Citrus Sinensis ID: 032345
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 224126299 | 190 | predicted protein [Populus trichocarpa] | 0.957 | 0.715 | 0.703 | 2e-48 | |
| 225427258 | 188 | PREDICTED: ferredoxin-1 [Vitis vinifera] | 0.950 | 0.718 | 0.722 | 1e-45 | |
| 449461515 | 189 | PREDICTED: ferredoxin-like [Cucumis sati | 0.957 | 0.719 | 0.645 | 3e-42 | |
| 224072634 | 142 | predicted protein [Populus trichocarpa] | 0.929 | 0.929 | 0.666 | 1e-41 | |
| 449523107 | 188 | PREDICTED: LOW QUALITY PROTEIN: ferredox | 0.950 | 0.718 | 0.645 | 7e-41 | |
| 255557611 | 186 | Ferredoxin-2, putative [Ricinus communis | 0.922 | 0.704 | 0.652 | 7e-40 | |
| 351629595 | 163 | ferredoxin 2 [Dimocarpus longan] | 0.816 | 0.711 | 0.601 | 3e-36 | |
| 356512010 | 169 | PREDICTED: ferredoxin-2-like [Glycine ma | 0.753 | 0.633 | 0.690 | 1e-35 | |
| 357476671 | 186 | Ferredoxin-6 [Medicago truncatula] gi|35 | 0.887 | 0.677 | 0.597 | 3e-35 | |
| 356565441 | 179 | PREDICTED: ferredoxin-2-like [Glycine ma | 0.816 | 0.648 | 0.612 | 4e-35 |
| >gi|224126299|ref|XP_002329520.1| predicted protein [Populus trichocarpa] gi|222870229|gb|EEF07360.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 196 bits (499), Expect = 2e-48, Method: Compositional matrix adjust.
Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 9/145 (6%)
Query: 1 MDLLVPPSSC---CRKPPLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVN---- 53
MDL++ SC CRKP +R++ SS + T++ +SLKCR KT +SELQ++ GV+
Sbjct: 1 MDLIISSHSCNSLCRKPAFYRRI-SSPNSTTQHSTSLKCRVAKT-TSELQSSVGVSDRTG 58
Query: 54 GSYSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRI 113
SYSPSIPTHKVTVHDR RGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVR+
Sbjct: 59 NSYSPSIPTHKVTVHDRQRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRV 118
Query: 114 KSGQIKQPEALGISAELKSKACTIL 138
KSGQ++QPEALGISAELKSK +L
Sbjct: 119 KSGQLRQPEALGISAELKSKGYALL 143
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225427258|ref|XP_002281131.1| PREDICTED: ferredoxin-1 [Vitis vinifera] gi|297742123|emb|CBI33910.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449461515|ref|XP_004148487.1| PREDICTED: ferredoxin-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224072634|ref|XP_002303817.1| predicted protein [Populus trichocarpa] gi|222841249|gb|EEE78796.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449523107|ref|XP_004168566.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255557611|ref|XP_002519835.1| Ferredoxin-2, putative [Ricinus communis] gi|223540881|gb|EEF42439.1| Ferredoxin-2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351629595|gb|AEQ54761.1| ferredoxin 2 [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
| >gi|356512010|ref|XP_003524714.1| PREDICTED: ferredoxin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357476671|ref|XP_003608621.1| Ferredoxin-6 [Medicago truncatula] gi|355509676|gb|AES90818.1| Ferredoxin-6 [Medicago truncatula] gi|388498102|gb|AFK37117.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356565441|ref|XP_003550948.1| PREDICTED: ferredoxin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| TAIR|locus:2206644 | 194 | FdC2 "ferredoxin C 2" [Arabido | 0.894 | 0.654 | 0.542 | 1.4e-30 | |
| UNIPROTKB|P0A3C8 | 99 | petF "Ferredoxin-1" [Nostoc sp | 0.429 | 0.616 | 0.459 | 5.8e-11 | |
| TAIR|locus:2038593 | 155 | FD3 "ferredoxin 3" [Arabidopsi | 0.788 | 0.722 | 0.321 | 1.8e-09 | |
| UNIPROTKB|P00221 | 147 | PETF "Ferredoxin-1, chloroplas | 0.626 | 0.605 | 0.347 | 2.9e-09 | |
| UNIPROTKB|P0A3C9 | 98 | petF1 "Ferredoxin-1" [Thermosy | 0.422 | 0.612 | 0.442 | 7.6e-09 | |
| UNIPROTKB|P83522 | 97 | P83522 "Ferredoxin" [Hordeum v | 0.323 | 0.474 | 0.5 | 4.2e-08 | |
| UNIPROTKB|P83585 | 97 | P83585 "Ferredoxin" [Solanum a | 0.323 | 0.474 | 0.456 | 1.4e-07 | |
| UNIPROTKB|P09911 | 149 | PETF "Ferredoxin-1, chloroplas | 0.746 | 0.711 | 0.297 | 1.8e-07 | |
| UNIPROTKB|P83583 | 97 | P83583 "Ferredoxin" [Solanum l | 0.323 | 0.474 | 0.456 | 2.9e-07 | |
| GENEDB_PFALCIPARUM|MAL13P1.95 | 194 | MAL13P1.95 "ferredoxin" [Plasm | 0.366 | 0.268 | 0.377 | 3.1e-07 |
| TAIR|locus:2206644 FdC2 "ferredoxin C 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
Identities = 77/142 (54%), Positives = 100/142 (70%)
Query: 1 MDLLVPPSSCC--RKP--PLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVNGSY 56
M L++P + C +K P++R+ + N R ++ C R V E+ T + GS
Sbjct: 1 MALILPCTFCTSLQKKNFPINRRYIT---NFRRGATTATCEFRIPV--EVSTPSD-RGSL 54
Query: 57 SPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSG 116
+P+HKVTVHDR RGVVHEF EDQYILH+AESQNI+LPFACRHGCCTSCAVR+KSG
Sbjct: 55 V--VPSHKVTVHDRQRGVVHEF---EDQYILHSAESQNISLPFACRHGCCTSCAVRVKSG 109
Query: 117 QIKQPEALGISAELKSKACTIL 138
+++QP+ALGISAELKS+ + L
Sbjct: 110 ELRQPQALGISAELKSQRISSL 131
|
|
| UNIPROTKB|P0A3C8 petF "Ferredoxin-1" [Nostoc sp. PCC 7119 (taxid:1168)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038593 FD3 "ferredoxin 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00221 PETF "Ferredoxin-1, chloroplastic" [Spinacia oleracea (taxid:3562)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A3C9 petF1 "Ferredoxin-1" [Thermosynechococcus elongatus BP-1 (taxid:197221)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P83522 P83522 "Ferredoxin" [Hordeum vulgare (taxid:4513)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P83585 P83585 "Ferredoxin" [Solanum abutiloides (taxid:45831)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09911 PETF "Ferredoxin-1, chloroplastic" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P83583 P83583 "Ferredoxin" [Solanum lyratum (taxid:230192)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|MAL13P1.95 MAL13P1.95 "ferredoxin" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_1180060 | hypothetical protein (191 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| TIGR02008 | 97 | TIGR02008, fdx_plant, ferredoxin [2Fe-2S] | 4e-14 | |
| CHL00134 | 99 | CHL00134, petF, ferredoxin; Validated | 2e-13 | |
| cd00207 | 84 | cd00207, fer2, 2Fe-2S iron-sulfur cluster binding | 1e-11 | |
| COG0633 | 102 | COG0633, Fdx, Ferredoxin [Energy production and co | 2e-10 | |
| pfam00111 | 77 | pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin | 5e-09 | |
| PTZ00038 | 191 | PTZ00038, PTZ00038, ferredoxin; Provisional | 1e-08 | |
| PLN03136 | 148 | PLN03136, PLN03136, Ferredoxin; Provisional | 7e-07 | |
| PRK07609 | 339 | PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucosee | 1e-06 | |
| PRK11872 | 340 | PRK11872, antC, anthranilate dioxygenase reductase | 0.001 | |
| PRK05713 | 312 | PRK05713, PRK05713, hypothetical protein; Provisio | 0.002 |
| >gnl|CDD|233684 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] | Back alignment and domain information |
|---|
Score = 63.2 bits (154), Expect = 4e-14
Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 1/61 (1%)
Query: 62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
T+KVT+ + G P+DQYIL AE I LP++CR G C++CA +++ G + Q
Sbjct: 2 TYKVTLVNP-DGGEETIECPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKVEEGTVDQS 60
Query: 122 E 122
+
Sbjct: 61 D 61
|
This model represents single domain 2Fe-2S (also called plant type) ferredoxins. In general, these occur as a single domain proteins or with a chloroplast transit peptide. Species tend to be photosynthetic, but several forms may occur in one species and individually may not be associated with photocynthesis. Halobacterial forms differ somewhat in architecture; they score between trusted and noise cutoffs. Sequences scoring below the noise cutoff tend to be ferredoxin-related domains of larger proteins. Length = 97 |
| >gnl|CDD|177056 CHL00134, petF, ferredoxin; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240237 PTZ00038, PTZ00038, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178681 PLN03136, PLN03136, Ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183350 PRK11872, antC, anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235575 PRK05713, PRK05713, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| CHL00134 | 99 | petF ferredoxin; Validated | 99.89 | |
| TIGR02008 | 97 | fdx_plant ferredoxin [2Fe-2S]. This model represen | 99.87 | |
| PLN03136 | 148 | Ferredoxin; Provisional | 99.84 | |
| PTZ00038 | 191 | ferredoxin; Provisional | 99.83 | |
| PRK10713 | 84 | 2Fe-2S ferredoxin YfaE; Provisional | 99.82 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 99.8 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 99.78 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 99.74 | |
| cd00207 | 84 | fer2 2Fe-2S iron-sulfur cluster binding domain. Ir | 99.74 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 99.74 | |
| PF00111 | 78 | Fer2: 2Fe-2S iron-sulfur cluster binding domain; I | 99.73 | |
| COG0633 | 102 | Fdx Ferredoxin [Energy production and conversion] | 99.71 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 99.69 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 99.67 | |
| TIGR02007 | 110 | fdx_isc ferredoxin, 2Fe-2S type, ISC system. This | 99.66 | |
| PLN02593 | 117 | adrenodoxin-like ferredoxin protein | 99.65 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 99.64 | |
| PTZ00490 | 143 | Ferredoxin superfamily; Provisional | 99.58 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 99.3 | |
| COG3894 | 614 | Uncharacterized metal-binding protein [General fun | 98.98 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 98.7 | |
| PF13510 | 82 | Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; | 98.69 | |
| KOG3309 | 159 | consensus Ferredoxin [Energy production and conver | 98.65 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 98.57 | |
| PRK06259 | 486 | succinate dehydrogenase/fumarate reductase iron-su | 98.21 | |
| PRK11433 | 217 | aldehyde oxidoreductase 2Fe-2S subunit; Provisiona | 98.18 | |
| PRK09908 | 159 | xanthine dehydrogenase subunit XdhC; Provisional | 97.99 | |
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 97.96 | |
| PF13085 | 110 | Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; | 97.93 | |
| PRK13552 | 239 | frdB fumarate reductase iron-sulfur subunit; Provi | 97.83 | |
| PRK12386 | 251 | fumarate reductase iron-sulfur subunit; Provisiona | 97.8 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 97.77 | |
| TIGR03193 | 148 | 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm | 97.72 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 97.67 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 97.6 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 97.6 | |
| PRK08640 | 249 | sdhB succinate dehydrogenase iron-sulfur subunit; | 97.6 | |
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 97.6 | |
| PLN00129 | 276 | succinate dehydrogenase [ubiquinone] iron-sulfur s | 97.58 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 97.51 | |
| PRK12575 | 235 | succinate dehydrogenase iron-sulfur subunit; Provi | 97.49 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 97.49 | |
| PRK05950 | 232 | sdhB succinate dehydrogenase iron-sulfur subunit; | 97.48 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 97.42 | |
| TIGR03198 | 151 | pucE xanthine dehydrogenase E subunit. This gene h | 97.34 | |
| PRK12385 | 244 | fumarate reductase iron-sulfur subunit; Provisiona | 97.34 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 97.32 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 97.29 | |
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 97.25 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 97.24 | |
| COG2080 | 156 | CoxS Aerobic-type carbon monoxide dehydrogenase, s | 97.13 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 96.69 | |
| TIGR02963 | 467 | xanthine_xdhA xanthine dehydrogenase, small subuni | 96.6 | |
| PRK09800 | 956 | putative hypoxanthine oxidase; Provisional | 96.35 | |
| TIGR03311 | 848 | Se_dep_Molyb_1 selenium-dependent molybdenum hydro | 96.12 | |
| TIGR03313 | 951 | Se_sel_red_Mo probable selenate reductase, molybde | 95.94 | |
| PLN00192 | 1344 | aldehyde oxidase | 95.66 | |
| TIGR02969 | 1330 | mam_aldehyde_ox aldehyde oxidase. Members of this | 94.77 | |
| KOG2282 | 708 | consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 | 92.46 | |
| COG4630 | 493 | XdhA Xanthine dehydrogenase, iron-sulfur cluster a | 85.24 | |
| PLN02906 | 1319 | xanthine dehydrogenase | 85.06 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 83.61 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 82.34 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 82.06 | |
| KOG3049 | 288 | consensus Succinate dehydrogenase, Fe-S protein su | 80.31 |
| >CHL00134 petF ferredoxin; Validated | Back alignment and domain information |
|---|
Probab=99.89 E-value=8.5e-23 Score=145.26 Aligned_cols=83 Identities=30% Similarity=0.554 Sum_probs=74.3
Q ss_pred CCceEEEEEeCCCCcEEEEEeCCCChHHHHHHHCCCCCCCCCCceecCCceEEEecCccCCcccCCCChhhhcCceEEeE
Q 032345 60 IPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILL 139 (142)
Q Consensus 60 ~~~~~Vti~~~~~G~~~~~~v~~getLL~aa~~~GI~l~~~Cr~G~CGtC~v~v~~G~v~~~e~~~Ls~~e~~~g~~LaC 139 (142)
|..|+|+|.+..+|..+.|++++|+|||++|+++||+++|+|+.|.||+|+++|++|++.+.+...|+++++++||+|+|
T Consensus 1 ~~~~~v~~~~~~~~~~~~~~~~~~~tLL~a~~~~Gi~i~~~C~~G~Cg~C~v~v~~G~v~~~~~~~l~~~e~~~g~~L~C 80 (99)
T CHL00134 1 MATYKVTLLSEEEGIDVTIDCPDDVYILDAAEEQGIDLPYSCRAGACSTCAGKVTEGTVDQSDQSFLDDDQLEAGFVLTC 80 (99)
T ss_pred CCeEEEEEEecCCCCeEEEEECCCCcHHHHHHHcCCCCCcCCCCccCCCCEEEEEeCccccCcccCCCHHHHhCCeEEEe
Confidence 34589999764466668899999999999999999999999999999999999999999887666699999999999999
Q ss_pred EeC
Q 032345 140 SAL 142 (142)
Q Consensus 140 q~~ 142 (142)
|++
T Consensus 81 ~~~ 83 (99)
T CHL00134 81 VAY 83 (99)
T ss_pred eCE
Confidence 974
|
|
| >TIGR02008 fdx_plant ferredoxin [2Fe-2S] | Back alignment and domain information |
|---|
| >PLN03136 Ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PTZ00038 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10713 2Fe-2S ferredoxin YfaE; Provisional | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions | Back alignment and domain information |
|---|
| >COG0633 Fdx Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system | Back alignment and domain information |
|---|
| >PLN02593 adrenodoxin-like ferredoxin protein | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PTZ00490 Ferredoxin superfamily; Provisional | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3894 Uncharacterized metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >KOG3309 consensus Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09908 xanthine dehydrogenase subunit XdhC; Provisional | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B | Back alignment and domain information |
|---|
| >PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12386 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >TIGR03198 pucE xanthine dehydrogenase E subunit | Back alignment and domain information |
|---|
| >PRK12385 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit | Back alignment and domain information |
|---|
| >PRK09800 putative hypoxanthine oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 | Back alignment and domain information |
|---|
| >TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit | Back alignment and domain information |
|---|
| >PLN00192 aldehyde oxidase | Back alignment and domain information |
|---|
| >TIGR02969 mam_aldehyde_ox aldehyde oxidase | Back alignment and domain information |
|---|
| >KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02906 xanthine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 142 | ||||
| 1qof_A | 98 | Ferredoxin Mutation Q70k Length = 98 | 1e-11 | ||
| 1j7b_A | 98 | Structure Of The Anabaena Ferredoxin Mutant E94k Le | 1e-11 | ||
| 1j7c_A | 98 | Structure Of The Anabaena Ferredoxin Mutant E95k Le | 1e-11 | ||
| 1fxa_A | 98 | Crystallization And Structure Determination To 2.5- | 1e-11 | ||
| 1j7a_A | 98 | Structure Of The Anabaena Ferredoxin D68k Mutant Le | 1e-11 | ||
| 1qob_A | 98 | Ferredoxin Mutation D62k Length = 98 | 2e-11 | ||
| 1qog_A | 98 | Ferredoxin Mutation S47a Length = 98 | 2e-11 | ||
| 3b2g_A | 98 | Leptolyngbya Boryana Ferredoxin Length = 98 | 9e-11 | ||
| 1qoa_A | 98 | Ferredoxin Mutation C49s Length = 98 | 1e-10 | ||
| 1rfk_A | 98 | Crystal Structure Of 2fe2s Ferredoxin From Thermoph | 2e-10 | ||
| 1roe_A | 97 | Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elo | 2e-09 | ||
| 1a70_A | 97 | Spinach Ferredoxin Length = 97 | 6e-09 | ||
| 4fxc_A | 98 | Tertiary Structure Of [2fe-2s] Ferredoxin From Spir | 2e-08 | ||
| 1gaq_B | 98 | Crystal Structure Of The Complex Between Ferredoxin | 2e-08 | ||
| 1awd_A | 94 | Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fu | 3e-08 | ||
| 3p63_A | 96 | Structure Of M. Laminosus Ferredoxin With A Shorter | 3e-08 | ||
| 3av8_A | 97 | Refined Structure Of Plant-Type [2fe-2s] Ferredoxin | 3e-07 | ||
| 1pfd_A | 96 | The Solution Structure Of High Plant Parsley [2fe-2 | 3e-07 | ||
| 1iue_A | 98 | Crystal Structure Analysis Of Ferredoxin From Plasm | 4e-07 | ||
| 3ab5_A | 97 | Crystal Structure Of The 2fe 2s Ferredoxin From Cya | 5e-07 | ||
| 1fxi_A | 96 | Structure Of The [2fe-2s] Ferredoxin I From The Blu | 6e-07 | ||
| 1e10_A | 128 | [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le | 1e-06 | ||
| 1e0z_A | 128 | [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le | 1e-06 | ||
| 1dox_A | 96 | 1h And 15n Sequential Assignment, Secondary Structu | 4e-06 | ||
| 1off_A | 97 | 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 L | 4e-06 | ||
| 2pvg_C | 96 | Crystal Srtucture Of The Binary Complex Between Fer | 5e-06 | ||
| 1doi_A | 128 | 2fe-2s Ferredoxin From Haloarcula Marismortui Lengt | 9e-06 | ||
| 1frr_A | 95 | Crystal Structure Of [2fe-2s] Ferredoxin I From Equ | 1e-05 |
| >pdb|1QOF|A Chain A, Ferredoxin Mutation Q70k Length = 98 | Back alignment and structure |
|
| >pdb|1J7B|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E94k Length = 98 | Back alignment and structure |
| >pdb|1J7C|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E95k Length = 98 | Back alignment and structure |
| >pdb|1FXA|A Chain A, Crystallization And Structure Determination To 2.5-Angstroms Resolution Of The Oxidized [2fe-2s] Ferredoxin Isolated From Anabaena 7120 Length = 98 | Back alignment and structure |
| >pdb|1J7A|A Chain A, Structure Of The Anabaena Ferredoxin D68k Mutant Length = 98 | Back alignment and structure |
| >pdb|1QOB|A Chain A, Ferredoxin Mutation D62k Length = 98 | Back alignment and structure |
| >pdb|1QOG|A Chain A, Ferredoxin Mutation S47a Length = 98 | Back alignment and structure |
| >pdb|3B2G|A Chain A, Leptolyngbya Boryana Ferredoxin Length = 98 | Back alignment and structure |
| >pdb|1QOA|A Chain A, Ferredoxin Mutation C49s Length = 98 | Back alignment and structure |
| >pdb|1RFK|A Chain A, Crystal Structure Of 2fe2s Ferredoxin From Thermophilic Cyanobacterium Mastigocladus Laminosus Length = 98 | Back alignment and structure |
| >pdb|1ROE|A Chain A, Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elongatus Length = 97 | Back alignment and structure |
| >pdb|1A70|A Chain A, Spinach Ferredoxin Length = 97 | Back alignment and structure |
| >pdb|4FXC|A Chain A, Tertiary Structure Of [2fe-2s] Ferredoxin From Spirulina Platensis Refined At 2.5 Angstroms Resolution: Structural Comparisons Of Plant-Type Ferredoxins And An Electrostatic Potential Analysis Length = 98 | Back alignment and structure |
| >pdb|1GAQ|B Chain B, Crystal Structure Of The Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Length = 98 | Back alignment and structure |
| >pdb|1AWD|A Chain A, Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fusca Length = 94 | Back alignment and structure |
| >pdb|3P63|A Chain A, Structure Of M. Laminosus Ferredoxin With A Shorter L1,2 Loop Length = 96 | Back alignment and structure |
| >pdb|3AV8|A Chain A, Refined Structure Of Plant-Type [2fe-2s] Ferredoxin I From Aphanothece Sacrum At 1.46 A Resolution Length = 97 | Back alignment and structure |
| >pdb|1PFD|A Chain A, The Solution Structure Of High Plant Parsley [2fe-2s] Ferredoxin, Nmr, 18 Structures Length = 96 | Back alignment and structure |
| >pdb|1IUE|A Chain A, Crystal Structure Analysis Of Ferredoxin From Plasmodium Falciparum Length = 98 | Back alignment and structure |
| >pdb|3AB5|A Chain A, Crystal Structure Of The 2fe 2s Ferredoxin From Cyanidioschyzon Merolae Length = 97 | Back alignment and structure |
| >pdb|1FXI|A Chain A, Structure Of The [2fe-2s] Ferredoxin I From The Blue-Green Alga Aphanothece Sacrum At 2.2 Angstroms Resolution Length = 96 | Back alignment and structure |
| >pdb|1E10|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 | Back alignment and structure |
| >pdb|1E0Z|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 | Back alignment and structure |
| >pdb|1DOX|A Chain A, 1h And 15n Sequential Assignment, Secondary Structure And Tertiary Fold Of [2fe-2s] Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 96 | Back alignment and structure |
| >pdb|1OFF|A Chain A, 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 97 | Back alignment and structure |
| >pdb|2PVG|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin And Ferredoxin:thioredoxin Reductase Length = 96 | Back alignment and structure |
| >pdb|1DOI|A Chain A, 2fe-2s Ferredoxin From Haloarcula Marismortui Length = 128 | Back alignment and structure |
| >pdb|1FRR|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin I From Equisetum Arvense At 1.8 Angstroms Resolution Length = 95 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 1czp_A | 98 | Ferredoxin I; [2Fe-2S] protein, crystal reduced wi | 2e-26 | |
| 1frd_A | 98 | Heterocyst [2Fe-2S] ferredoxin; electron transport | 1e-25 | |
| 1iue_A | 98 | Ferredoxin; electron transport, iron-sulfur; 1.70A | 5e-25 | |
| 1awd_A | 94 | Ferredoxin; electron transport, eukaryotic, green | 3e-24 | |
| 1a70_A | 97 | Ferredoxin; iron-sulfur protein, photosynthesis, e | 4e-24 | |
| 1frr_A | 95 | Ferredoxin I; electron transfer(iron-sulfur protei | 3e-23 | |
| 1wri_A | 93 | Ferredoxin II, ferredoxin; electron transport; 1.2 | 3e-21 | |
| 1doi_A | 128 | 2Fe-2S ferredoxin; halophilic protein, redox prote | 1e-19 | |
| 1jq4_A | 98 | Methane monooxygenase component C; [2Fe-2S] ferred | 6e-18 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 7e-14 | |
| 3zyy_X | 631 | Iron-sulfur cluster binding protein; iron-sulfur-b | 7e-08 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 6e-07 |
| >1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Length = 98 | Back alignment and structure |
|---|
Score = 94.3 bits (235), Expect = 2e-26
Identities = 28/72 (38%), Positives = 41/72 (56%)
Query: 62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
T KVT+ + G HE VP+D+YIL AE Q LPF+CR G C++CA ++ SG + Q
Sbjct: 2 TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQS 61
Query: 122 EALGISAELKSK 133
+ + +
Sbjct: 62 DQSFLDDDQIEA 73
|
| >1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Length = 98 | Back alignment and structure |
|---|
| >1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Length = 98 | Back alignment and structure |
|---|
| >1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Length = 94 | Back alignment and structure |
|---|
| >1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Length = 97 | Back alignment and structure |
|---|
| >1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Length = 95 | Back alignment and structure |
|---|
| >1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Length = 93 | Back alignment and structure |
|---|
| >1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Length = 128 | Back alignment and structure |
|---|
| >1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Length = 98 | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 | Back alignment and structure |
|---|
| >3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 1iue_A | 98 | Ferredoxin; electron transport, iron-sulfur; 1.70A | 99.85 | |
| 1frd_A | 98 | Heterocyst [2Fe-2S] ferredoxin; electron transport | 99.85 | |
| 1frr_A | 95 | Ferredoxin I; electron transfer(iron-sulfur protei | 99.85 | |
| 1a70_A | 97 | Ferredoxin; iron-sulfur protein, photosynthesis, e | 99.84 | |
| 1czp_A | 98 | Ferredoxin I; [2Fe-2S] protein, crystal reduced wi | 99.84 | |
| 1awd_A | 94 | Ferredoxin; electron transport, eukaryotic, green | 99.84 | |
| 1wri_A | 93 | Ferredoxin II, ferredoxin; electron transport; 1.2 | 99.83 | |
| 1jq4_A | 98 | Methane monooxygenase component C; [2Fe-2S] ferred | 99.82 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 99.81 | |
| 3lxf_A | 104 | Ferredoxin; iron, iron-sulfur, metal-binding, meta | 99.79 | |
| 2bt6_A | 108 | Adrenodoxin 1; ruthenium(II) bipyridyl complex, in | 99.78 | |
| 1xlq_A | 106 | Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored | 99.78 | |
| 2y5c_A | 109 | Adrenodoxin-like protein, mitochondrial; electron | 99.78 | |
| 2wlb_A | 103 | ETP1-FD, electron transfer protein 1, mitochondria | 99.78 | |
| 1uwm_A | 106 | Ferredoxin VI, FDVI; electron transport, metal-bin | 99.77 | |
| 3hui_A | 126 | Ferredoxin; cytochrome P450, electron transfer, ir | 99.77 | |
| 3ah7_A | 113 | [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur | 99.77 | |
| 1doi_A | 128 | 2Fe-2S ferredoxin; halophilic protein, redox prote | 99.76 | |
| 1b9r_A | 105 | Protein (terpredoxin); structure from molmol, ferr | 99.76 | |
| 1l5p_A | 93 | Ferredoxin; [2Fe-2S] cluster, electron transfer, i | 99.76 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 99.75 | |
| 1i7h_A | 111 | Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch | 99.72 | |
| 3zyy_X | 631 | Iron-sulfur cluster binding protein; iron-sulfur-b | 99.68 | |
| 3n9z_C | 123 | Adrenodoxin; cytochrome P450, 22-hydroxycholestero | 99.59 | |
| 1t3q_A | 168 | Quinoline 2-oxidoreductase small subunit; QOR, mol | 98.75 | |
| 3hrd_D | 160 | Nicotinate dehydrogenase small FES subunit; seleni | 98.36 | |
| 1rm6_C | 161 | 4-hydroxybenzoyl-COA reductase gamma subunit; xant | 98.35 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 98.35 | |
| 1ffv_A | 163 | CUTS, iron-sulfur protein of carbon monoxide dehyd | 98.34 | |
| 1n62_A | 166 | Carbon monoxide dehydrogenase small chain; CODH, m | 98.34 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 98.31 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 98.24 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 97.97 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 97.87 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 97.83 | |
| 2w3s_A | 462 | Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 | 97.35 | |
| 3nvw_A | 164 | Xanthine dehydrogenase/oxidase; hydroxylase, homod | 97.31 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 97.21 | |
| 1vlb_A | 907 | Aldehyde oxidoreductase; iron-sulphur cluster; HET | 97.2 | |
| 1dgj_A | 907 | Aldehyde oxidoreductase; beta half-barrel, four-he | 97.02 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 95.88 | |
| 3unc_A | 1332 | Xanthine dehydrogenase/oxidase; oxidoreductase; HE | 95.02 | |
| 3zyv_A | 1335 | AOH1; oxidoreductase, molybdenum cofactor; HET: MT | 92.99 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 89.57 |
| >1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 | Back alignment and structure |
|---|
Probab=99.85 E-value=1.4e-21 Score=136.44 Aligned_cols=79 Identities=27% Similarity=0.557 Sum_probs=71.2
Q ss_pred ceEEEEEeCCCCcEEEEEeCCCChHHHHHHHCCCCCCCCCCceecCCceEEEecCccCCcccCCCChhhhcCceEEeEEe
Q 032345 62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSA 141 (142)
Q Consensus 62 ~~~Vti~~~~~G~~~~~~v~~getLL~aa~~~GI~l~~~Cr~G~CGtC~v~v~~G~v~~~e~~~Ls~~e~~~g~~LaCq~ 141 (142)
.++|+|.. +|..++|++++|+|||++|+++|+.++++|+.|.||+|+++|++|++.+.+...|+++++++||+|+||+
T Consensus 2 ~~~v~~~~--~~~~~~~~~~~g~tlL~a~~~~gi~i~~~C~~G~Cg~C~v~v~~G~~~~~e~~~L~~~e~~~g~~LaCq~ 79 (98)
T 1iue_A 2 FYNITLRT--NDGEKKIECNEDEYILDASERQNVELPYSCRGGSCSTCAAKLVEGEVDNDDQSYLDEEQIKKKYILLCTC 79 (98)
T ss_dssp EEEEEEEE--TTEEEEEEEETTSCHHHHHHHTTCCCCCSSCSSSSSTTEEEEEESCEECTTCCSSCHHHHHTTEEEGGGC
T ss_pred cEEEEEEe--CCCeEEEEeCCCCcHHHHHHHcCCCCCCCCCCCcCCCCEEEEeeCCccccccccCCHHHHhCCeEEEeEC
Confidence 47888875 3435789999999999999999999999999999999999999999988888889999999999999997
Q ss_pred C
Q 032345 142 L 142 (142)
Q Consensus 142 ~ 142 (142)
+
T Consensus 80 ~ 80 (98)
T 1iue_A 80 Y 80 (98)
T ss_dssp E
T ss_pred E
Confidence 4
|
| >1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A | Back alignment and structure |
|---|
| >1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... | Back alignment and structure |
|---|
| >1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 | Back alignment and structure |
|---|
| >2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* | Back alignment and structure |
|---|
| >1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A | Back alignment and structure |
|---|
| >2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A | Back alignment and structure |
|---|
| >3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A | Back alignment and structure |
|---|
| >1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} | Back alignment and structure |
|---|
| >3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A | Back alignment and structure |
|---|
| >1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 | Back alignment and structure |
|---|
| >3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* | Back alignment and structure |
|---|
| >1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* | Back alignment and structure |
|---|
| >3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
| >1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* | Back alignment and structure |
|---|
| >1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* | Back alignment and structure |
|---|
| >3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 142 | ||||
| d1czpa_ | 98 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A | 1e-15 | |
| d1doia_ | 128 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu | 7e-14 | |
| d1krha3 | 104 | d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, | 2e-13 | |
| d1iuea_ | 98 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite | 3e-12 | |
| d1frda_ | 98 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A | 3e-11 | |
| d1a70a_ | 97 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia | 5e-11 | |
| d1jq4a_ | 98 | d.15.4.2 (A:) Methane monooxygenase reductase N-te | 7e-11 | |
| d1frra_ | 95 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense | 8e-11 | |
| d1wria_ | 93 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense | 9e-10 | |
| d1awda_ | 94 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [ | 1e-09 | |
| d2piaa3 | 98 | d.15.4.2 (A:224-321) Phthalate dioxygenase reducta | 3e-09 | |
| d2fug33 | 95 | d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai | 8e-04 | |
| d1xlqa1 | 106 | d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas | 0.001 | |
| d1b9ra_ | 105 | d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., | 0.002 |
| >d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin-related domain: 2Fe-2S ferredoxin species: Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]
Score = 65.8 bits (160), Expect = 1e-15
Identities = 28/68 (41%), Positives = 41/68 (60%)
Query: 62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
T KVT+ + G HE VP+D+YIL AE Q LPF+CR G C++CA ++ SG + Q
Sbjct: 2 TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQS 61
Query: 122 EALGISAE 129
+ + +
Sbjct: 62 DQSFLDDD 69
|
| >d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 | Back information, alignment and structure |
|---|
| >d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 | Back information, alignment and structure |
|---|
| >d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 98 | Back information, alignment and structure |
|---|
| >d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 | Back information, alignment and structure |
|---|
| >d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 | Back information, alignment and structure |
|---|
| >d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 93 | Back information, alignment and structure |
|---|
| >d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Length = 94 | Back information, alignment and structure |
|---|
| >d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 | Back information, alignment and structure |
|---|
| >d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 | Back information, alignment and structure |
|---|
| >d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 | Back information, alignment and structure |
|---|
| >d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| d1czpa_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 99.91 | |
| d1frra_ | 95 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 99.91 | |
| d1awda_ | 94 | 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | 99.9 | |
| d1iuea_ | 98 | 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa | 99.9 | |
| d1frda_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 99.9 | |
| d1a70a_ | 97 | 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta | 99.9 | |
| d1krha3 | 104 | Benzoate dioxygenase reductase, N-terminal domain | 99.89 | |
| d1jq4a_ | 98 | Methane monooxygenase reductase N-terminal domain | 99.89 | |
| d1wria_ | 93 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 99.88 | |
| d2piaa3 | 98 | Phthalate dioxygenase reductase, C-terminal domain | 99.85 | |
| d1doia_ | 128 | 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui | 99.78 | |
| d1e9ma_ | 106 | 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo | 99.69 | |
| d1i7ha_ | 109 | Adrenodoxin-like ferredoxin {Escherichia coli [Tax | 99.68 | |
| d1l5pa_ | 93 | 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 | 99.68 | |
| d2fug33 | 95 | Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi | 99.67 | |
| d1xlqa1 | 106 | 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox | 99.65 | |
| d1b9ra_ | 105 | 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T | 99.65 | |
| d2bt6a1 | 104 | Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | 99.55 | |
| d3c8ya2 | 126 | Fe-only hydrogenase, N-terminal domain {Clostridiu | 98.44 | |
| d1t3qa2 | 81 | Quinoline 2-oxidoreductase small subunit QorS, N-d | 98.34 | |
| d1rm6c2 | 81 | 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, | 98.32 | |
| d1dgja2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 98.26 | |
| d2bs2b2 | 106 | Fumarate reductase iron-sulfur protein, N-terminal | 98.25 | |
| d1vlba2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 98.23 | |
| d1ffva2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 98.12 | |
| d1n62a2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 98.11 | |
| d1kf6b2 | 105 | Fumarate reductase iron-sulfur protein, N-terminal | 98.0 | |
| d1jroa2 | 84 | Xanthine dehydrogenase chain A, N-terminal domain | 98.0 | |
| d1v97a2 | 90 | Xanthine oxidase, N-terminal domain {Cow (Bos taur | 97.63 | |
| d1nekb2 | 106 | Succinate dehydogenase iron-sulfur protein, N-term | 97.31 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 95.18 |
| >d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin-related domain: 2Fe-2S ferredoxin species: Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]
Probab=99.91 E-value=3.3e-25 Score=154.85 Aligned_cols=81 Identities=36% Similarity=0.638 Sum_probs=76.6
Q ss_pred ceEEEEEeCCCCcEEEEEeCCCChHHHHHHHCCCCCCCCCCceecCCceEEEecCccCCcccCCCChhhhcCceEEeEEe
Q 032345 62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSA 141 (142)
Q Consensus 62 ~~~Vti~~~~~G~~~~~~v~~getLL~aa~~~GI~l~~~Cr~G~CGtC~v~v~~G~v~~~e~~~Ls~~e~~~g~~LaCq~ 141 (142)
+|+|||.+..+|..++|.+++|+|||++|+++||++||+|+.|.||+|+++|++|++.+.+...|+++++++||+|+||+
T Consensus 2 t~~Vtl~~~~~g~~~~~~v~~~~slL~a~~~~Gi~ip~~C~~G~CgtC~~~v~~G~v~~~~~~~l~~~e~~~g~~L~C~~ 81 (98)
T d1czpa_ 2 TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVA 81 (98)
T ss_dssp EEEEEEEETTTTEEEEEEEETTSCHHHHHHHTTCCCCCSSSSSSSSTTEEEEEESCEECTTCCSSCHHHHHTTEEEGGGC
T ss_pred eEEEEEEEcCCCCEEEEEeCcCChHHHHHHHcCCCeEEecCCcccCCCeeEEecccccccccccCChhHhcCCeEEeccC
Confidence 68999988778888899999999999999999999999999999999999999999999888899999999999999997
Q ss_pred C
Q 032345 142 L 142 (142)
Q Consensus 142 ~ 142 (142)
+
T Consensus 82 ~ 82 (98)
T d1czpa_ 82 Y 82 (98)
T ss_dssp E
T ss_pred E
Confidence 4
|
| >d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | Back information, alignment and structure |
|---|
| >d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} | Back information, alignment and structure |
|---|
| >d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} | Back information, alignment and structure |
|---|
| >d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} | Back information, alignment and structure |
|---|
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|