Citrus Sinensis ID: 032350


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MSKFARVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTPRE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccEEccccccccccccccc
cccEEEEEEcccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccc
MSKFARVICqdkkmslpggdwmcaacqhqnfkkreacqrcgypkyggpdvstylcnrtevlagdwyctamncgahnyasrpncyrcgaaktDYACANMmaygtdgsvppgwksgdwicnrmgcgvhnyasrmvcykcktpre
MSKFARVICQdkkmslpggDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHnyasrmvcykcktpre
MSKFARVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTPRE
*****RVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKC*****
********************WMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMA*********GWKSGDWICNRMGCGVHNYASRMVCYKCKTP**
MSKFARVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTPRE
*SKFARVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGY*****************VLAGDWYCTAMNCGAHNYASRPNCYRCGA***********************KSGDWICNRMGCGVHNYASRMVCYKCK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKFARVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTPRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
O13801 604 Uncharacterized RNA-bindi yes no 0.838 0.197 0.283 5e-08
Q5ZLX5 334 Zinc finger Ran-binding d yes no 0.556 0.236 0.397 1e-05
Q19QU3 328 Zinc finger Ran-binding d yes no 0.556 0.240 0.386 6e-05
O35986 330 Zinc finger Ran-binding d yes no 0.556 0.239 0.386 6e-05
Q5R580 320 Zinc finger Ran-binding d yes no 0.556 0.246 0.386 6e-05
Q9R020 330 Zinc finger Ran-binding d yes no 0.556 0.239 0.386 6e-05
O95218 330 Zinc finger Ran-binding d yes no 0.556 0.239 0.386 6e-05
P70501 852 RNA-binding protein 10 OS no no 0.161 0.026 0.6 0.0005
Q99KG3 930 RNA-binding protein 10 OS no no 0.161 0.024 0.6 0.0005
P98175 930 RNA-binding protein 10 OS no no 0.161 0.024 0.6 0.0005
>sp|O13801|YE04_SCHPO Uncharacterized RNA-binding protein C17H9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.04c PE=1 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 57/134 (42%), Gaps = 15/134 (11%)

Query: 19  GDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRT---EVLAGDWYCTAMNCGAH 75
           GDW C  C   NF++R +C RC +P  G   VS    + T   +   G+ Y    +    
Sbjct: 345 GDWNCPMCGFSNFQRRTSCFRCSFP--GPTHVSAATGSNTFSPDFPYGNSYGNGSSHFIA 402

Query: 76  NYASRPNCYRCGAAKTDYACAN--------MMAYGTDGSVPPGWKSGDWICNRMGCGVHN 127
           NY    +       ++D    N          +    G+VP  +++GDW C   GCG HN
Sbjct: 403 NYGGSVHHSNENTMQSDLQHQNGNNAVNHHHSSRSFGGNVP--FRAGDWKCGSEGCGYHN 460

