Citrus Sinensis ID: 032204


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRNK
ccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHcccccccccccccccccccccHHHHHccc
cccHHHcccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccEEccccccccccccccccccccccHHcccccc
maaafqslswqdvhhhqapsyaspecridlgssskcnnkisamrtptnkateervvnrresphsttpekrqrvpsAYNQFIKEEIQRIkannpdishREAFSTAAknwahfphiHFGLmleannqpklddasgnrlMSRTALRNK
MAAAFqslswqdvhHHQAPSYASPECRIDlgssskcnnkisamrtptnkateervvnrresphsttpekrqrvpsaYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPklddasgnrlmsrtalrnk
MAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRNK
********************************************************************************I*****************EAFSTAAKNWAHFPHIHFGLMLE************************
***AFQS***********************************************************************QFIKEEIQRIKAN*PDISHREAFSTAAKNWAHFP**************************R******
**********************SPECRIDLGSSSKCNNKISAM*****************************VPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRNK
**************************************************************HSTTP**RQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLE************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
Q8GW46164 Axial regulator YABBY 5 O yes no 0.779 0.689 0.671 4e-37
Q6H668256 Protein YABBY 4 OS=Oryza yes no 0.579 0.328 0.651 5e-26
A2X7Q3256 Protein YABBY 4 OS=Oryza N/A no 0.579 0.328 0.651 5e-26
Q9XFB0184 Putative axial regulator no no 0.455 0.358 0.818 5e-26
Q0JBF0266 Protein YABBY 5 OS=Oryza no no 0.744 0.406 0.568 8e-26
Q01JG2266 Protein YABBY 5 OS=Oryza N/A no 0.744 0.406 0.568 8e-26
Q10FZ7186 Protein YABBY 2 OS=Oryza no no 0.482 0.376 0.774 5e-25
Q8L556313 Protein YABBY 3 OS=Oryza no no 0.620 0.287 0.591 9e-25
O22152229 Axial regulator YABBY 1 O no no 0.455 0.288 0.779 2e-24
Q2QM17207 Protein YABBY 6 OS=Oryza no no 0.475 0.333 0.753 4e-24
>sp|Q8GW46|YAB5_ARATH Axial regulator YABBY 5 OS=Arabidopsis thaliana GN=YAB5 PE=2 SV=1 Back     alignment and function desciption
 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 95/128 (74%), Gaps = 15/128 (11%)

Query: 1   MAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRE 60
           MAAA QSLS  +    QA +YA PE     GSSS+ + KI + R  T   TE+R+VNR  
Sbjct: 51  MAAALQSLSRPNF---QATNYAVPE----YGSSSRSHTKIPS-RISTRTITEQRIVNR-- 100

Query: 61  SPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML 120
                 PEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML
Sbjct: 101 -----PPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML 155

Query: 121 EANNQPKL 128
           E+N Q K+
Sbjct: 156 ESNKQAKI 163





Arabidopsis thaliana (taxid: 3702)
>sp|Q6H668|YAB4_ORYSJ Protein YABBY 4 OS=Oryza sativa subsp. japonica GN=YAB4 PE=2 SV=1 Back     alignment and function description
>sp|A2X7Q3|YAB4_ORYSI Protein YABBY 4 OS=Oryza sativa subsp. indica GN=YAB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9XFB0|YAB2_ARATH Putative axial regulator YABBY 2 OS=Arabidopsis thaliana GN=YAB2 PE=2 SV=1 Back     alignment and function description
>sp|Q0JBF0|YAB5_ORYSJ Protein YABBY 5 OS=Oryza sativa subsp. japonica GN=YAB5 PE=2 SV=1 Back     alignment and function description
>sp|Q01JG2|YAB5_ORYSI Protein YABBY 5 OS=Oryza sativa subsp. indica GN=YAB5 PE=2 SV=2 Back     alignment and function description
>sp|Q10FZ7|YAB2_ORYSJ Protein YABBY 2 OS=Oryza sativa subsp. japonica GN=YAB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8L556|YAB3_ORYSJ Protein YABBY 3 OS=Oryza sativa subsp. japonica GN=YAB3 PE=2 SV=1 Back     alignment and function description
>sp|O22152|YAB1_ARATH Axial regulator YABBY 1 OS=Arabidopsis thaliana GN=YAB1 PE=1 SV=1 Back     alignment and function description
>sp|Q2QM17|YAB6_ORYSJ Protein YABBY 6 OS=Oryza sativa subsp. japonica GN=YAB6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
225445565185 PREDICTED: axial regulator YABBY 5 [Viti 0.924 0.724 0.772 1e-55
224087122188 predicted protein [Populus trichocarpa] 0.924 0.712 0.779 4e-53
351724725186 uncharacterized protein LOC100499942 [Gl 0.924 0.720 0.751 1e-52
356548475186 PREDICTED: axial regulator YABBY 5-like 0.924 0.720 0.744 3e-52
255638088186 unknown [Glycine max] 0.924 0.720 0.737 2e-51
217073506191 unknown [Medicago truncatula] gi|3884906 0.931 0.706 0.712 1e-49
357478135191 YABBY protein [Medicago truncatula] gi|3 0.931 0.706 0.712 1e-49
255572533185 Axial regulator YABBY5, putative [Ricinu 0.917 0.718 0.739 4e-48
302399149188 YABBY domain class transcription factor 0.931 0.718 0.737 1e-46
449464626193 PREDICTED: axial regulator YABBY 5-like 0.924 0.694 0.690 4e-46
>gi|225445565|ref|XP_002285328.1| PREDICTED: axial regulator YABBY 5 [Vitis vinifera] gi|297738980|emb|CBI28225.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 120/145 (82%), Gaps = 11/145 (7%)

Query: 1   MAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRE 60
           MAAAFQSLSWQDV   QAP+Y SP+ RIDLGSSSKCN K+ AMR P +  +EER+VNR  
Sbjct: 52  MAAAFQSLSWQDV---QAPNYTSPDYRIDLGSSSKCNTKM-AMRAPASNISEERIVNR-- 105

Query: 61  SPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML 120
                 PEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML
Sbjct: 106 -----PPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML 160

Query: 121 EANNQPKLDDASGNRLMSRTALRNK 145
           E NNQPKLD+ S   LMS+ ALRNK
Sbjct: 161 ETNNQPKLDEGSEKHLMSKAALRNK 185




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224087122|ref|XP_002308074.1| predicted protein [Populus trichocarpa] gi|222854050|gb|EEE91597.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351724725|ref|NP_001238347.1| uncharacterized protein LOC100499942 [Glycine max] gi|255627893|gb|ACU14291.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356548475|ref|XP_003542627.1| PREDICTED: axial regulator YABBY 5-like [Glycine max] Back     alignment and taxonomy information
>gi|255638088|gb|ACU19358.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|217073506|gb|ACJ85113.1| unknown [Medicago truncatula] gi|388490620|gb|AFK33376.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357478135|ref|XP_003609353.1| YABBY protein [Medicago truncatula] gi|355510408|gb|AES91550.1| YABBY protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255572533|ref|XP_002527201.1| Axial regulator YABBY5, putative [Ricinus communis] gi|223533466|gb|EEF35214.1| Axial regulator YABBY5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302399149|gb|ADL36869.1| YABBY domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|449464626|ref|XP_004150030.1| PREDICTED: axial regulator YABBY 5-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
TAIR|locus:2066311164 YAB5 "YABBY5" [Arabidopsis tha 0.779 0.689 0.679 1.2e-35
TAIR|locus:2826731184 YAB2 "YABBY2" [Arabidopsis tha 0.765 0.603 0.557 1.1e-25
TAIR|locus:2126931240 YAB3 "YABBY3" [Arabidopsis tha 0.579 0.35 0.654 5.9e-25
TAIR|locus:2005492229 AFO "AT2G45190" [Arabidopsis t 0.434 0.275 0.815 2.6e-24
UNIPROTKB|Q7XIM7169 YAB1 "Protein YABBY 1" [Oryza 0.358 0.307 0.846 1e-20
TAIR|locus:2028020231 INO "INNER NO OUTER" [Arabidop 0.441 0.277 0.625 5.3e-17
TAIR|locus:2026418181 CRC "AT1G69180" [Arabidopsis t 0.310 0.248 0.711 3e-14
UNIPROTKB|Q76EJ0194 DL "Protein DROOPING LEAF" [Or 0.296 0.221 0.767 7.9e-14
TAIR|locus:2066311 YAB5 "YABBY5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
 Identities = 87/128 (67%), Positives = 96/128 (75%)

Query:     1 MAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNRRE 60
             MAAA QSLS  +    QA +YA PE     GSSS+ + KI + R  T   TE+R+VNR  
Sbjct:    51 MAAALQSLSRPNF---QATNYAVPE----YGSSSRSHTKIPS-RISTRTITEQRIVNR-- 100

Query:    61 SPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML 120
              P    PEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML
Sbjct:   101 -P----PEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLML 155

Query:   121 EANNQPKL 128
             E+N Q K+
Sbjct:   156 ESNKQAKI 163




GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
GO:0006417 "regulation of translation" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2826731 YAB2 "YABBY2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126931 YAB3 "YABBY3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005492 AFO "AT2G45190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XIM7 YAB1 "Protein YABBY 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2028020 INO "INNER NO OUTER" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026418 CRC "AT1G69180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q76EJ0 DL "Protein DROOPING LEAF" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GW46YAB5_ARATHNo assigned EC number0.67180.77930.6890yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
pfam04690170 pfam04690, YABBY, YABBY protein 7e-36
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 0.004
>gnl|CDD|113458 pfam04690, YABBY, YABBY protein Back     alignment and domain information
 Score =  121 bits (304), Expect = 7e-36
 Identities = 51/60 (85%), Positives = 53/60 (88%)

Query: 59  RESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 118
           R  P +  PEKRQRVPSAYN+FIKEEIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL
Sbjct: 111 RVPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 170


YABBY proteins are a group of plant-specific transcription involved in the specification of abaxial polarity in lateral organs. Length = 170

>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 100.0
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 98.57
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 98.31
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 98.21
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 98.2
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 98.19
smart0039870 HMG high mobility group. 98.18
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 98.18
PTZ0019994 high mobility group protein; Provisional 98.09
KOG038196 consensus HMG box-containing protein [General func 97.35
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 97.03
KOG3223221 consensus Uncharacterized conserved protein [Funct 93.52
COG5648211 NHP6B Chromatin-associated proteins containing the 81.96
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
Probab=100.00  E-value=4.6e-36  Score=238.32  Aligned_cols=66  Identities=73%  Similarity=1.163  Sum_probs=60.5

Q ss_pred             CCCCccccccc-cccCCCCCCCCcccCCCCchhhHHHHHHHHHHHhhCCCCCHHHHHHHHHHhhccCCCccccc
Q 032204           46 PTNKATEERVV-NRRESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL  118 (145)
Q Consensus        46 ~~~~~~~~~~~-~R~~~a~~~p~eK~~R~PSAYN~FmKeEiqRiKa~nP~isHKEaFs~AAkNWa~~P~~~~g~  118 (145)
                      ..+++.+++++ +|       |||||||+|||||+|||+||+|||++||+|+|||||++||+||||+|||||||
T Consensus       104 ~~~~~~pr~~~v~k-------PPEKRqR~psaYn~f~k~ei~rik~~~p~ishkeaFs~aAknW~h~phihfgl  170 (170)
T PF04690_consen  104 SEEEEIPRAPPVNK-------PPEKRQRVPSAYNRFMKEEIQRIKAENPDISHKEAFSAAAKNWAHFPHIHFGL  170 (170)
T ss_pred             cccccccccccccC-------CccccCCCchhHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHhhhhCcccccCC
Confidence            44556776665 67       99999999999999999999999999999999999999999999999999997



>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3223 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 98.59
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 98.49
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 98.46
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 98.42
1hme_A77 High mobility group protein fragment-B; DNA-bindin 98.38
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 98.33
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 98.3
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 98.29
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 98.27
1wgf_A90 Upstream binding factor 1; transcription factor, D 98.25
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 98.25
1ckt_A71 High mobility group 1 protein; high-mobility group 98.24
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 98.22
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 98.22
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 98.18
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 98.17
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 98.17
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 98.15
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 98.14
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 98.05
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 98.04
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 98.04
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 98.03
2yrq_A173 High mobility group protein B1; HMG box domain, DN 98.0
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 98.0
2lhj_A97 High mobility group protein homolog NHP1; structur 97.94
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 97.88
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 97.83
2yrq_A173 High mobility group protein B1; HMG box domain, DN 97.81
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 97.63
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 97.59
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 97.53
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 97.47
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 97.46
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 96.9
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 96.85
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 96.45
3tq6_A214 Transcription factor A, mitochondrial; transcripti 96.41
2cto_A93 Novel protein; high mobility group box domain, hel 96.23
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
Probab=98.59  E-value=7.3e-08  Score=64.46  Aligned_cols=50  Identities=22%  Similarity=0.325  Sum_probs=47.2

Q ss_pred             CCCCCcccCCCCchhhHHHHHHHHHHHhhCCCCCHHHHHHHHHHhhccCC
Q 032204           63 HSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFP  112 (145)
Q Consensus        63 ~~~p~eK~~R~PSAYN~FmKeEiqRiKa~nP~isHKEaFs~AAkNWa~~P  112 (145)
                      |++++.+++|.+|||..|+++.-..|+++||++++.|.-+.++..|+..+
T Consensus         1 g~~~~~~pkrP~~af~lf~~~~r~~~~~~~p~~~~~eisk~lg~~Wk~ls   50 (82)
T 1wz6_A            1 GSSGSSGARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLD   50 (82)
T ss_dssp             CCSSCCCSCCCCCHHHHHHHHHHHHHHHHCSSSCTTHHHHHHHHHHHTCC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHhhCC
Confidence            56789999999999999999999999999999999999999999999854



>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 98.52
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 98.4
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 98.38
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 98.38
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 98.35
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 98.27
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.14
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 97.75
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 97.55
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 97.3
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.52  E-value=7.1e-08  Score=64.21  Aligned_cols=48  Identities=25%  Similarity=0.401  Sum_probs=44.0

Q ss_pred             CCcccCCCCchhhHHHHHHHHHHHhhCCCCCHHHHHHHHHHhhccCCC
Q 032204           66 TPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPH  113 (145)
Q Consensus        66 p~eK~~R~PSAYN~FmKeEiqRiKa~nP~isHKEaFs~AAkNWa~~P~  113 (145)
                      .+.+++|-+|+|..||++..+.|++.||++++.|+.+.++..|+..++
T Consensus        17 ~~~~PKrP~say~lF~~e~r~~~~~~~p~~~~~ei~k~l~~~W~~Ls~   64 (90)
T d1wgfa_          17 GSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSE   64 (90)
T ss_dssp             CCCCCCCCCCHHHHHHHHTHHHHHHHCTTSCHHHHHHHHHHHHHHSCH
T ss_pred             CCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHhCCH
Confidence            466778899999999999999999999999999999999999998653



>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure