Citrus Sinensis ID: 032345

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MDLLVPPSSCCRKPPLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVNGSYSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSAL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEcccccHHHHHHHHccccccccccccccccccEEEEEEEEEccccccccHHHHHcccEEEEEEc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccEEEEEEEEccccEEEEEEEEccccHHHHHHHcccccccccccccccccEEEEEEccEEccccccccHHHHHccEEEEEEEc
mdllvppssccrkpplhrqltsstynntrnpsslkcrprktvsselqttagvngsyspsipthkvtvhdrfrgvvheflvpedqyiLHTAEsqnitlpfacrhgcctscavriksgqikqpealgiSAELKSKACTILLSAL
mdllvppssccrkpplhrqltsstynntrnpsslkcrprktVSSELQttagvngsyspsiptHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKsgqikqpealgisaelksKACTILLSAL
MDLLVPPSSCCRKPPLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVNGSYSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSAL
***********************************************************IPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTIL****
******P*SCC**************************************************THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSAL
MDLLVPPSSCCRKPPLHRQLTSS***********************QTTAGVNGSYSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSAL
*******************************************************YSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSAL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLVPPSSCCRKPPLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVNGSYSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
P0A3C799 Ferredoxin-1 OS=Nostoc sp no no 0.443 0.636 0.444 7e-11
P0A3C899 Ferredoxin-1 OS=Anabaena N/A no 0.443 0.636 0.444 7e-11
P0025399 Ferredoxin OS=Nostoc musc N/A no 0.443 0.636 0.428 2e-10
P1578899 Ferredoxin OS=Halothece s N/A no 0.443 0.636 0.412 3e-10
P94044155 Ferredoxin-6, chloroplast N/A no 0.359 0.329 0.470 5e-10
Q5157799 Ferredoxin-1 OS=Plectonem N/A no 0.443 0.636 0.412 5e-10
P27788152 Ferredoxin-3, chloroplast N/A no 0.697 0.651 0.330 1e-09
P0024899 Ferredoxin OS=Mastigoclad N/A no 0.443 0.636 0.412 1e-09
P0025499 Ferredoxin-1 OS=Anabaena no no 0.443 0.636 0.412 1e-09
P08451105 Ferredoxin-2 OS=Synechoco no no 0.542 0.733 0.354 2e-09
>sp|P0A3C7|FER1_NOSS1 Ferredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=petF PE=1 SV=2 Back     alignment and function desciption
 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 60  IPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIK 119
           + T KVT+ +   G  HE  VP+D+YIL  AE Q   LPF+CR G C++CA ++ SG + 
Sbjct: 1   MATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVD 60

Query: 120 QPE 122
           Q +
Sbjct: 61  QSD 63
Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
Nostoc sp. (strain PCC 7120 / UTEX 2576) (taxid: 103690)
>sp|P0A3C8|FER1_ANASO Ferredoxin-1 OS=Anabaena sp. (strain PCC 7119) GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P00253|FER_NOSMU Ferredoxin OS=Nostoc muscorum PE=1 SV=2 Back     alignment and function description
>sp|P15788|FER_HALP7 Ferredoxin OS=Halothece sp. (strain PCC 7418) PE=1 SV=2 Back     alignment and function description
>sp|P94044|FER6_MAIZE Ferredoxin-6, chloroplastic OS=Zea mays GN=FDX6 PE=2 SV=1 Back     alignment and function description
>sp|Q51577|FER1_PLEBO Ferredoxin-1 OS=Plectonema boryanum GN=petF1 PE=1 SV=1 Back     alignment and function description
>sp|P27788|FER3_MAIZE Ferredoxin-3, chloroplastic OS=Zea mays GN=FDX3 PE=2 SV=1 Back     alignment and function description
>sp|P00248|FER_MASLA Ferredoxin OS=Mastigocladus laminosus GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P00254|FER1_ANAVT Ferredoxin-1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=petF1 PE=1 SV=2 Back     alignment and function description
>sp|P08451|FER2_SYNP6 Ferredoxin-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=petF2 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
224126299190 predicted protein [Populus trichocarpa] 0.957 0.715 0.703 2e-48
225427258188 PREDICTED: ferredoxin-1 [Vitis vinifera] 0.950 0.718 0.722 1e-45
449461515189 PREDICTED: ferredoxin-like [Cucumis sati 0.957 0.719 0.645 3e-42
224072634142 predicted protein [Populus trichocarpa] 0.929 0.929 0.666 1e-41
449523107188 PREDICTED: LOW QUALITY PROTEIN: ferredox 0.950 0.718 0.645 7e-41
255557611186 Ferredoxin-2, putative [Ricinus communis 0.922 0.704 0.652 7e-40
351629595163 ferredoxin 2 [Dimocarpus longan] 0.816 0.711 0.601 3e-36
356512010169 PREDICTED: ferredoxin-2-like [Glycine ma 0.753 0.633 0.690 1e-35
357476671186 Ferredoxin-6 [Medicago truncatula] gi|35 0.887 0.677 0.597 3e-35
356565441179 PREDICTED: ferredoxin-2-like [Glycine ma 0.816 0.648 0.612 4e-35
>gi|224126299|ref|XP_002329520.1| predicted protein [Populus trichocarpa] gi|222870229|gb|EEF07360.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 9/145 (6%)