Query: 128 YASRMVCYKCKTPR 141
           +A  + C +C   R
Sbjct: 461 FAKNVCCLRCGASR 474





Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q5ZLX5|ZRAB2_CHICK Zinc finger Ran-binding domain-containing protein 2 OS=Gallus gallus GN=ZRANB2 PE=2 SV=1 Back     alignment and function description
>sp|Q19QU3|ZRAB2_PIG Zinc finger Ran-binding domain-containing protein 2 OS=Sus scrofa GN=ZRANB2 PE=2 SV=1 Back     alignment and function description
>sp|O35986|ZRAB2_RAT Zinc finger Ran-binding domain-containing protein 2 OS=Rattus norvegicus GN=Zranb2 PE=2 SV=2 Back     alignment and function description
>sp|Q5R580|ZRAB2_PONAB Zinc finger Ran-binding domain-containing protein 2 OS=Pongo abelii GN=ZRANB2 PE=2 SV=1 Back     alignment and function description
>sp|Q9R020|ZRAB2_MOUSE Zinc finger Ran-binding domain-containing protein 2 OS=Mus musculus GN=Zranb2 PE=1 SV=2 Back     alignment and function description
>sp|O95218|ZRAB2_HUMAN Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens GN=ZRANB2 PE=1 SV=2 Back     alignment and function description
>sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus GN=Rbm10 PE=2 SV=1 Back     alignment and function description
>sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=Rbm10 PE=1 SV=1 Back     alignment and function description
>sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
224091300133 predicted protein [Populus trichocarpa] 0.880 0.939 0.755 7e-51
2760836 676 putative second messenger-dependent prot 0.908 0.190 0.694 2e-50
357477963144 Zinc finger protein-like Ser/Thr protein 0.929 0.916 0.717 2e-49
224122470144 predicted protein [Populus trichocarpa] 0.887 0.875 0.723 1e-48
449464598140 PREDICTED: zinc finger Ran-binding domai 0.908 0.921 0.718 2e-48
79602205138 Ran BP2/NZF zinc finger-like protein [Ar 0.908 0.934 0.694 4e-48
297822233138 binding protein [Arabidopsis lyrata subs 0.908 0.934 0.694 5e-48
449526000140 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.908 0.921 0.711 7e-48
388521825140 unknown [Lotus japonicus] 0.908 0.921 0.696 3e-47
356516951140 PREDICTED: zinc finger Ran-binding domai 0.908 0.921 0.681 2e-46
>gi|224091300|ref|XP_002309220.1| predicted protein [Populus trichocarpa] gi|222855196|gb|EEE92743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 96/127 (75%), Positives = 109/127 (85%), Gaps = 2/127 (1%)

Query: 18  GGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNY 77
           GGDWMC+ACQHQNFKKRE CQRCGYPKYGGPD +TY+CN T+VLAGDWYC+AMNC AHNY
Sbjct: 6   GGDWMCSACQHQNFKKREMCQRCGYPKYGGPDPATYICNATKVLAGDWYCSAMNCQAHNY 65

Query: 78  ASRPNCYRCGAAKTDYACANM--MAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCY 135
           ASR +CY CGA + D+A       AYG+DGS PPGWK+GDWIC R+GCGVHNYASRM C+
Sbjct: 66  ASRSSCYNCGALRDDHAAGGYGSNAYGSDGSDPPGWKTGDWICTRLGCGVHNYASRMECF 125

Query: 136 KCKTPRE 142
           KC+TPRE
Sbjct: 126 KCRTPRE 132




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|2760836|gb|AAB95304.1| putative second messenger-dependent protein kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357477963|ref|XP_003609267.1| Zinc finger protein-like Ser/Thr protein kinase-like protein [Medicago truncatula] gi|355510322|gb|AES91464.1| Zinc finger protein-like Ser/Thr protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224122470|ref|XP_002330489.1| predicted protein [Populus trichocarpa] gi|222872423|gb|EEF09554.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449464598|ref|XP_004150016.1| PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79602205|ref|NP_973537.2| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] gi|48310248|gb|AAT41783.1| At2g26695 [Arabidopsis thaliana] gi|50198944|gb|AAT70475.1| At2g26695 [Arabidopsis thaliana] gi|330252782|gb|AEC07876.1| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297822233|ref|XP_002878999.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297324838|gb|EFH55258.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449526000|ref|XP_004170003.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger Ran-binding domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388521825|gb|AFK48974.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356516951|ref|XP_003527154.1| PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
TAIR|locus:1006230021138 AT2G26695 [Arabidopsis thalian 0.908 0.934 0.694 3.4e-54
TAIR|locus:2179479170 AT5G25490 [Arabidopsis thalian 0.605 0.505 0.41 4.8e-31
TAIR|locus:2093317164 AT3G15680 [Arabidopsis thalian 0.704 0.609 0.423 1.3e-20
ASPGD|ASPL0000012537 609 AN8055 [Emericella nidulans (t 0.274 0.064 0.45 6.1e-13
TAIR|locus:2198095455 AT1G48570 [Arabidopsis thalian 0.436 0.136 0.397 9.3e-12
TAIR|locus:2827841 268 AT2G17975 [Arabidopsis thalian 0.704 0.373 0.310 4.7e-11
UNIPROTKB|G4MV21 629 MGG_07327 "Asparagine-rich pro 0.338 0.076 0.395 1.4e-09
POMBASE|SPAC17H9.04c 604 SPAC17H9.04c "RNA-binding prot 0.838 0.197 0.283 6.4e-09
ZFIN|ZDB-GENE-040426-2743 314 zranb2 "zinc finger, RAN-bindi 0.535 0.242 0.4 1.1e-08
UNIPROTKB|Q5ZLX5 334 ZRANB2 "Zinc finger Ran-bindin 0.535 0.227 0.4 1.3e-08
TAIR|locus:1006230021 AT2G26695 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 560 (202.2 bits), Expect = 3.4e-54, P = 3.4e-54
 Identities = 93/134 (69%), Positives = 109/134 (81%)

Query:    14 MSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCG 73
             MS  GGDW+C ACQH NFKKRE+CQ+CGYPK+GG DVSTYL NRTEV+AGDWYC A+NCG
Sbjct:     1 MSWTGGDWLCGACQHANFKKRESCQKCGYPKFGGVDVSTYLYNRTEVMAGDWYCGALNCG 60

Query:    74 AHNYASRPNCYRCGAAKTDYA----CANMMAYGTDGSV-PPGWKSGDWICNRMGCGVHNY 128
             +HNYASR +CYRCG  K +Y      A M+AYG DG+  PPGWK+GDW+C R+GCGVHNY
Sbjct:    61 SHNYASRTSCYRCGMIKVEYTEQYYGAQMVAYGNDGAACPPGWKTGDWVCPRVGCGVHNY 120

Query:   129 ASRMVCYKCKTPRE 142
             ASR  C+KCKT R+
Sbjct:   121 ASRAECFKCKTTRD 134




GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2179479 AT5G25490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093317 AT3G15680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000012537 AN8055 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2198095 AT1G48570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827841 AT2G17975 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MV21 MGG_07327 "Asparagine-rich protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC17H9.04c SPAC17H9.04c "RNA-binding protein" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2743 zranb2 "zinc finger, RAN-binding domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLX5 ZRANB2 "Zinc finger Ran-binding domain-containing protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VI.1028.1
hypothetical protein (133 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
smart0054725 smart00547, ZnF_RBZ, Zinc finger domain 0.004
>gnl|CDD|197784 smart00547, ZnF_RBZ, Zinc finger domain Back     alignment and domain information
 Score = 32.7 bits (75), Expect = 0.004
 Identities = 13/25 (52%), Positives = 13/25 (52%)

