Citrus Sinensis ID: 032350
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 224091300 | 133 | predicted protein [Populus trichocarpa] | 0.880 | 0.939 | 0.755 | 7e-51 | |
| 2760836 | 676 | putative second messenger-dependent prot | 0.908 | 0.190 | 0.694 | 2e-50 | |
| 357477963 | 144 | Zinc finger protein-like Ser/Thr protein | 0.929 | 0.916 | 0.717 | 2e-49 | |
| 224122470 | 144 | predicted protein [Populus trichocarpa] | 0.887 | 0.875 | 0.723 | 1e-48 | |
| 449464598 | 140 | PREDICTED: zinc finger Ran-binding domai | 0.908 | 0.921 | 0.718 | 2e-48 | |
| 79602205 | 138 | Ran BP2/NZF zinc finger-like protein [Ar | 0.908 | 0.934 | 0.694 | 4e-48 | |
| 297822233 | 138 | binding protein [Arabidopsis lyrata subs | 0.908 | 0.934 | 0.694 | 5e-48 | |
| 449526000 | 140 | PREDICTED: LOW QUALITY PROTEIN: zinc fin | 0.908 | 0.921 | 0.711 | 7e-48 | |
| 388521825 | 140 | unknown [Lotus japonicus] | 0.908 | 0.921 | 0.696 | 3e-47 | |
| 356516951 | 140 | PREDICTED: zinc finger Ran-binding domai | 0.908 | 0.921 | 0.681 | 2e-46 |
| >gi|224091300|ref|XP_002309220.1| predicted protein [Populus trichocarpa] gi|222855196|gb|EEE92743.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 204 bits (520), Expect = 7e-51, Method: Compositional matrix adjust.
Identities = 96/127 (75%), Positives = 109/127 (85%), Gaps = 2/127 (1%)
Query: 18 GGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNY 77
GGDWMC+ACQHQNFKKRE CQRCGYPKYGGPD +TY+CN T+VLAGDWYC+AMNC AHNY
Sbjct: 6 GGDWMCSACQHQNFKKREMCQRCGYPKYGGPDPATYICNATKVLAGDWYCSAMNCQAHNY 65
Query: 78 ASRPNCYRCGAAKTDYACANM--MAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCY 135
ASR +CY CGA + D+A AYG+DGS PPGWK+GDWIC R+GCGVHNYASRM C+
Sbjct: 66 ASRSSCYNCGALRDDHAAGGYGSNAYGSDGSDPPGWKTGDWICTRLGCGVHNYASRMECF 125
Query: 136 KCKTPRE 142
KC+TPRE
Sbjct: 126 KCRTPRE 132
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|2760836|gb|AAB95304.1| putative second messenger-dependent protein kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357477963|ref|XP_003609267.1| Zinc finger protein-like Ser/Thr protein kinase-like protein [Medicago truncatula] gi|355510322|gb|AES91464.1| Zinc finger protein-like Ser/Thr protein kinase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224122470|ref|XP_002330489.1| predicted protein [Populus trichocarpa] gi|222872423|gb|EEF09554.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449464598|ref|XP_004150016.1| PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|79602205|ref|NP_973537.2| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] gi|48310248|gb|AAT41783.1| At2g26695 [Arabidopsis thaliana] gi|50198944|gb|AAT70475.1| At2g26695 [Arabidopsis thaliana] gi|330252782|gb|AEC07876.1| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297822233|ref|XP_002878999.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297324838|gb|EFH55258.1| binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449526000|ref|XP_004170003.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger Ran-binding domain-containing protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388521825|gb|AFK48974.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356516951|ref|XP_003527154.1| PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| TAIR|locus:1006230021 | 138 | AT2G26695 [Arabidopsis thalian | 0.908 | 0.934 | 0.694 | 3.4e-54 | |
| TAIR|locus:2179479 | 170 | AT5G25490 [Arabidopsis thalian | 0.605 | 0.505 | 0.41 | 4.8e-31 | |
| TAIR|locus:2093317 | 164 | AT3G15680 [Arabidopsis thalian | 0.704 | 0.609 | 0.423 | 1.3e-20 | |
| ASPGD|ASPL0000012537 | 609 | AN8055 [Emericella nidulans (t | 0.274 | 0.064 | 0.45 | 6.1e-13 | |
| TAIR|locus:2198095 | 455 | AT1G48570 [Arabidopsis thalian | 0.436 | 0.136 | 0.397 | 9.3e-12 | |
| TAIR|locus:2827841 | 268 | AT2G17975 [Arabidopsis thalian | 0.704 | 0.373 | 0.310 | 4.7e-11 | |
| UNIPROTKB|G4MV21 | 629 | MGG_07327 "Asparagine-rich pro | 0.338 | 0.076 | 0.395 | 1.4e-09 | |
| POMBASE|SPAC17H9.04c | 604 | SPAC17H9.04c "RNA-binding prot | 0.838 | 0.197 | 0.283 | 6.4e-09 | |
| ZFIN|ZDB-GENE-040426-2743 | 314 | zranb2 "zinc finger, RAN-bindi | 0.535 | 0.242 | 0.4 | 1.1e-08 | |
| UNIPROTKB|Q5ZLX5 | 334 | ZRANB2 "Zinc finger Ran-bindin | 0.535 | 0.227 | 0.4 | 1.3e-08 |
| TAIR|locus:1006230021 AT2G26695 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 560 (202.2 bits), Expect = 3.4e-54, P = 3.4e-54
Identities = 93/134 (69%), Positives = 109/134 (81%)
Query: 14 MSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCG 73
MS GGDW+C ACQH NFKKRE+CQ+CGYPK+GG DVSTYL NRTEV+AGDWYC A+NCG
Sbjct: 1 MSWTGGDWLCGACQHANFKKRESCQKCGYPKFGGVDVSTYLYNRTEVMAGDWYCGALNCG 60
Query: 74 AHNYASRPNCYRCGAAKTDYA----CANMMAYGTDGSV-PPGWKSGDWICNRMGCGVHNY 128
+HNYASR +CYRCG K +Y A M+AYG DG+ PPGWK+GDW+C R+GCGVHNY
Sbjct: 61 SHNYASRTSCYRCGMIKVEYTEQYYGAQMVAYGNDGAACPPGWKTGDWVCPRVGCGVHNY 120
Query: 129 ASRMVCYKCKTPRE 142
ASR C+KCKT R+
Sbjct: 121 ASRAECFKCKTTRD 134
|
|
| TAIR|locus:2179479 AT5G25490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093317 AT3G15680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000012537 AN8055 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198095 AT1G48570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827841 AT2G17975 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MV21 MGG_07327 "Asparagine-rich protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC17H9.04c SPAC17H9.04c "RNA-binding protein" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2743 zranb2 "zinc finger, RAN-binding domain containing 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZLX5 ZRANB2 "Zinc finger Ran-binding domain-containing protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.VI.1028.1 | hypothetical protein (133 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| smart00547 | 25 | smart00547, ZnF_RBZ, Zinc finger domain | 0.004 |
| >gnl|CDD|197784 smart00547, ZnF_RBZ, Zinc finger domain | Back alignment and domain information |
|---|
Score = 32.7 bits (75), Expect = 0.004
Identities = 13/25 (52%), Positives = 13/25 (52%)
Query: 19 GDWMCAACQHQNFKKREACQRCGYP 43
GDW C AC NF R C CG P
Sbjct: 1 GDWECPACTFLNFASRSKCFACGAP 25
|
Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP. Length = 25 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| KOG4198 | 280 | consensus RNA-binding Ran Zn-finger protein and re | 99.73 | |
| KOG4198 | 280 | consensus RNA-binding Ran Zn-finger protein and re | 99.7 | |
| PF00641 | 30 | zf-RanBP: Zn-finger in Ran binding protein and oth | 98.92 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 98.84 | |
| PF00641 | 30 | zf-RanBP: Zn-finger in Ran binding protein and oth | 98.75 | |
| smart00547 | 26 | ZnF_RBZ Zinc finger domain. Zinc finger domain in | 98.46 | |
| smart00547 | 26 | ZnF_RBZ Zinc finger domain. Zinc finger domain in | 98.29 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 97.62 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 96.86 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 95.05 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 94.3 | |
| KOG4477 | 228 | consensus RING1 interactor RYBP and related Zn-fin | 92.55 | |
| KOG4477 | 228 | consensus RING1 interactor RYBP and related Zn-fin | 91.11 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 90.92 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 90.91 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 89.97 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 88.84 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 86.45 | |
| KOG4345 | 774 | consensus NF-kappa B regulator AP20/Cezanne [Signa | 86.17 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 84.05 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 82.45 | |
| PRK04136 | 48 | rpl40e 50S ribosomal protein L40e; Provisional | 80.92 |
| >KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.73 E-value=3.7e-18 Score=137.25 Aligned_cols=121 Identities=34% Similarity=0.727 Sum_probs=93.6
Q ss_pred CCC-CeeccccCccccccccccccCCCCCCCCCCCc------------ccccccccccCCCcccCCCCCCCeecCCCcCc
Q 032350 17 PGG-DWMCAACQHQNFKKREACQRCGYPKYGGPDVS------------TYLCNRTEVLAGDWYCTAMNCGAHNYASRPNC 83 (142)
Q Consensus 17 ~~g-dW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~------------~~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~C 83 (142)
+.| ||.|..|...||..+..|.+|..+++. ..+. .+.+....+++|||.|+ .|+++||++|..|
T Consensus 5 r~g~~~~~~~~~~~~~~~~~~c~~c~~~~~~-i~~~~~~~~tid~~~~~~~~~~~~~~pgdw~c~--~c~~~n~arr~~c 81 (280)
T KOG4198|consen 5 RKGVDSLKRLCLHVNFDERDSCGRCSLSRAY-IQPDDDEARTIDVMRLLLTNSKDPPRPGDWNCP--LCGFHNSARRLLC 81 (280)
T ss_pred cccCCcccchhhhhccccccccccccCCccc-ccccccccCccchhhhcccccCCCCCCcccccC--ccchhhHHHhhhc
Confidence 344 999999999999999999999999944 2111 11235678999999999 8999999999999
Q ss_pred cccCCCCCCccccc-ccccC-----------C------CCCCC---------CCCCCCCeeecCCCCCceeccCCccccC
Q 032350 84 YRCGAAKTDYACAN-MMAYG-----------T------DGSVP---------PGWKSGDWICNRMGCGVHNYASRMVCYK 136 (142)
Q Consensus 84 ~~C~~~~~~~~~~~-~~g~g-----------~------~~~~~---------~~~~~gdW~C~~~~C~~~N~a~r~~C~~ 136 (142)
.+|+.++++..+.+ ++..| . ...+. ..+++|||+|+ .|+||||+++.+|++
T Consensus 82 ~~c~~s~~~~~~~~~~~~~g~~~~~~~~r~~~~~~~~~~~~g~~~~~n~~~~r~~~~GDW~Cp--~C~fhNfarn~~C~r 159 (280)
T KOG4198|consen 82 FRCGFSKVPLDSALTAPNSGSRSLQTGPRYFKGDWLCPRCPGLGFSRNNKPKRPWRSGDWECP--GCNFHNFARNSECFR 159 (280)
T ss_pred ceecccCCCccccccCCCCcccccccccccccCCCCCCCCCCCcccccccccCCccccCcccC--CCCceeccccchhhh
Confidence 99999988766531 11111 0 00000 13789999999 899999999999999
Q ss_pred CCCCCC
Q 032350 137 CKTPRE 142 (142)
Q Consensus 137 C~~~k~ 142 (142)
|+++++
T Consensus 160 C~~~r~ 165 (280)
T KOG4198|consen 160 CGAKRP 165 (280)
T ss_pred cCCcCc
Confidence 999875
|
|
| >KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00547 ZnF_RBZ Zinc finger domain | Back alignment and domain information |
|---|
| >smart00547 ZnF_RBZ Zinc finger domain | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG4345 consensus NF-kappa B regulator AP20/Cezanne [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04136 rpl40e 50S ribosomal protein L40e; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 3gj8_B | 92 | Nuclear pore complex protein NUP153; G protein, GD | 2e-05 | |
| 3gj8_B | 92 | Nuclear pore complex protein NUP153; G protein, GD | 2e-04 | |
| 1n0z_A | 45 | ZNF265; zinc finger, RNA splicing, transcription; | 1e-04 | |
| 1n0z_A | 45 | ZNF265; zinc finger, RNA splicing, transcription; | 2e-04 | |
| 1n0z_A | 45 | ZNF265; zinc finger, RNA splicing, transcription; | 5e-04 | |
| 3gj7_B | 98 | Nuclear pore complex protein NUP153; G protein, GD | 6e-04 |
| >3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 | Back alignment and structure |
|---|
Score = 39.9 bits (92), Expect = 2e-05
Identities = 21/88 (23%), Positives = 28/88 (31%), Gaps = 12/88 (13%)
Query: 62 AGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACA--------NMMAYGTDGSVPPGWKS 113
G W C C N A C C + K A ++ + G G
Sbjct: 6 VGSWECPV--CCVSNKAEDSRCVSCTSEKPGLVSASSSNSVPVSLPSGGCLGLDKFKKPE 63
Query: 114 GDWICNRMGCGVHNYASRMVCYKCKTPR 141
G W C C V N A C C++ +
Sbjct: 64 GSWDCE--VCLVQNKADSTKCIACESAK 89
|
| >3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 | Back alignment and structure |
|---|
| >1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 | Back alignment and structure |
|---|
| >1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 | Back alignment and structure |
|---|
| >1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 | Back alignment and structure |
|---|
| >3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Length = 98 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 3gj8_B | 92 | Nuclear pore complex protein NUP153; G protein, GD | 99.72 | |
| 3gj8_B | 92 | Nuclear pore complex protein NUP153; G protein, GD | 99.67 | |
| 3gj7_B | 98 | Nuclear pore complex protein NUP153; G protein, GD | 99.28 | |
| 1n0z_A | 45 | ZNF265; zinc finger, RNA splicing, transcription; | 99.26 | |
| 2k1p_A | 33 | Zinc finger RAN-binding domain-containing protein | 99.25 | |
| 2lk0_A | 32 | RNA-binding protein 5; zinc finger; NMR {Homo sapi | 99.23 | |
| 3gj7_B | 98 | Nuclear pore complex protein NUP153; G protein, GD | 99.18 | |
| 2k1p_A | 33 | Zinc finger RAN-binding domain-containing protein | 99.17 | |
| 2lk0_A | 32 | RNA-binding protein 5; zinc finger; NMR {Homo sapi | 99.15 | |
| 1n0z_A | 45 | ZNF265; zinc finger, RNA splicing, transcription; | 99.12 | |
| 3gj3_B | 33 | Nuclear pore complex protein NUP153; G protein, GD | 98.62 | |
| 3gj5_B | 34 | Nuclear pore complex protein NUP153; G protein, GD | 98.57 | |
| 2ebr_A | 47 | Nuclear pore complex protein NUP153; ZF-ranbp doma | 98.42 | |
| 3gj3_B | 33 | Nuclear pore complex protein NUP153; G protein, GD | 98.41 | |
| 3gj5_B | 34 | Nuclear pore complex protein NUP153; G protein, GD | 98.33 | |
| 2ebq_A | 47 | Nuclear pore complex protein NUP153; ZF-ranbp doma | 98.3 | |
| 2ebq_A | 47 | Nuclear pore complex protein NUP153; ZF-ranbp doma | 98.21 | |
| 2ebr_A | 47 | Nuclear pore complex protein NUP153; ZF-ranbp doma | 98.19 | |
| 2ebv_A | 57 | Nuclear pore complex protein NUP153; ZF-ranbp doma | 98.09 | |
| 2d9g_A | 53 | YY1-associated factor 2; ZF-ranbp domain, structur | 98.02 | |
| 2d9g_A | 53 | YY1-associated factor 2; ZF-ranbp domain, structur | 97.94 | |
| 2ebv_A | 57 | Nuclear pore complex protein NUP153; ZF-ranbp doma | 97.7 | |
| 3a9j_C | 34 | Mitogen-activated protein kinase kinase kinase 7- | 97.67 | |
| 1nj3_A | 31 | NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, | 97.65 | |
| 3a9j_C | 34 | Mitogen-activated protein kinase kinase kinase 7- | 97.53 | |
| 1nj3_A | 31 | NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, | 97.3 | |
| 2crc_A | 52 | Ubiquitin conjugating enzyme 7 interacting protein | 96.91 | |
| 2crc_A | 52 | Ubiquitin conjugating enzyme 7 interacting protein | 96.76 | |
| 3b08_B | 64 | Ranbp-type and C3HC4-type zinc finger-containing; | 96.6 | |
| 3b08_B | 64 | Ranbp-type and C3HC4-type zinc finger-containing; | 96.5 | |
| 2c6a_A | 46 | Ubiquitin-protein ligase E3 MDM2; zinc finger, hum | 95.81 | |
| 1w7p_D | 566 | VPS36P, YLR417W; ESCRT-II complex, endosomal prote | 94.72 | |
| 2c6a_A | 46 | Ubiquitin-protein ligase E3 MDM2; zinc finger, hum | 94.4 | |
| 1w7p_D | 566 | VPS36P, YLR417W; ESCRT-II complex, endosomal prote | 93.81 | |
| 2cr8_A | 53 | MDM4 protein; ZF-ranbp domain, P53-binding protein | 89.84 | |
| 1dx8_A | 70 | Rubredoxin; electron transport, zinc-substitution; | 86.47 | |
| 2kn9_A | 81 | Rubredoxin; metalloprotein, ssgcid, structural gen | 84.3 | |
| 1e8j_A | 52 | Rubredoxin; iron-sulfur-protein, zinc-substitution | 83.87 | |
| 2cr8_A | 53 | MDM4 protein; ZF-ranbp domain, P53-binding protein | 82.51 | |
| 1yk4_A | 52 | Rubredoxin, RD; electron transport; 0.69A {Pyrococ | 81.49 |
| >3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* | Back alignment and structure |
|---|
Probab=99.72 E-value=1e-18 Score=119.11 Aligned_cols=75 Identities=27% Similarity=0.523 Sum_probs=26.6
Q ss_pred CCCCCeeccccCccccccccccccCCCCCCCCCCCcc-------------cccccccccCCCcccCCCCCCCeecCCCcC
Q 032350 16 LPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVST-------------YLCNRTEVLAGDWYCTAMNCGAHNYASRPN 82 (142)
Q Consensus 16 ~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~-------------~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~ 82 (142)
.++|||+|+.|+++||+++++|++|++|||.+..... .++..+..++|+|.|+ .|+++|++++..
T Consensus 4 ~~~g~W~C~~C~~~N~~~~~~C~~C~~pkp~~~~~~~~~~~~~~~~~~~~~g~~~f~~~~g~W~C~--~C~~~N~a~~~~ 81 (92)
T 3gj8_B 4 GSVGSWECPVCCVSNKAEDSRCVSCTSEKPGLVSASSSNSVPVSLPSGGCLGLDKFKKPEGSWDCE--VCLVQNKADSTK 81 (92)
T ss_dssp ------------------------------------------------------------CCEECT--TTCCEECSSCSB
T ss_pred CCCcCCCCCcCCCEeccccceecccCCCCCCCCCccccccCcccccccccccccccCCCCCcccCC--cCCcCChhhccc
Confidence 3689999999999999999999999999986431100 0012355688999999 999999999999
Q ss_pred ccccCCCCCC
Q 032350 83 CYRCGAAKTD 92 (142)
Q Consensus 83 C~~C~~~~~~ 92 (142)
|+.|+++||.
T Consensus 82 C~~C~~pkp~ 91 (92)
T 3gj8_B 82 CIACESAKPG 91 (92)
T ss_dssp CTTTCCBCC-
T ss_pred ccccCCCCCC
Confidence 9999999984
|
| >3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* | Back alignment and structure |
|---|
| >3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* | Back alignment and structure |
|---|
| >1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 | Back alignment and structure |
|---|
| >2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A | Back alignment and structure |
|---|
| >2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* | Back alignment and structure |
|---|
| >3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* | Back alignment and structure |
|---|
| >2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A | Back alignment and structure |
|---|
| >2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* | Back alignment and structure |
|---|
| >1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 | Back alignment and structure |
|---|
| >3gj3_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 PDB: 2gqe_A | Back alignment and structure |
|---|
| >3gj5_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 | Back alignment and structure |
|---|
| >2ebr_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gj3_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 PDB: 2gqe_A | Back alignment and structure |
|---|
| >3gj5_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 | Back alignment and structure |
|---|
| >2ebq_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebq_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebr_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebv_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9g_A YY1-associated factor 2; ZF-ranbp domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9g_A YY1-associated factor 2; ZF-ranbp domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebv_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a9j_C Mitogen-activated protein kinase kinase kinase 7- interacting protein 2; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 2wwz_C 2wx0_C 2wx1_C 3a9k_C | Back alignment and structure |
|---|
| >1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A | Back alignment and structure |
|---|
| >3a9j_C Mitogen-activated protein kinase kinase kinase 7- interacting protein 2; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 2wwz_C 2wx0_C 2wx1_C 3a9k_C | Back alignment and structure |
|---|
| >1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A | Back alignment and structure |
|---|
| >2crc_A Ubiquitin conjugating enzyme 7 interacting protein 3; ZF-ranbp domain, hepatitis B virus X-associated protein 4, HBV associated factor 4; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crc_A Ubiquitin conjugating enzyme 7 interacting protein 3; ZF-ranbp domain, hepatitis B virus X-associated protein 4, HBV associated factor 4; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b08_B Ranbp-type and C3HC4-type zinc finger-containing; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Mus musculus} PDB: 3b0a_B* | Back alignment and structure |
|---|
| >3b08_B Ranbp-type and C3HC4-type zinc finger-containing; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Mus musculus} PDB: 3b0a_B* | Back alignment and structure |
|---|
| >2c6a_A Ubiquitin-protein ligase E3 MDM2; zinc finger, human MDM2, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene; NMR {Homo sapiens} SCOP: g.41.11.1 PDB: 2c6b_A | Back alignment and structure |
|---|
| >1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 | Back alignment and structure |
|---|
| >2c6a_A Ubiquitin-protein ligase E3 MDM2; zinc finger, human MDM2, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene; NMR {Homo sapiens} SCOP: g.41.11.1 PDB: 2c6b_A | Back alignment and structure |
|---|
| >1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 | Back alignment and structure |
|---|
| >2cr8_A MDM4 protein; ZF-ranbp domain, P53-binding protein MDM4, MDM2-like P53-binding DE protein, MDMX protein, double minute 4 protein; NMR {Homo sapiens} SCOP: g.41.11.1 | Back alignment and structure |
|---|
| >1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A | Back alignment and structure |
|---|
| >2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A | Back alignment and structure |
|---|
| >2cr8_A MDM4 protein; ZF-ranbp domain, P53-binding protein MDM4, MDM2-like P53-binding DE protein, MDMX protein, double minute 4 protein; NMR {Homo sapiens} SCOP: g.41.11.1 | Back alignment and structure |
|---|
| >1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 142 | ||||
| d1n0za_ | 45 | g.41.11.1 (A:) Znf265, first zinc-finger domain {H | 5e-08 | |
| d1n0za_ | 45 | g.41.11.1 (A:) Znf265, first zinc-finger domain {H | 3e-07 | |
| d1n0za_ | 45 | g.41.11.1 (A:) Znf265, first zinc-finger domain {H | 3e-04 |
| >d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Ran binding protein zinc finger-like family: Ran binding protein zinc finger-like domain: Znf265, first zinc-finger domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.4 bits (105), Expect = 5e-08
Identities = 12/32 (37%), Positives = 15/32 (46%)
Query: 111 WKSGDWICNRMGCGVHNYASRMVCYKCKTPRE 142
GDWIC CG N+A R C +C +
Sbjct: 10 VSDGDWICPDKKCGNVNFARRTSCDRCGREKT 41
|
| >d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| d1n0za_ | 45 | Znf265, first zinc-finger domain {Human (Homo sapi | 99.31 | |
| d1n0za_ | 45 | Znf265, first zinc-finger domain {Human (Homo sapi | 99.25 | |
| d2gqea1 | 29 | Nuclear pore complex protein nup153 {Human (Homo s | 98.3 | |
| d2gqea1 | 29 | Nuclear pore complex protein nup153 {Human (Homo s | 98.08 | |
| d1q5wa_ | 31 | Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.21 | |
| d1q5wa_ | 31 | Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.81 | |
| d1dx8a_ | 70 | Rubredoxin {Guillardia theta [TaxId: 55529]} | 91.5 | |
| d2c6aa1 | 46 | MDM2 {Human (Homo sapiens) [TaxId: 9606]} | 89.75 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 88.25 | |
| d2cr8a1 | 41 | MDM4 {Human (Homo sapiens) [TaxId: 9606]} | 87.13 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 82.8 | |
| d2c6aa1 | 46 | MDM2 {Human (Homo sapiens) [TaxId: 9606]} | 81.83 | |
| d1s24a_ | 56 | Two-iron rubredoxin {Pseudomonas oleovorans [TaxId | 81.66 |
| >d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Ran binding protein zinc finger-like family: Ran binding protein zinc finger-like domain: Znf265, first zinc-finger domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.31 E-value=5.6e-13 Score=77.66 Aligned_cols=39 Identities=41% Similarity=1.055 Sum_probs=34.6
Q ss_pred cCCCCCCCCCCeecc--ccCccccccccccccCCCCCCCCC
Q 032350 10 QDKKMSLPGGDWMCA--ACQHQNFKKREACQRCGYPKYGGP 48 (142)
Q Consensus 10 ~~~~~~~~~gdW~C~--~C~~~Nf~~r~~C~~C~~prp~~~ 48 (142)
..+.+..++|||+|+ .|+++||++|+.|++|++||+.++
T Consensus 4 s~~n~~~~~GDW~C~~~~C~~~NFa~R~~C~rC~~~r~~gp 44 (45)
T d1n0za_ 4 STKNFRVSDGDWICPDKKCGNVNFARRTSCDRCGREKTTGP 44 (45)
T ss_dssp CCSSCSSCSSSCBCSSTTTCCBCCSSCSBCSSSCCBCCCCC
T ss_pred CcCCCCCCCCCccCCCCCCCCeeccccCcccCCCCcCCCCc
Confidence 456677889999997 799999999999999999998763
|
| >d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gqea1 g.41.11.1 (A:3-31) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gqea1 g.41.11.1 (A:3-31) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5wa_ g.41.11.1 (A:) Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q5wa_ g.41.11.1 (A:) Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} | Back information, alignment and structure |
|---|
| >d2c6aa1 g.41.11.1 (A:290-335) MDM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cr8a1 g.41.11.1 (A:8-48) MDM4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d2c6aa1 g.41.11.1 (A:290-335) MDM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} | Back information, alignment and structure |
|---|