Query: 1   MDLLVPPSSC---CRKPPLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVN---- 53
           MDL++   SC   CRKP  +R++ SS  + T++ +SLKCR  KT +SELQ++ GV+    
Sbjct: 1   MDLIISSHSCNSLCRKPAFYRRI-SSPNSTTQHSTSLKCRVAKT-TSELQSSVGVSDRTG 58

Query: 54  GSYSPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRI 113
            SYSPSIPTHKVTVHDR RGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVR+
Sbjct: 59  NSYSPSIPTHKVTVHDRQRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRV 118

Query: 114 KSGQIKQPEALGISAELKSKACTIL 138
           KSGQ++QPEALGISAELKSK   +L
Sbjct: 119 KSGQLRQPEALGISAELKSKGYALL 143

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427258|ref|XP_002281131.1| PREDICTED: ferredoxin-1 [Vitis vinifera] gi|297742123|emb|CBI33910.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449461515|ref|XP_004148487.1| PREDICTED: ferredoxin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224072634|ref|XP_002303817.1| predicted protein [Populus trichocarpa] gi|222841249|gb|EEE78796.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449523107|ref|XP_004168566.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255557611|ref|XP_002519835.1| Ferredoxin-2, putative [Ricinus communis] gi|223540881|gb|EEF42439.1| Ferredoxin-2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351629595|gb|AEQ54761.1| ferredoxin 2 [Dimocarpus longan] Back     alignment and taxonomy information
>gi|356512010|ref|XP_003524714.1| PREDICTED: ferredoxin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|357476671|ref|XP_003608621.1| Ferredoxin-6 [Medicago truncatula] gi|355509676|gb|AES90818.1| Ferredoxin-6 [Medicago truncatula] gi|388498102|gb|AFK37117.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356565441|ref|XP_003550948.1| PREDICTED: ferredoxin-2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
TAIR|locus:2206644194 FdC2 "ferredoxin C 2" [Arabido 0.894 0.654 0.542 1.4e-30
UNIPROTKB|P0A3C899 petF "Ferredoxin-1" [Nostoc sp 0.429 0.616 0.459 5.8e-11
TAIR|locus:2038593155 FD3 "ferredoxin 3" [Arabidopsi 0.788 0.722 0.321 1.8e-09
UNIPROTKB|P00221147 PETF "Ferredoxin-1, chloroplas 0.626 0.605 0.347 2.9e-09
UNIPROTKB|P0A3C998 petF1 "Ferredoxin-1" [Thermosy 0.422 0.612 0.442 7.6e-09
UNIPROTKB|P8352297 P83522 "Ferredoxin" [Hordeum v 0.323 0.474 0.5 4.2e-08
UNIPROTKB|P8358597 P83585 "Ferredoxin" [Solanum a 0.323 0.474 0.456 1.4e-07
UNIPROTKB|P09911149 PETF "Ferredoxin-1, chloroplas 0.746 0.711 0.297 1.8e-07
UNIPROTKB|P8358397 P83583 "Ferredoxin" [Solanum l 0.323 0.474 0.456 2.9e-07
GENEDB_PFALCIPARUM|MAL13P1.95194 MAL13P1.95 "ferredoxin" [Plasm 0.366 0.268 0.377 3.1e-07
TAIR|locus:2206644 FdC2 "ferredoxin C 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 77/142 (54%), Positives = 100/142 (70%)

Query:     1 MDLLVPPSSCC--RKP--PLHRQLTSSTYNNTRNPSSLKCRPRKTVSSELQTTAGVNGSY 56
             M L++P + C   +K   P++R+  +   N  R  ++  C  R  V  E+ T +   GS 
Sbjct:     1 MALILPCTFCTSLQKKNFPINRRYIT---NFRRGATTATCEFRIPV--EVSTPSD-RGSL 54

Query:    57 SPSIPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSG 116
                +P+HKVTVHDR RGVVHEF   EDQYILH+AESQNI+LPFACRHGCCTSCAVR+KSG
Sbjct:    55 V--VPSHKVTVHDRQRGVVHEF---EDQYILHSAESQNISLPFACRHGCCTSCAVRVKSG 109

Query:   117 QIKQPEALGISAELKSKACTIL 138
             +++QP+ALGISAELKS+  + L
Sbjct:   110 ELRQPQALGISAELKSQRISSL 131
GO:0009055 "electron carrier activity" evidence=IEA;ISS;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0022900 "electron transport chain" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0009688 "abscisic acid biosynthetic process" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
UNIPROTKB|P0A3C8 petF "Ferredoxin-1" [Nostoc sp. PCC 7119 (taxid:1168)] Back     alignment and assigned GO terms
TAIR|locus:2038593 FD3 "ferredoxin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P00221 PETF "Ferredoxin-1, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3C9 petF1 "Ferredoxin-1" [Thermosynechococcus elongatus BP-1 (taxid:197221)] Back     alignment and assigned GO terms
UNIPROTKB|P83522 P83522 "Ferredoxin" [Hordeum vulgare (taxid:4513)] Back     alignment and assigned GO terms
UNIPROTKB|P83585 P83585 "Ferredoxin" [Solanum abutiloides (taxid:45831)] Back     alignment and assigned GO terms
UNIPROTKB|P09911 PETF "Ferredoxin-1, chloroplastic" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|P83583 P83583 "Ferredoxin" [Solanum lyratum (taxid:230192)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|MAL13P1.95 MAL13P1.95 "ferredoxin" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_1180060
hypothetical protein (191 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
TIGR0200897 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] 4e-14
CHL0013499 CHL00134, petF, ferredoxin; Validated 2e-13
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 1e-11
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 2e-10
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 5e-09
PTZ00038191 PTZ00038, PTZ00038, ferredoxin; Provisional 1e-08
PLN03136148 PLN03136, PLN03136, Ferredoxin; Provisional 7e-07
PRK07609 339 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucosee 1e-06
PRK11872 340 PRK11872, antC, anthranilate dioxygenase reductase 0.001
PRK05713 312 PRK05713, PRK05713, hypothetical protein; Provisio 0.002
>gnl|CDD|233684 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] Back     alignment and domain information 
 Score = 63.2 bits (154), Expect = 4e-14
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 62  THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
           T+KVT+ +   G       P+DQYIL  AE   I LP++CR G C++CA +++ G + Q 
Sbjct: 2   TYKVTLVNP-DGGEETIECPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKVEEGTVDQS 60