Query: 19 GDWMCAACQHQNFKKREACQRCGYP 43
          GDW C AC   NF  R  C  CG P
Sbjct: 1  GDWECPACTFLNFASRSKCFACGAP 25


Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP. Length = 25

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
KOG4198 280 consensus RNA-binding Ran Zn-finger protein and re 99.73
KOG4198280 consensus RNA-binding Ran Zn-finger protein and re 99.7
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 98.92
KOG1995 351 consensus Conserved Zn-finger protein [General fun 98.84
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 98.75
smart0054726 ZnF_RBZ Zinc finger domain. Zinc finger domain in 98.46
smart0054726 ZnF_RBZ Zinc finger domain. Zinc finger domain in 98.29
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.62
PF1277350 DZR: Double zinc ribbon 96.86
PRK14559 645 putative protein serine/threonine phosphatase; Pro 95.05
PF1277350 DZR: Double zinc ribbon 94.3
KOG4477228 consensus RING1 interactor RYBP and related Zn-fin 92.55
KOG4477 228 consensus RING1 interactor RYBP and related Zn-fin 91.11
PF1324826 zf-ribbon_3: zinc-ribbon domain 90.92
PF1324826 zf-ribbon_3: zinc-ribbon domain 90.91
PF1324023 zinc_ribbon_2: zinc-ribbon domain 89.97
PF1324023 zinc_ribbon_2: zinc-ribbon domain 88.84
PRK14559 645 putative protein serine/threonine phosphatase; Pro 86.45
KOG4345 774 consensus NF-kappa B regulator AP20/Cezanne [Signa 86.17
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.05
PRK14714 1337 DNA polymerase II large subunit; Provisional 82.45
PRK0413648 rpl40e 50S ribosomal protein L40e; Provisional 80.92
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only] Back     alignment and domain information
Probab=99.73  E-value=3.7e-18  Score=137.25  Aligned_cols=121  Identities=34%  Similarity=0.727  Sum_probs=93.6

Q ss_pred             CCC-CeeccccCccccccccccccCCCCCCCCCCCc------------ccccccccccCCCcccCCCCCCCeecCCCcCc
Q 032350           17 PGG-DWMCAACQHQNFKKREACQRCGYPKYGGPDVS------------TYLCNRTEVLAGDWYCTAMNCGAHNYASRPNC   83 (142)
Q Consensus        17 ~~g-dW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~------------~~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~C   83 (142)
                      +.| ||.|..|...||..+..|.+|..+++. ..+.            .+.+....+++|||.|+  .|+++||++|..|
T Consensus         5 r~g~~~~~~~~~~~~~~~~~~c~~c~~~~~~-i~~~~~~~~tid~~~~~~~~~~~~~~pgdw~c~--~c~~~n~arr~~c   81 (280)
T KOG4198|consen    5 RKGVDSLKRLCLHVNFDERDSCGRCSLSRAY-IQPDDDEARTIDVMRLLLTNSKDPPRPGDWNCP--LCGFHNSARRLLC   81 (280)
T ss_pred             cccCCcccchhhhhccccccccccccCCccc-ccccccccCccchhhhcccccCCCCCCcccccC--ccchhhHHHhhhc
Confidence            344 999999999999999999999999944 2111            11235678999999999  8999999999999


Q ss_pred             cccCCCCCCccccc-ccccC-----------C------CCCCC---------CCCCCCCeeecCCCCCceeccCCccccC
Q 032350           84 YRCGAAKTDYACAN-MMAYG-----------T------DGSVP---------PGWKSGDWICNRMGCGVHNYASRMVCYK  136 (142)
Q Consensus        84 ~~C~~~~~~~~~~~-~~g~g-----------~------~~~~~---------~~~~~gdW~C~~~~C~~~N~a~r~~C~~  136 (142)
                      .+|+.++++..+.+ ++..|           .      ...+.         ..+++|||+|+  .|+||||+++.+|++
T Consensus        82 ~~c~~s~~~~~~~~~~~~~g~~~~~~~~r~~~~~~~~~~~~g~~~~~n~~~~r~~~~GDW~Cp--~C~fhNfarn~~C~r  159 (280)
T KOG4198|consen   82 FRCGFSKVPLDSALTAPNSGSRSLQTGPRYFKGDWLCPRCPGLGFSRNNKPKRPWRSGDWECP--GCNFHNFARNSECFR  159 (280)
T ss_pred             ceecccCCCccccccCCCCcccccccccccccCCCCCCCCCCCcccccccccCCccccCcccC--CCCceeccccchhhh
Confidence            99999988766531 11111           0      00000         13789999999  899999999999999


Q ss_pred             CCCCCC
Q 032350          137 CKTPRE  142 (142)
Q Consensus       137 C~~~k~  142 (142)
                      |+++++
T Consensus       160 C~~~r~  165 (280)
T KOG4198|consen  160 CGAKRP  165 (280)
T ss_pred             cCCcCc
Confidence            999875



>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only] Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00547 ZnF_RBZ Zinc finger domain Back     alignment and domain information
>smart00547 ZnF_RBZ Zinc finger domain Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription] Back     alignment and domain information
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>KOG4345 consensus NF-kappa B regulator AP20/Cezanne [Signal transduction mechanisms] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 2e-05
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 2e-04
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 1e-04
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 2e-04
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 5e-04
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 6e-04
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 Back     alignment and structure
 Score = 39.9 bits (92), Expect = 2e-05
 Identities = 21/88 (23%), Positives = 28/88 (31%), Gaps = 12/88 (13%)

Query: 62  AGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACA--------NMMAYGTDGSVPPGWKS 113
            G W C    C   N A    C  C + K     A        ++ + G  G        
Sbjct: 6   VGSWECPV--CCVSNKAEDSRCVSCTSEKPGLVSASSSNSVPVSLPSGGCLGLDKFKKPE 63

Query: 114 GDWICNRMGCGVHNYASRMVCYKCKTPR 141
           G W C    C V N A    C  C++ +
Sbjct: 64  GSWDCE--VCLVQNKADSTKCIACESAK 89


>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 99.72
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 99.67
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 99.28
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 99.26
2k1p_A33 Zinc finger RAN-binding domain-containing protein 99.25
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 99.23
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 99.18
2k1p_A33 Zinc finger RAN-binding domain-containing protein 99.17
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 99.15
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 99.12
3gj3_B33 Nuclear pore complex protein NUP153; G protein, GD 98.62
3gj5_B34 Nuclear pore complex protein NUP153; G protein, GD 98.57
2ebr_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 98.42
3gj3_B33 Nuclear pore complex protein NUP153; G protein, GD 98.41
3gj5_B34 Nuclear pore complex protein NUP153; G protein, GD 98.33
2ebq_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 98.3
2ebq_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 98.21
2ebr_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 98.19
2ebv_A57 Nuclear pore complex protein NUP153; ZF-ranbp doma 98.09
2d9g_A53 YY1-associated factor 2; ZF-ranbp domain, structur 98.02
2d9g_A53 YY1-associated factor 2; ZF-ranbp domain, structur 97.94
2ebv_A57 Nuclear pore complex protein NUP153; ZF-ranbp doma 97.7
3a9j_C34 Mitogen-activated protein kinase kinase kinase 7- 97.67
1nj3_A31 NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, 97.65
3a9j_C34 Mitogen-activated protein kinase kinase kinase 7- 97.53
1nj3_A31 NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, 97.3
2crc_A52 Ubiquitin conjugating enzyme 7 interacting protein 96.91
2crc_A52 Ubiquitin conjugating enzyme 7 interacting protein 96.76
3b08_B64 Ranbp-type and C3HC4-type zinc finger-containing; 96.6
3b08_B64 Ranbp-type and C3HC4-type zinc finger-containing; 96.5
2c6a_A46 Ubiquitin-protein ligase E3 MDM2; zinc finger, hum 95.81
1w7p_D 566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 94.72
2c6a_A46 Ubiquitin-protein ligase E3 MDM2; zinc finger, hum 94.4
1w7p_D 566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 93.81
2cr8_A53 MDM4 protein; ZF-ranbp domain, P53-binding protein 89.84
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 86.47
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 84.3
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 83.87
2cr8_A53 MDM4 protein; ZF-ranbp domain, P53-binding protein 82.51
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 81.49
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Back     alignment and structure
Probab=99.72  E-value=1e-18  Score=119.11  Aligned_cols=75  Identities=27%  Similarity=0.523  Sum_probs=26.6

Q ss_pred             CCCCCeeccccCccccccccccccCCCCCCCCCCCcc-------------cccccccccCCCcccCCCCCCCeecCCCcC
Q 032350           16 LPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVST-------------YLCNRTEVLAGDWYCTAMNCGAHNYASRPN   82 (142)
Q Consensus        16 ~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~-------------~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~   82 (142)
                      .++|||+|+.|+++||+++++|++|++|||.+.....             .++..+..++|+|.|+  .|+++|++++..
T Consensus         4 ~~~g~W~C~~C~~~N~~~~~~C~~C~~pkp~~~~~~~~~~~~~~~~~~~~~g~~~f~~~~g~W~C~--~C~~~N~a~~~~   81 (92)
T 3gj8_B            4 GSVGSWECPVCCVSNKAEDSRCVSCTSEKPGLVSASSSNSVPVSLPSGGCLGLDKFKKPEGSWDCE--VCLVQNKADSTK   81 (92)
T ss_dssp             ------------------------------------------------------------CCEECT--TTCCEECSSCSB
T ss_pred             CCCcCCCCCcCCCEeccccceecccCCCCCCCCCccccccCcccccccccccccccCCCCCcccCC--cCCcCChhhccc
Confidence            3689999999999999999999999999986431100             0012355688999999  999999999999


Q ss_pred             ccccCCCCCC
Q 032350           83 CYRCGAAKTD   92 (142)
Q Consensus        83 C~~C~~~~~~   92 (142)
                      |+.|+++||.
T Consensus        82 C~~C~~pkp~   91 (92)
T 3gj8_B           82 CIACESAKPG   91 (92)
T ss_dssp             CTTTCCBCC-
T ss_pred             ccccCCCCCC
Confidence            9999999984



>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Back     alignment and structure
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Back     alignment and structure
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Back     alignment and structure
>3gj3_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 PDB: 2gqe_A Back     alignment and structure
>3gj5_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 Back     alignment and structure
>2ebr_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gj3_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 PDB: 2gqe_A Back     alignment and structure
>3gj5_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 Back     alignment and structure
>2ebq_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebq_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebr_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebv_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9g_A YY1-associated factor 2; ZF-ranbp domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9g_A YY1-associated factor 2; ZF-ranbp domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebv_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a9j_C Mitogen-activated protein kinase kinase kinase 7- interacting protein 2; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 2wwz_C 2wx0_C 2wx1_C 3a9k_C Back     alignment and structure
>1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A Back     alignment and structure
>3a9j_C Mitogen-activated protein kinase kinase kinase 7- interacting protein 2; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 2wwz_C 2wx0_C 2wx1_C 3a9k_C Back     alignment and structure
>1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A Back     alignment and structure
>2crc_A Ubiquitin conjugating enzyme 7 interacting protein 3; ZF-ranbp domain, hepatitis B virus X-associated protein 4, HBV associated factor 4; NMR {Homo sapiens} Back     alignment and structure
>2crc_A Ubiquitin conjugating enzyme 7 interacting protein 3; ZF-ranbp domain, hepatitis B virus X-associated protein 4, HBV associated factor 4; NMR {Homo sapiens} Back     alignment and structure
>3b08_B Ranbp-type and C3HC4-type zinc finger-containing; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Mus musculus} PDB: 3b0a_B* Back     alignment and structure
>3b08_B Ranbp-type and C3HC4-type zinc finger-containing; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Mus musculus} PDB: 3b0a_B* Back     alignment and structure
>2c6a_A Ubiquitin-protein ligase E3 MDM2; zinc finger, human MDM2, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene; NMR {Homo sapiens} SCOP: g.41.11.1 PDB: 2c6b_A Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
>2c6a_A Ubiquitin-protein ligase E3 MDM2; zinc finger, human MDM2, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene; NMR {Homo sapiens} SCOP: g.41.11.1 PDB: 2c6b_A Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
>2cr8_A MDM4 protein; ZF-ranbp domain, P53-binding protein MDM4, MDM2-like P53-binding DE protein, MDMX protein, double minute 4 protein; NMR {Homo sapiens} SCOP: g.41.11.1 Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>2cr8_A MDM4 protein; ZF-ranbp domain, P53-binding protein MDM4, MDM2-like P53-binding DE protein, MDMX protein, double minute 4 protein; NMR {Homo sapiens} SCOP: g.41.11.1 Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1n0za_45 g.41.11.1 (A:) Znf265, first zinc-finger domain {H 5e-08
d1n0za_45 g.41.11.1 (A:) Znf265, first zinc-finger domain {H 3e-07
d1n0za_45 g.41.11.1 (A:) Znf265, first zinc-finger domain {H 3e-04
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Ran binding protein zinc finger-like
family: Ran binding protein zinc finger-like
domain: Znf265, first zinc-finger domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.4 bits (105), Expect = 5e-08
 Identities = 12/32 (37%), Positives = 15/32 (46%)

Query: 111 WKSGDWICNRMGCGVHNYASRMVCYKCKTPRE 142
              GDWIC    CG  N+A R  C +C   + 
Sbjct: 10  VSDGDWICPDKKCGNVNFARRTSCDRCGREKT 41


>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1n0za_45 Znf265, first zinc-finger domain {Human (Homo sapi 99.31
d1n0za_45 Znf265, first zinc-finger domain {Human (Homo sapi 99.25
d2gqea129 Nuclear pore complex protein nup153 {Human (Homo s 98.3
d2gqea129 Nuclear pore complex protein nup153 {Human (Homo s 98.08
d1q5wa_31 Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.21
d1q5wa_31 Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.81
d1dx8a_70 Rubredoxin {Guillardia theta [TaxId: 55529]} 91.5
d2c6aa146 MDM2 {Human (Homo sapiens) [TaxId: 9606]} 89.75
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 88.25
d2cr8a141 MDM4 {Human (Homo sapiens) [TaxId: 9606]} 87.13
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 82.8
d2c6aa146 MDM2 {Human (Homo sapiens) [TaxId: 9606]} 81.83
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 81.66
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Ran binding protein zinc finger-like
family: Ran binding protein zinc finger-like
domain: Znf265, first zinc-finger domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.31  E-value=5.6e-13  Score=77.66  Aligned_cols=39  Identities=41%  Similarity=1.055  Sum_probs=34.6

Q ss_pred             cCCCCCCCCCCeecc--ccCccccccccccccCCCCCCCCC
Q 032350           10 QDKKMSLPGGDWMCA--ACQHQNFKKREACQRCGYPKYGGP   48 (142)
Q Consensus        10 ~~~~~~~~~gdW~C~--~C~~~Nf~~r~~C~~C~~prp~~~   48 (142)
                      ..+.+..++|||+|+  .|+++||++|+.|++|++||+.++
T Consensus         4 s~~n~~~~~GDW~C~~~~C~~~NFa~R~~C~rC~~~r~~gp   44 (45)
T d1n0za_           4 STKNFRVSDGDWICPDKKCGNVNFARRTSCDRCGREKTTGP   44 (45)
T ss_dssp             CCSSCSSCSSSCBCSSTTTCCBCCSSCSBCSSSCCBCCCCC
T ss_pred             CcCCCCCCCCCccCCCCCCCCeeccccCcccCCCCcCCCCc
Confidence            456677889999997  799999999999999999998763



>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqea1 g.41.11.1 (A:3-31) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqea1 g.41.11.1 (A:3-31) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5wa_ g.41.11.1 (A:) Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q5wa_ g.41.11.1 (A:) Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Back     information, alignment and structure
>d2c6aa1 g.41.11.1 (A:290-335) MDM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cr8a1 g.41.11.1 (A:8-48) MDM4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2c6aa1 g.41.11.1 (A:290-335) MDM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure