280 0.409 3.9e-17
TAIR|locus:2031144 343 UMAMIT22 "Usually multiple aci 0.684 0.291 0.44 9.3e-17
TAIR|locus:2091363 367 UMAMIT41 "AT3G28050" [Arabidop 0.705 0.280 0.420 1.3e-16
TAIR|locus:2173752 370 UMAMIT37 "AT5G40230" [Arabidop 0.705 0.278 0.429 5e-16
TAIR|locus:2169414 402 UMAMIT9 "Usually multiple acid 0.705 0.256 0.359 6.7e-16
TAIR|locus:2039792 374 UMAMIT14 "AT2G39510" [Arabidop 0.705 0.275 0.339 3.1e-15
TAIR|locus:2092702 383 UMAMIT4 "AT3G18200" [Arabidops 0.780 0.297 0.370 4.4e-15
TAIR|locus:2005689 389 WAT1 "Walls Are Thin 1" [Arabi 0.698 0.262 0.392 1.7e-14
TAIR|locus:2091383 360 UMAMIT46 "AT3G28070" [Arabidop 0.678 0.275 0.435 2.1e-14
TAIR|locus:2173737 UMAMIT42 "Usually multiple acids move in and out Transporters 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 8.3e-19, P = 8.3e-19
 Identities = 49/101 (48%), Positives = 68/101 (67%)

Query:    17 AMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNR-KNRPPLTFA 75
             AMV  +   VG+ TL KAA S+G +P ++ VY+    SL+LLPL+FF  R ++ PPLTF+
Sbjct:    16 AMVVTEFSNVGVNTLVKAATSKGLSPFVVLVYSYTFGSLLLLPLTFFSFRSRSLPPLTFS 75

Query:    76 LLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPA 116
             +LC + IL LI  +  QI  Y G+ +SSPTL SA +N+ PA
Sbjct:    76 ILCNMGILGLIA-SAFQILGYNGIKYSSPTLSSAMSNVNPA 115




GO:0016020 "membrane" evidence=IEA
GO:0006863 "purine nucleobase transport" evidence=RCA
TAIR|locus:2012255 UMAMIT25 "Usually multiple acids move in and out Transporters 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031144 UMAMIT22 "Usually multiple acids move in and out Transporters 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091363 UMAMIT41 "AT3G28050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173752 UMAMIT37 "AT5G40230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169414 UMAMIT9 "Usually multiple acids move in and out Transporters 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039792 UMAMIT14 "AT2G39510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092702 UMAMIT4 "AT3G18200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005689 WAT1 "Walls Are Thin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091383 UMAMIT46 "AT3G28070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XV.1426.1
SubName- Full=Putative uncharacterized protein; (331 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
PLN00411 358 PLN00411, PLN00411, nodulin MtN21 family protein; 4e-19
>gnl|CDD|177805 PLN00411, PLN00411, nodulin MtN21 family protein; Provisional Back     alignment and domain information
 Score = 81.2 bits (200), Expect = 4e-19
 Identities = 49/111 (44%), Positives = 73/111 (65%), Gaps = 2/111 (1%)

Query: 17  AMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNR-KNRPPLTFA 75
           AM+A +   VGI+TL K A S+G        Y+  +ASL+LLP  FF NR ++ PPL+ +
Sbjct: 17  AMLATETSVVGISTLFKVATSKGLNIYPFLGYSYLLASLLLLPSLFFTNRSRSLPPLSVS 76

Query: 76  LLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIFR 126
           +L K+ +L  +G ++  I  Y G+ +S+PTL SA +N+ PA TF+LA+IFR
Sbjct: 77  ILSKIGLLGFLG-SMYVITGYIGIEYSNPTLASAISNITPALTFILAIIFR 126


Length = 358

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PLN00411 358 nodulin MtN21 family protein; Provisional 99.85
TIGR00688 256 rarD rarD protein. This uncharacterized protein is 99.73
PRK11272 292 putative DMT superfamily transporter inner membran 99.71
PRK15430 296 putative chloramphenical resistance permease RarD; 99.71
PF00892126 EamA: EamA-like transporter family; InterPro: IPR0 99.69
PRK11689 295 aromatic amino acid exporter; Provisional 99.66
PRK11453 299 O-acetylserine/cysteine export protein; Provisiona 99.6
TIGR00950 260 2A78 Carboxylate/Amino Acid/Amine Transporter. 99.59
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 99.57
PRK10532 293 threonine and homoserine efflux system; Provisiona 99.46
TIGR00817 302 tpt Tpt phosphate/phosphoenolpyruvate translocator 99.43
PRK10532293 threonine and homoserine efflux system; Provisiona 99.4
PRK11272292 putative DMT superfamily transporter inner membran 99.4
COG2510140 Predicted membrane protein [Function unknown] 99.37
PTZ00343 350 triose or hexose phosphate/phosphate translocator; 99.34
TIGR03340 281 phn_DUF6 phosphonate utilization associated putati 99.32
PRK11689295 aromatic amino acid exporter; Provisional 99.31
PRK11453299 O-acetylserine/cysteine export protein; Provisiona 99.26
PLN00411358 nodulin MtN21 family protein; Provisional 99.26
COG0697 292 RhaT Permeases of the drug/metabolite transporter 99.18
TIGR00817302 tpt Tpt phosphate/phosphoenolpyruvate translocator 99.16
PF13536113 EmrE: Multidrug resistance efflux transporter 99.08
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 98.98
PTZ00343350 triose or hexose phosphate/phosphate translocator; 98.89
PRK15430296 putative chloramphenical resistance permease RarD; 98.89
COG0697292 RhaT Permeases of the drug/metabolite transporter 98.87
PF03151153 TPT: Triose-phosphate Transporter family; InterPro 98.72
TIGR00776 290 RhaT RhaT L-rhamnose-proton symporter family prote 98.69
COG2962 293 RarD Predicted permeases [General function predict 98.65
TIGR00776290 RhaT RhaT L-rhamnose-proton symporter family prote 98.62
COG5006292 rhtA Threonine/homoserine efflux transporter [Amin 98.58
PF06027 334 DUF914: Eukaryotic protein of unknown function (DU 98.4
TIGR00688256 rarD rarD protein. This uncharacterized protein is 98.34
PRK15051111 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 97.98
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 97.98
KOG4510 346 consensus Permease of the drug/metabolite transpor 97.98
PRK02971129 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 97.92
COG5006 292 rhtA Threonine/homoserine efflux transporter [Amin 97.73
PF08449303 UAA: UAA transporter family; InterPro: IPR013657 T 97.52
PF08449 303 UAA: UAA transporter family; InterPro: IPR013657 T 97.51
COG2962293 RarD Predicted permeases [General function predict 97.26
KOG4510346 consensus Permease of the drug/metabolite transpor 97.04
PF0089393 Multi_Drug_Res: Small Multidrug Resistance protein 96.74
PF04142 244 Nuc_sug_transp: Nucleotide-sugar transporter; Inte 96.54
KOG2234 345 consensus Predicted UDP-galactose transporter [Car 96.51
KOG1441 316 consensus Glucose-6-phosphate/phosphate and phosph 96.25
PF06800269 Sugar_transport: Sugar transport protein; InterPro 95.98
KOG1441316 consensus Glucose-6-phosphate/phosphate and phosph 95.96
KOG3912 372 consensus Predicted integral membrane protein [Gen 95.66
PF10639113 UPF0546: Uncharacterised protein family UPF0546; I 95.31
KOG1443 349 consensus Predicted integral membrane protein [Fun 95.07
TIGR00803222 nst UDP-galactose transporter. NSTs generally appe 95.04
PF04657138 DUF606: Protein of unknown function, DUF606; Inter 95.01
KOG2765 416 consensus Predicted membrane protein [Function unk 94.84
PRK10452120 multidrug efflux system protein MdtJ; Provisional 94.69
KOG3912372 consensus Predicted integral membrane protein [Gen 94.67
COG2076106 EmrE Membrane transporters of cations and cationic 94.59
PRK13499345 rhamnose-proton symporter; Provisional 94.46
PRK09541110 emrE multidrug efflux protein; Reviewed 94.31
PF05653 300 Mg_trans_NIPA: Magnesium transporter NIPA; InterPr 94.16
KOG4314 290 consensus Predicted carbohydrate/phosphate translo 93.71
KOG1444 314 consensus Nucleotide-sugar transporter VRG4/SQV-7 93.66
KOG2765416 consensus Predicted membrane protein [Function unk 93.09
PRK11431105 multidrug efflux system protein; Provisional 92.91
PRK13499 345 rhamnose-proton symporter; Provisional 92.89
COG5070309 VRG4 Nucleotide-sugar transporter [Carbohydrate tr 91.72
PRK10650109 multidrug efflux system protein MdtI; Provisional 90.92
KOG1444314 consensus Nucleotide-sugar transporter VRG4/SQV-7 87.81
KOG1581327 consensus UDP-galactose transporter related protei 81.26
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
Probab=99.85  E-value=2.9e-20  Score=153.03  Aligned_cols=130  Identities=38%  Similarity=0.548  Sum_probs=117.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHhhhhcC-CCCCCCHHHHHHHHHHHHHHHH
Q 032161           11 GLVPYAAMVAVQCVQVGITTLSKAAISQGATPLILAVYADAIASLILLPLSFFLNRK-NRPPLTFALLCKVFILSLIGIT   89 (146)
Q Consensus        11 ~~~~~l~ll~~~~~wg~~~v~~K~~l~~g~~P~~l~~~R~~iA~l~l~~~~~~~~~~-~~~~~~~~~~~~l~~lgl~g~~   89 (146)
                      +.++|+.|+..++++++..++.|.+++.|++|..+.++|+.+|++++.|+.+.++|+ +.++.+++++..+.++|++| .
T Consensus        11 ~~~~~~~~~~~q~~~~~~~~~~k~a~~~G~~~~~~~~~R~~iA~l~Ll~~~~~~~~~~~~~~~~~~~~~~l~l~g~~g-~   89 (358)
T PLN00411         11 EAVFLTAMLATETSVVGISTLFKVATSKGLNIYPFLGYSYLLASLLLLPSLFFTNRSRSLPPLSVSILSKIGLLGFLG-S   89 (358)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHHHCCCCccHHHHHHHHHHHHHHHHHHHHHHHhcccCcchHHHHHHHHHHHHHH-H
Confidence            357999999999999999999999999999999999999999999999998765543 23455688999999999999 6


Q ss_pred             HHHHHHHHHhhhccHHHHHHHHhhHHHHHHHHHHHH------hhHHHHHHHHHHHHHH
Q 032161           90 LMQICVYTGVSFSSPTLVSATNNLIPAFTFLLAVIF------RFFFFFIFVVFYFLII  141 (146)
Q Consensus        90 ~~~~l~~~gl~~tsas~asii~~l~Pv~t~lla~l~------l~E~~~~~~~~~~~~~  141 (146)
                      .++.+++.|++||+|++++++.+++|++++++++++      ++|+.+...+.+.++-
T Consensus        90 ~~~~~~~~gl~~tsa~~asll~~~~P~~~~lla~~~~~e~~~~~er~~~~~~~G~~l~  147 (358)
T PLN00411         90 MYVITGYIGIEYSNPTLASAISNITPALTFILAIIFRMEKVSFKERSSVAKVMGTILS  147 (358)
T ss_pred             HHHHHHHHHHhhccHHHHHHHHHhhHHHHHHHHHHHHhchhhhcccccHHHHHHHHHH
Confidence            888899999999999999999999999999999999      5999999999887764



>TIGR00688 rarD rarD protein Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>PF13536 EmrE: Multidrug resistance efflux transporter Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>TIGR00688 rarD rarD protein Back     alignment and domain information
>PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] Back     alignment and domain information
>PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] Back     alignment and domain information
>PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins Back     alignment and domain information
>PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles Back     alignment and domain information
>KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long Back     alignment and domain information
>KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG3912 consensus Predicted integral membrane protein [General function prediction only] Back     alignment and domain information
>PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function Back     alignment and domain information
>KOG1443 consensus Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter Back     alignment and domain information
>PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins Back     alignment and domain information
>KOG2765 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>KOG3912 consensus Predicted integral membrane protein [General function prediction only] Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13499 rhamnose-proton symporter; Provisional Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] Back     alignment and domain information
>KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2765 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK11431 multidrug efflux system protein; Provisional Back     alignment and domain information
>PRK13499 rhamnose-proton symporter; Provisional Back     alignment and domain information
>COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
2i68_A137 Protein EMRE; transmembrane protein, small-multidr 98.21
3b5d_A110 Multidrug transporter EMRE; helical membrane prote 98.05
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
Probab=98.21  E-value=2.2e-06  Score=60.91  Aligned_cols=62  Identities=10%  Similarity=-0.014  Sum_probs=46.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccHHHHHHH-HhhHHHHHHHHHHHHhhHHHHHHHHHHHHHHHh
Q 032161           82 ILSLIGITLMQICVYTGVSFSSPTLVSAT-NNLIPAFTFLLAVIFRFFFFFIFVVFYFLIILL  143 (146)
Q Consensus        82 ~lgl~g~~~~~~l~~~gl~~tsas~asii-~~l~Pv~t~lla~l~l~E~~~~~~~~~~~~~~~  143 (146)
                      .+|+++..+++.+++.++++.+++.+..+ .++.|+++.++++++++|+++...+.+..+|+.
T Consensus        34 ~l~i~~~~ls~~l~~~alk~i~~s~ay~iw~~l~pv~~~l~g~l~lgE~ls~~~~~Gi~LIi~   96 (137)
T 2i68_A           34 VGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICA   96 (137)
T ss_dssp             CHHHHHHHHHHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHH
Confidence            57778888999999999999999999988 899999999999999999999999999998874



>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00