Query: 122 E 122
           +
Sbjct: 61  D 61

This model represents single domain 2Fe-2S (also called plant type) ferredoxins. In general, these occur as a single domain proteins or with a chloroplast transit peptide. Species tend to be photosynthetic, but several forms may occur in one species and individually may not be associated with photocynthesis. Halobacterial forms differ somewhat in architecture; they score between trusted and noise cutoffs. Sequences scoring below the noise cutoff tend to be ferredoxin-related domains of larger proteins. Length = 97
>gnl|CDD|177056 CHL00134, petF, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|240237 PTZ00038, PTZ00038, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|178681 PLN03136, PLN03136, Ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>gnl|CDD|183350 PRK11872, antC, anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>gnl|CDD|235575 PRK05713, PRK05713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
CHL0013499 petF ferredoxin; Validated 99.89
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.87
PLN03136148 Ferredoxin; Provisional 99.84
PTZ00038191 ferredoxin; Provisional 99.83
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.82
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.8
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.78
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.74
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.74
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.74
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.73
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.71
PRK05713 312 hypothetical protein; Provisional 99.69
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.67
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.66
PLN02593117 adrenodoxin-like ferredoxin protein 99.65
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.64
PTZ00490143 Ferredoxin superfamily; Provisional 99.58
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.3
COG3894 614 Uncharacterized metal-binding protein [General fun 98.98
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.7
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.69
KOG3309159 consensus Ferredoxin [Energy production and conver 98.65
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.57
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 98.21
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 98.18
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.99
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 97.96
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 97.93
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 97.83
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 97.8
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.77
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 97.72
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.67
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 97.6
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 97.6
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 97.6
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 97.6
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 97.58
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 97.51
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 97.49
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 97.49
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 97.48
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.42
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 97.34
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 97.34
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.32
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.29
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 97.25
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 97.24
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 97.13
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 96.69
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 96.6
PRK09800 956 putative hypoxanthine oxidase; Provisional 96.35
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 96.12
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 95.94
PLN00192 1344 aldehyde oxidase 95.66
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 94.77
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 92.46
COG4630 493 XdhA Xanthine dehydrogenase, iron-sulfur cluster a 85.24
PLN02906 1319 xanthine dehydrogenase 85.06
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 83.61
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 82.34
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 82.06
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 80.31
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information 
Probab=99.89  E-value=8.5e-23  Score=145.26  Aligned_cols=83  Identities=30%  Similarity=0.554  Sum_probs=74.3

Q ss_pred             CCceEEEEEeCCCCcEEEEEeCCCChHHHHHHHCCCCCCCCCCceecCCceEEEecCccCCcccCCCChhhhcCceEEeE
Q 032345           60 IPTHKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILL  139 (142)
Q Consensus        60 ~~~~~Vti~~~~~G~~~~~~v~~getLL~aa~~~GI~l~~~Cr~G~CGtC~v~v~~G~v~~~e~~~Ls~~e~~~g~~LaC  139 (142)
                      |..|+|+|.+..+|..+.|++++|+|||++|+++||+++|+|+.|.||+|+++|++|++.+.+...|+++++++||+|+|
T Consensus         1 ~~~~~v~~~~~~~~~~~~~~~~~~~tLL~a~~~~Gi~i~~~C~~G~Cg~C~v~v~~G~v~~~~~~~l~~~e~~~g~~L~C   80 (99)
T CHL00134          1 MATYKVTLLSEEEGIDVTIDCPDDVYILDAAEEQGIDLPYSCRAGACSTCAGKVTEGTVDQSDQSFLDDDQLEAGFVLTC   80 (99)
T ss_pred             CCeEEEEEEecCCCCeEEEEECCCCcHHHHHHHcCCCCCcCCCCccCCCCEEEEEeCccccCcccCCCHHHHhCCeEEEe
Confidence            34589999764466668899999999999999999999999999999999999999999887666699999999999999


Q ss_pred             EeC
Q 032345          140 SAL  142 (142)
Q Consensus       140 q~~  142 (142)
                      |++
T Consensus        81 ~~~   83 (99)
T CHL00134         81 VAY   83 (99)
T ss_pred             eCE
Confidence            974

>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
1qof_A98 Ferredoxin Mutation Q70k Length = 98 1e-11
1j7b_A98 Structure Of The Anabaena Ferredoxin Mutant E94k Le 1e-11
1j7c_A98 Structure Of The Anabaena Ferredoxin Mutant E95k Le 1e-11
1fxa_A98 Crystallization And Structure Determination To 2.5- 1e-11
1j7a_A98 Structure Of The Anabaena Ferredoxin D68k Mutant Le 1e-11
1qob_A98 Ferredoxin Mutation D62k Length = 98 2e-11
1qog_A98 Ferredoxin Mutation S47a Length = 98 2e-11
3b2g_A98 Leptolyngbya Boryana Ferredoxin Length = 98 9e-11
1qoa_A98 Ferredoxin Mutation C49s Length = 98 1e-10
1rfk_A98 Crystal Structure Of 2fe2s Ferredoxin From Thermoph 2e-10
1roe_A97 Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elo 2e-09
1a70_A97 Spinach Ferredoxin Length = 97 6e-09
4fxc_A98 Tertiary Structure Of [2fe-2s] Ferredoxin From Spir 2e-08
1gaq_B98 Crystal Structure Of The Complex Between Ferredoxin 2e-08
1awd_A94 Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fu 3e-08
3p63_A96 Structure Of M. Laminosus Ferredoxin With A Shorter 3e-08
3av8_A97 Refined Structure Of Plant-Type [2fe-2s] Ferredoxin 3e-07
1pfd_A96 The Solution Structure Of High Plant Parsley [2fe-2 3e-07
1iue_A98 Crystal Structure Analysis Of Ferredoxin From Plasm 4e-07
3ab5_A97 Crystal Structure Of The 2fe 2s Ferredoxin From Cya 5e-07
1fxi_A96 Structure Of The [2fe-2s] Ferredoxin I From The Blu 6e-07
1e10_A128 [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le 1e-06
1e0z_A128 [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le 1e-06
1dox_A96 1h And 15n Sequential Assignment, Secondary Structu 4e-06
1off_A97 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 L 4e-06
2pvg_C96 Crystal Srtucture Of The Binary Complex Between Fer 5e-06
1doi_A128 2fe-2s Ferredoxin From Haloarcula Marismortui Lengt 9e-06
1frr_A95 Crystal Structure Of [2fe-2s] Ferredoxin I From Equ 1e-05
>pdb|1QOF|A Chain A, Ferredoxin Mutation Q70k Length = 98 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 39/61 (63%)
Query: 62  THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
           T KVT+ +   G  HE  VP+D+YIL  AE Q   LPF+CR G C++CA ++ SG + Q 
Sbjct: 2   TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQS 61
Query: 122 E 122
           +
Sbjct: 62  D 62
>pdb|1J7B|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E94k Length = 98 Back     alignment and structure
>pdb|1J7C|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E95k Length = 98 Back     alignment and structure
>pdb|1FXA|A Chain A, Crystallization And Structure Determination To 2.5-Angstroms Resolution Of The Oxidized [2fe-2s] Ferredoxin Isolated From Anabaena 7120 Length = 98 Back     alignment and structure
>pdb|1J7A|A Chain A, Structure Of The Anabaena Ferredoxin D68k Mutant Length = 98 Back     alignment and structure
>pdb|1QOB|A Chain A, Ferredoxin Mutation D62k Length = 98 Back     alignment and structure
>pdb|1QOG|A Chain A, Ferredoxin Mutation S47a Length = 98 Back     alignment and structure
>pdb|3B2G|A Chain A, Leptolyngbya Boryana Ferredoxin Length = 98 Back     alignment and structure
>pdb|1QOA|A Chain A, Ferredoxin Mutation C49s Length = 98 Back     alignment and structure
>pdb|1RFK|A Chain A, Crystal Structure Of 2fe2s Ferredoxin From Thermophilic Cyanobacterium Mastigocladus Laminosus Length = 98 Back     alignment and structure
>pdb|1ROE|A Chain A, Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elongatus Length = 97 Back     alignment and structure
>pdb|1A70|A Chain A, Spinach Ferredoxin Length = 97 Back     alignment and structure
>pdb|4FXC|A Chain A, Tertiary Structure Of [2fe-2s] Ferredoxin From Spirulina Platensis Refined At 2.5 Angstroms Resolution: Structural Comparisons Of Plant-Type Ferredoxins And An Electrostatic Potential Analysis Length = 98 Back     alignment and structure
>pdb|1GAQ|B Chain B, Crystal Structure Of The Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Length = 98 Back     alignment and structure
>pdb|1AWD|A Chain A, Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fusca Length = 94 Back     alignment and structure
>pdb|3P63|A Chain A, Structure Of M. Laminosus Ferredoxin With A Shorter L1,2 Loop Length = 96 Back     alignment and structure
>pdb|3AV8|A Chain A, Refined Structure Of Plant-Type [2fe-2s] Ferredoxin I From Aphanothece Sacrum At 1.46 A Resolution Length = 97 Back     alignment and structure
>pdb|1PFD|A Chain A, The Solution Structure Of High Plant Parsley [2fe-2s] Ferredoxin, Nmr, 18 Structures Length = 96 Back     alignment and structure
>pdb|1IUE|A Chain A, Crystal Structure Analysis Of Ferredoxin From Plasmodium Falciparum Length = 98 Back     alignment and structure
>pdb|3AB5|A Chain A, Crystal Structure Of The 2fe 2s Ferredoxin From Cyanidioschyzon Merolae Length = 97 Back     alignment and structure
>pdb|1FXI|A Chain A, Structure Of The [2fe-2s] Ferredoxin I From The Blue-Green Alga Aphanothece Sacrum At 2.2 Angstroms Resolution Length = 96 Back     alignment and structure
>pdb|1E10|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 Back     alignment and structure
>pdb|1E0Z|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 Back     alignment and structure
>pdb|1DOX|A Chain A, 1h And 15n Sequential Assignment, Secondary Structure And Tertiary Fold Of [2fe-2s] Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 96 Back     alignment and structure
>pdb|1OFF|A Chain A, 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 97 Back     alignment and structure
>pdb|2PVG|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin And Ferredoxin:thioredoxin Reductase Length = 96 Back     alignment and structure
>pdb|1DOI|A Chain A, 2fe-2s Ferredoxin From Haloarcula Marismortui Length = 128 Back     alignment and structure
>pdb|1FRR|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin I From Equisetum Arvense At 1.8 Angstroms Resolution Length = 95 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 2e-26
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 1e-25
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 5e-25
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 3e-24
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 4e-24
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 3e-23
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 3e-21
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 1e-19
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 6e-18
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 7e-14
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 7e-08
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 6e-07
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Length = 98 Back     alignment and structure
 Score = 94.3 bits (235), Expect = 2e-26
 Identities = 28/72 (38%), Positives = 41/72 (56%)

Query: 62  THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
           T KVT+ +   G  HE  VP+D+YIL  AE Q   LPF+CR G C++CA ++ SG + Q 
Sbjct: 2   TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQS 61

Query: 122 EALGISAELKSK 133
           +   +  +    
Sbjct: 62  DQSFLDDDQIEA 73
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Length = 94 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Length = 97 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Length = 95 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Length = 128 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Length = 98 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.85
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.85
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.85
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.84
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.84
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.84
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.83
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.82
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.81
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.79
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.78
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.78
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.78
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.78
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.77
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.77
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.77
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.76
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.76
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.76
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.75
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.72
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.68
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.59
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.75
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 98.36
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 98.35
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.35
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 98.34
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 98.34
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.31
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 98.24
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.97
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 97.87
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 97.83
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 97.35
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 97.31
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 97.21
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 97.2
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 97.02
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 95.88
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 95.02
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 92.99
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 89.57
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
Probab=99.85  E-value=1.4e-21  Score=136.44  Aligned_cols=79  Identities=27%  Similarity=0.557  Sum_probs=71.2

Q ss_pred             ceEEEEEeCCCCcEEEEEeCCCChHHHHHHHCCCCCCCCCCceecCCceEEEecCccCCcccCCCChhhhcCceEEeEEe
Q 032345           62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSA  141 (142)
Q Consensus        62 ~~~Vti~~~~~G~~~~~~v~~getLL~aa~~~GI~l~~~Cr~G~CGtC~v~v~~G~v~~~e~~~Ls~~e~~~g~~LaCq~  141 (142)
                      .++|+|..  +|..++|++++|+|||++|+++|+.++++|+.|.||+|+++|++|++.+.+...|+++++++||+|+||+
T Consensus         2 ~~~v~~~~--~~~~~~~~~~~g~tlL~a~~~~gi~i~~~C~~G~Cg~C~v~v~~G~~~~~e~~~L~~~e~~~g~~LaCq~   79 (98)
T 1iue_A            2 FYNITLRT--NDGEKKIECNEDEYILDASERQNVELPYSCRGGSCSTCAAKLVEGEVDNDDQSYLDEEQIKKKYILLCTC   79 (98)
T ss_dssp             EEEEEEEE--TTEEEEEEEETTSCHHHHHHHTTCCCCCSSCSSSSSTTEEEEEESCEECTTCCSSCHHHHHTTEEEGGGC
T ss_pred             cEEEEEEe--CCCeEEEEeCCCCcHHHHHHHcCCCCCCCCCCCcCCCCEEEEeeCCccccccccCCHHHHhCCeEEEeEC
Confidence            47888875  3435789999999999999999999999999999999999999999988888889999999999999997


Q ss_pred             C
Q 032345          142 L  142 (142)
Q Consensus       142 ~  142 (142)
                      +
T Consensus        80 ~   80 (98)
T 1iue_A           80 Y   80 (98)
T ss_dssp             E
T ss_pred             E
Confidence            4
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1czpa_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 1e-15
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 7e-14
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 2e-13
d1iuea_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite 3e-12
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 3e-11
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 5e-11
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 7e-11
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 8e-11
d1wria_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 9e-10
d1awda_94 d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [ 1e-09
d2piaa398 d.15.4.2 (A:224-321) Phthalate dioxygenase reducta 3e-09
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 8e-04
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 0.001
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 0.002
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]

 Score = 65.8 bits (160), Expect = 1e-15
 Identities = 28/68 (41%), Positives = 41/68 (60%)

Query: 62  THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQP 121
           T KVT+ +   G  HE  VP+D+YIL  AE Q   LPF+CR G C++CA ++ SG + Q 
Sbjct: 2   TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQS 61

Query: 122 EALGISAE 129
           +   +  +
Sbjct: 62  DQSFLDDD 69
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 98 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 93 Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Length = 94 Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.91
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.91
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.9
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.9
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.9
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.9
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.89
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.89
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.88
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.85
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.78
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.69
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.68
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.68
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.67
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.65
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.65
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.55
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.44
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.34
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 98.32
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.26
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 98.25
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.23
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.12
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.11
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 98.0
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 98.0
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 97.63
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 97.31
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 95.18
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]

Probab=99.91  E-value=3.3e-25  Score=154.85  Aligned_cols=81  Identities=36%  Similarity=0.638  Sum_probs=76.6

Q ss_pred             ceEEEEEeCCCCcEEEEEeCCCChHHHHHHHCCCCCCCCCCceecCCceEEEecCccCCcccCCCChhhhcCceEEeEEe
Q 032345           62 THKVTVHDRFRGVVHEFLVPEDQYILHTAESQNITLPFACRHGCCTSCAVRIKSGQIKQPEALGISAELKSKACTILLSA  141 (142)
Q Consensus        62 ~~~Vti~~~~~G~~~~~~v~~getLL~aa~~~GI~l~~~Cr~G~CGtC~v~v~~G~v~~~e~~~Ls~~e~~~g~~LaCq~  141 (142)
                      +|+|||.+..+|..++|.+++|+|||++|+++||++||+|+.|.||+|+++|++|++.+.+...|+++++++||+|+||+
T Consensus         2 t~~Vtl~~~~~g~~~~~~v~~~~slL~a~~~~Gi~ip~~C~~G~CgtC~~~v~~G~v~~~~~~~l~~~e~~~g~~L~C~~   81 (98)
T d1czpa_           2 TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVA   81 (98)
T ss_dssp             EEEEEEEETTTTEEEEEEEETTSCHHHHHHHTTCCCCCSSSSSSSSTTEEEEEESCEECTTCCSSCHHHHHTTEEEGGGC
T ss_pred             eEEEEEEEcCCCCEEEEEeCcCChHHHHHHHcCCCeEEecCCcccCCCeeEEecccccccccccCChhHhcCCeEEeccC
Confidence            68999988778888899999999999999999999999999999999999999999999888899999999999999997


Q ss_pred             C
Q 032345          142 L  142 (142)
Q Consensus       142 ~  142 (142)
                      +
T Consensus        82 ~   82 (98)
T d1czpa_          82 Y   82 (98)
T ss_dssp             E
T ss_pred             E
Confidence            4
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure