Citrus Sinensis ID: 032438


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKVSPSSTCRLASKCI
ccccccccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccc
ccccccccHHcccHHHHHHHHHHHHHHccHcccEEEEEccccccHHHHHHHHHHHcccEEEEHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHcccEEEEcccccHHHHHHHHHHHHHcccccEc
masssaanledvpsVDLMTELLRRMKcaskpdkrlilvgppgsgkgtqspiikdeyclCHLATGDMLRAAVAAKtplgikakeamdkgelvsdDLVVGIIDEamkkpscqkgfildgfprtevqaqkvspsstcrlaskci
masssaanledvpsvDLMTELLRRMkcaskpdkrlilvgppgsgkgtqspiIKDEYCLCHLATGDMLRAAVAAKTPLGIkakeamdkgelvSDDLVVGIIDEAMKKPSCQKGFILDGFPRtevqaqkvspsstcrlaskci
MASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKVSPSSTCRLASKCI
**********************************LILV***********PIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFP**********************
*************SVDL*****************LILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKVSPSSTCRL*****
**********DVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTE*******************
*********EDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKVSPSSTCRLA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKVSPSSTCRLASKCI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q08480 243 Adenylate kinase B OS=Ory yes no 0.886 0.514 0.936 1e-64
Q08479 241 Adenylate kinase A OS=Ory no no 0.872 0.510 0.918 2e-61
Q9FK35 248 Adenylate kinase 2 OS=Ara yes no 0.907 0.516 0.815 3e-59
O82514 246 Adenylate kinase 1 OS=Ara no no 0.879 0.504 0.822 3e-58
B0D360 256 Adenylate kinase 1 OS=Lac N/A no 0.673 0.371 0.666 3e-32
B4KLY1 240 Adenylate kinase 2, mitoc N/A no 0.659 0.387 0.634 5e-32
Q1HQK0 241 Adenylate kinase 2, mitoc N/A no 0.659 0.385 0.634 5e-32
Q7QJX9 240 Adenylate kinase 2, mitoc yes no 0.659 0.387 0.623 9e-32
B0X5E3 241 Adenylate kinase 2, mitoc N/A no 0.659 0.385 0.623 9e-32
B4MQT3 240 Adenylate kinase 2, mitoc N/A no 0.659 0.387 0.612 1e-31
>sp|Q08480|KAD2_ORYSJ Adenylate kinase B OS=Oryza sativa subsp. japonica GN=ADK-B PE=2 SV=1 Back     alignment and function desciption
 Score =  244 bits (622), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/125 (93%), Positives = 123/125 (98%)

Query: 4   SSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLAT 63
           ++AANLEDVPS+DLM ELLRRMKC+SKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLAT
Sbjct: 2   AAAANLEDVPSMDLMNELLRRMKCSSKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLAT 61

Query: 64  GDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEV 123
           GDMLRAAVAAKTPLG+KAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT V
Sbjct: 62  GDMLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVV 121

Query: 124 QAQKV 128
           QAQK+
Sbjct: 122 QAQKL 126




This small ubiquitous enzyme is essential for maintenance and cell growth.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 3
>sp|Q08479|KAD1_ORYSJ Adenylate kinase A OS=Oryza sativa subsp. japonica GN=ADK-A PE=2 SV=1 Back     alignment and function description
>sp|Q9FK35|KAD2_ARATH Adenylate kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=2 SV=1 Back     alignment and function description
>sp|O82514|KAD1_ARATH Adenylate kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=2 SV=2 Back     alignment and function description
>sp|B0D360|KAD1_LACBS Adenylate kinase 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ADK1 PE=3 SV=1 Back     alignment and function description
>sp|B4KLY1|KAD2_DROMO Adenylate kinase 2, mitochondrial OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|Q1HQK0|KAD2_AEDAE Adenylate kinase 2, mitochondrial OS=Aedes aegypti GN=Adk2 PE=2 SV=1 Back     alignment and function description
>sp|Q7QJX9|KAD2_ANOGA Adenylate kinase 2, mitochondrial OS=Anopheles gambiae GN=Adk2 PE=3 SV=2 Back     alignment and function description
>sp|B0X5E3|KAD2_CULQU Adenylate kinase 2, mitochondrial OS=Culex quinquefasciatus GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|B4MQT3|KAD2_DROWI Adenylate kinase 2, mitochondrial OS=Drosophila willistoni GN=Adk2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
224121954 246 predicted protein [Populus trichocarpa] 0.907 0.520 0.945 9e-65
115485231 243 Os11g0312400 [Oryza sativa Japonica Grou 0.886 0.514 0.936 1e-62
225456268 245 PREDICTED: adenylate kinase B [Vitis vin 0.872 0.502 0.934 1e-62
255540299241 adenylate kinase 1, putative [Ricinus co 0.865 0.506 0.959 1e-62
449469623 247 PREDICTED: adenylate kinase B-like [Cucu 0.900 0.514 0.921 2e-62
297738377 301 unnamed protein product [Vitis vinifera] 0.907 0.425 0.906 7e-62
357477153 243 Adenylate kinase B [Medicago truncatula] 0.886 0.514 0.929 1e-61
388509510 243 unknown [Lotus japonicus] 0.865 0.502 0.942 1e-61
225425838 245 PREDICTED: adenylate kinase B-like [Viti 0.907 0.522 0.906 1e-61
449440574 247 PREDICTED: adenylate kinase B-like [Cucu 0.907 0.518 0.914 1e-61
>gi|224121954|ref|XP_002318714.1| predicted protein [Populus trichocarpa] gi|222859387|gb|EEE96934.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 121/128 (94%), Positives = 127/128 (99%)

Query: 1   MASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCH 60
           MASS+AANLEDVPSV+LMTELLRRMKC+SKPDKRLIL+GPPGSGKGTQSPIIKDEYCLCH
Sbjct: 1   MASSAAANLEDVPSVNLMTELLRRMKCSSKPDKRLILIGPPGSGKGTQSPIIKDEYCLCH 60

Query: 61  LATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPR 120
           LATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPR
Sbjct: 61  LATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPR 120

Query: 121 TEVQAQKV 128
           T VQA+K+
Sbjct: 121 TVVQAEKL 128




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|115485231|ref|NP_001067759.1| Os11g0312400 [Oryza sativa Japonica Group] gi|585338|sp|Q08480.1|KAD2_ORYSJ RecName: Full=Adenylate kinase B; Short=AK B; AltName: Full=ATP-AMP transphosphorylase B gi|391879|dbj|BAA01181.1| adenylate kinase-b [Oryza sativa] gi|62734015|gb|AAX96124.1| adenylate kinase b (ec 2.7.4.3) (atp-amp transphosphorylase) [Oryza sativa Japonica Group] gi|77550163|gb|ABA92960.1| Adenylate kinase B, putative, expressed [Oryza sativa Japonica Group] gi|113644981|dbj|BAF28122.1| Os11g0312400 [Oryza sativa Japonica Group] gi|125534192|gb|EAY80740.1| hypothetical protein OsI_35920 [Oryza sativa Indica Group] gi|125576978|gb|EAZ18200.1| hypothetical protein OsJ_33744 [Oryza sativa Japonica Group] gi|215707086|dbj|BAG93546.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225456268|ref|XP_002283508.1| PREDICTED: adenylate kinase B [Vitis vinifera] gi|297734386|emb|CBI15633.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540299|ref|XP_002511214.1| adenylate kinase 1, putative [Ricinus communis] gi|223550329|gb|EEF51816.1| adenylate kinase 1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449469623|ref|XP_004152518.1| PREDICTED: adenylate kinase B-like [Cucumis sativus] gi|449521377|ref|XP_004167706.1| PREDICTED: adenylate kinase B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297738377|emb|CBI27578.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357477153|ref|XP_003608862.1| Adenylate kinase B [Medicago truncatula] gi|217075582|gb|ACJ86151.1| unknown [Medicago truncatula] gi|355509917|gb|AES91059.1| Adenylate kinase B [Medicago truncatula] gi|388515225|gb|AFK45674.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388509510|gb|AFK42821.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225425838|ref|XP_002266762.1| PREDICTED: adenylate kinase B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440574|ref|XP_004138059.1| PREDICTED: adenylate kinase B-like [Cucumis sativus] gi|449517589|ref|XP_004165828.1| PREDICTED: adenylate kinase B-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
UNIPROTKB|Q08480 243 ADK-B "Adenylate kinase B" [Or 0.886 0.514 0.936 2.7e-59
UNIPROTKB|Q08479 241 ADK-A "Adenylate kinase A" [Or 0.872 0.510 0.918 5.9e-57
TAIR|locus:2177527 248 AT5G50370 [Arabidopsis thalian 0.907 0.516 0.815 9.9e-55
TAIR|locus:2167316 246 ADK1 "adenylate kinase 1" [Ara 0.907 0.520 0.806 8.9e-54
GENEDB_PFALCIPARUM|PF10_0086 242 PF10_0086 "adenylate kinase, p 0.865 0.504 0.524 2.3e-32
UNIPROTKB|Q8IJV6 242 PF10_0086 "Adenylate kinase" [ 0.865 0.504 0.524 2.3e-32
FB|FBgn0022708 240 Adk2 "Adenylate kinase-2" [Dro 0.659 0.387 0.612 1e-29
CGD|CAL0004216 249 ADK1 [Candida albicans (taxid: 0.858 0.485 0.511 5.6e-29
DICTYBASE|DDB_G0283805 276 adkA "adenylate kinase" [Dicty 0.673 0.344 0.589 9.1e-29
POMBASE|SPAC4G9.03 220 adk1 "adenylate kinase Adk1" [ 0.680 0.436 0.639 1.2e-28
UNIPROTKB|Q08480 ADK-B "Adenylate kinase B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 608 (219.1 bits), Expect = 2.7e-59, P = 2.7e-59
 Identities = 117/125 (93%), Positives = 123/125 (98%)

Query:     4 SSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLAT 63
             ++AANLEDVPS+DLM ELLRRMKC+SKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLAT
Sbjct:     2 AAAANLEDVPSMDLMNELLRRMKCSSKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLAT 61

Query:    64 GDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEV 123
             GDMLRAAVAAKTPLG+KAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT V
Sbjct:    62 GDMLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVV 121

Query:   124 QAQKV 128
             QAQK+
Sbjct:   122 QAQKL 126




GO:0004017 "adenylate kinase activity" evidence=IGI;ISS
GO:0005524 "ATP binding" evidence=IGI
GO:0006163 "purine nucleotide metabolic process" evidence=IEP
UNIPROTKB|Q08479 ADK-A "Adenylate kinase A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2177527 AT5G50370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167316 ADK1 "adenylate kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF10_0086 PF10_0086 "adenylate kinase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IJV6 PF10_0086 "Adenylate kinase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
FB|FBgn0022708 Adk2 "Adenylate kinase-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0004216 ADK1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283805 adkA "adenylate kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC4G9.03 adk1 "adenylate kinase Adk1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FK35KAD2_ARATH2, ., 7, ., 4, ., 30.81530.90780.5161yesno
Q08480KAD2_ORYSJ2, ., 7, ., 4, ., 30.9360.88650.5144yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.921
3rd Layer2.7.4.30.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
PLN02674 244 PLN02674, PLN02674, adenylate kinase 6e-89
PRK00279 215 PRK00279, adk, adenylate kinase; Reviewed 2e-51
pfam00406186 pfam00406, ADK, Adenylate kinase 2e-50
cd01428194 cd01428, ADK, Adenylate kinase (ADK) catalyzes the 2e-50
TIGR01351 210 TIGR01351, adk, adenylate kinase 2e-48
COG0563178 COG0563, Adk, Adenylate kinase and related kinases 1e-39
PRK02496184 PRK02496, adk, adenylate kinase; Provisional 1e-38
PRK14528186 PRK14528, PRK14528, adenylate kinase; Provisional 2e-33
PRK13808 333 PRK13808, PRK13808, adenylate kinase; Provisional 9e-32
PRK14531183 PRK14531, PRK14531, adenylate kinase; Provisional 9e-32
PRK14532188 PRK14532, PRK14532, adenylate kinase; Provisional 9e-29
PLN02842 505 PLN02842, PLN02842, nucleotide kinase 5e-26
PRK14529 223 PRK14529, PRK14529, adenylate kinase; Provisional 1e-25
PRK14527191 PRK14527, PRK14527, adenylate kinase; Provisional 3e-24
PRK14526 211 PRK14526, PRK14526, adenylate kinase; Provisional 2e-23
PTZ00088 229 PTZ00088, PTZ00088, adenylate kinase 1; Provisiona 2e-23
PRK14530 215 PRK14530, PRK14530, adenylate kinase; Provisional 3e-22
TIGR01360188 TIGR01360, aden_kin_iso1, adenylate kinase, isozym 8e-22
TIGR01359183 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family 5e-17
PLN02459 261 PLN02459, PLN02459, probable adenylate kinase 9e-17
PLN02200234 PLN02200, PLN02200, adenylate kinase family protei 4e-14
pfam13207114 pfam13207, AAA_17, AAA domain 8e-04
TIGR02173171 TIGR02173, cyt_kin_arch, cytidylate kinase, putati 0.002
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrol 0.003
>gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase Back     alignment and domain information
 Score =  258 bits (660), Expect = 6e-89
 Identities = 120/127 (94%), Positives = 126/127 (99%)

Query: 2   ASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHL 61
           +S++AANLEDVPSVDLMTELLRRMKC+SKPDKRLIL+GPPGSGKGTQSPIIKDEYCLCHL
Sbjct: 1   SSAAAANLEDVPSVDLMTELLRRMKCSSKPDKRLILIGPPGSGKGTQSPIIKDEYCLCHL 60

Query: 62  ATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT 121
           ATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT
Sbjct: 61  ATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT 120

Query: 122 EVQAQKV 128
            VQAQK+
Sbjct: 121 VVQAQKL 127


Length = 244

>gnl|CDD|234711 PRK00279, adk, adenylate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|201213 pfam00406, ADK, Adenylate kinase Back     alignment and domain information
>gnl|CDD|238713 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>gnl|CDD|233369 TIGR01351, adk, adenylate kinase Back     alignment and domain information
>gnl|CDD|223637 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178435 PLN02842, PLN02842, nucleotide kinase Back     alignment and domain information
>gnl|CDD|237746 PRK14529, PRK14529, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237745 PRK14527, PRK14527, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|240262 PTZ00088, PTZ00088, adenylate kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|237747 PRK14530, PRK14530, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family Back     alignment and domain information
>gnl|CDD|215253 PLN02459, PLN02459, probable adenylate kinase Back     alignment and domain information
>gnl|CDD|215125 PLN02200, PLN02200, adenylate kinase family protein Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|233761 TIGR02173, cyt_kin_arch, cytidylate kinase, putative Back     alignment and domain information
>gnl|CDD|236442 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
PLN02674 244 adenylate kinase 99.98
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 99.95
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 99.94
PLN02459 261 probable adenylate kinase 99.94
PRK14529 223 adenylate kinase; Provisional 99.93
PRK13808 333 adenylate kinase; Provisional 99.92
PTZ00088 229 adenylate kinase 1; Provisional 99.92
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 99.92
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 99.91
PRK14526 211 adenylate kinase; Provisional 99.91
PRK14532188 adenylate kinase; Provisional 99.91
PRK00279 215 adk adenylate kinase; Reviewed 99.91
PRK14528186 adenylate kinase; Provisional 99.9
PRK14531183 adenylate kinase; Provisional 99.9
PRK02496184 adk adenylate kinase; Provisional 99.9
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.9
PLN02200234 adenylate kinase family protein 99.88
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 99.88
PRK14527191 adenylate kinase; Provisional 99.88
PRK14530 215 adenylate kinase; Provisional 99.84
KOG3078 235 consensus Adenylate kinase [Nucleotide transport a 99.82
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.82
PLN02842 505 nucleotide kinase 99.81
PRK01184184 hypothetical protein; Provisional 99.42
PRK08356195 hypothetical protein; Provisional 99.4
PRK08118167 topology modulation protein; Reviewed 99.38
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 99.23
PRK03839180 putative kinase; Provisional 99.23
PRK06217183 hypothetical protein; Validated 99.23
PRK13949169 shikimate kinase; Provisional 99.19
PRK07261171 topology modulation protein; Provisional 99.07
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.06
PHA02530 300 pseT polynucleotide kinase; Provisional 99.06
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.0
PRK12339197 2-phosphoglycerate kinase; Provisional 98.99
PRK04182180 cytidylate kinase; Provisional 98.99
PRK04040188 adenylate kinase; Provisional 98.97
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.95
PRK13948182 shikimate kinase; Provisional 98.93
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.91
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 98.89
PRK13947171 shikimate kinase; Provisional 98.89
PRK00131175 aroK shikimate kinase; Reviewed 98.89
PRK00625173 shikimate kinase; Provisional 98.87
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 98.85
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.84
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.83
PRK00081194 coaE dephospho-CoA kinase; Reviewed 98.81
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 98.77
PRK08233182 hypothetical protein; Provisional 98.75
PRK14734200 coaE dephospho-CoA kinase; Provisional 98.72
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.72
PRK13946184 shikimate kinase; Provisional 98.69
PLN02199303 shikimate kinase 98.69
TIGR00152188 dephospho-CoA kinase. This model produces scores i 98.69
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.66
CHL00181287 cbbX CbbX; Provisional 98.66
PLN02422 232 dephospho-CoA kinase 98.65
PRK06547172 hypothetical protein; Provisional 98.62
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.61
PRK06762166 hypothetical protein; Provisional 98.6
PTZ00451 244 dephospho-CoA kinase; Provisional 98.58
PRK14733204 coaE dephospho-CoA kinase; Provisional 98.56
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.56
COG0283 222 Cmk Cytidylate kinase [Nucleotide transport and me 98.56
PRK03731171 aroL shikimate kinase II; Reviewed 98.56
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 98.53
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 98.53
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 98.53
PRK13973213 thymidylate kinase; Provisional 98.52
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.52
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.48
PRK05057172 aroK shikimate kinase I; Reviewed 98.48
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.48
TIGR00017 217 cmk cytidylate kinase. This family consists of cyt 98.46
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 98.44
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 98.44
PRK12338 319 hypothetical protein; Provisional 98.44
PRK14731208 coaE dephospho-CoA kinase; Provisional 98.43
PRK06696223 uridine kinase; Validated 98.43
PRK13975196 thymidylate kinase; Provisional 98.42
PRK00023 225 cmk cytidylate kinase; Provisional 98.41
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 98.4
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.39
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.39
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.38
PRK14732196 coaE dephospho-CoA kinase; Provisional 98.37
PRK13974212 thymidylate kinase; Provisional 98.37
PRK11860 661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.37
PF00004132 AAA: ATPase family associated with various cellula 98.34
PLN02165 334 adenylate isopentenyltransferase 98.34
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.33
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 98.33
PRK05541176 adenylylsulfate kinase; Provisional 98.28
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 98.24
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.23
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.19
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 98.18
PRK05480209 uridine/cytidine kinase; Provisional 98.18
PLN02924220 thymidylate kinase 98.18
PRK04220301 2-phosphoglycerate kinase; Provisional 98.16
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 98.16
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 98.15
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 98.14
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 98.14
PF01745 233 IPT: Isopentenyl transferase; InterPro: IPR002648 98.14
PRK07667193 uridine kinase; Provisional 98.14
PRK00889175 adenylylsulfate kinase; Provisional 98.11
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 98.09
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.09
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.09
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 98.08
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.08
PHA00729226 NTP-binding motif containing protein 98.08
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 98.07
smart00382148 AAA ATPases associated with a variety of cellular 98.07
PRK12377248 putative replication protein; Provisional 98.06
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 98.05
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.05
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 98.05
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.05
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 98.04
PRK06526254 transposase; Provisional 98.02
KOG3220 225 consensus Similar to bacterial dephospho-CoA kinas 98.02
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.02
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.02
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.02
PRK09825176 idnK D-gluconate kinase; Provisional 97.99
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 97.99
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 97.98
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.98
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.98
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.97
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.97
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.96
PRK04328 249 hypothetical protein; Provisional 97.95
PLN02840 421 tRNA dimethylallyltransferase 97.95
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 97.93
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.93
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.92
PRK06067234 flagellar accessory protein FlaH; Validated 97.92
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.92
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.92
PRK12337 475 2-phosphoglycerate kinase; Provisional 97.92
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.91
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 97.91
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.91
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.91
PLN02748 468 tRNA dimethylallyltransferase 97.9
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.9
PRK03846198 adenylylsulfate kinase; Provisional 97.9
PRK09183259 transposase/IS protein; Provisional 97.9
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.9
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.89
PRK15453 290 phosphoribulokinase; Provisional 97.89
PRK06921266 hypothetical protein; Provisional 97.89
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.89
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.89
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.89
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.88
PRK05439 311 pantothenate kinase; Provisional 97.88
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.88
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.87
PRK08181269 transposase; Validated 97.87
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.87
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 97.85
PRK00300205 gmk guanylate kinase; Provisional 97.85
CHL00195 489 ycf46 Ycf46; Provisional 97.85
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 97.84
COG0645170 Predicted kinase [General function prediction only 97.84
COG3638 258 ABC-type phosphate/phosphonate transport system, A 97.84
PRK03992 389 proteasome-activating nucleotidase; Provisional 97.84
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 97.83
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.83
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.83
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.81
COG1428 216 Deoxynucleoside kinases [Nucleotide transport and 97.81
PRK14737186 gmk guanylate kinase; Provisional 97.81
PHA02575 227 1 deoxynucleoside monophosphate kinase; Provisiona 97.81
COG2074 299 2-phosphoglycerate kinase [Carbohydrate transport 97.8
COG4619223 ABC-type uncharacterized transport system, ATPase 97.8
PTZ00301210 uridine kinase; Provisional 97.79
PRK00698205 tmk thymidylate kinase; Validated 97.78
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.77
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.77
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 97.77
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 97.77
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.77
PRK06761 282 hypothetical protein; Provisional 97.76
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.75
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 97.75
PRK09302 509 circadian clock protein KaiC; Reviewed 97.75
PF13173128 AAA_14: AAA domain 97.73
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.73
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.72
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.72
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.72
PRK08099399 bifunctional DNA-binding transcriptional repressor 97.72
PRK14738206 gmk guanylate kinase; Provisional 97.72
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.71
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.71
PRK09087226 hypothetical protein; Validated 97.7
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.7
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.69
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 97.69
cd02030 219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 97.69
PRK11545163 gntK gluconate kinase 1; Provisional 97.69
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.69
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 97.69
PRK07429 327 phosphoribulokinase; Provisional 97.69
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.68
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 97.66
PLN02348 395 phosphoribulokinase 97.66
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.65
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.65
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.64
KOG1533 290 consensus Predicted GTPase [General function predi 97.64
PHA02624 647 large T antigen; Provisional 97.63
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.63
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.63
PRK07952244 DNA replication protein DnaC; Validated 97.62
PRK04195 482 replication factor C large subunit; Provisional 97.61
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.6
PHA02544 316 44 clamp loader, small subunit; Provisional 97.6
PF05729166 NACHT: NACHT domain 97.6
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.59
PF1324576 AAA_19: Part of AAA domain 97.59
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.59
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.59
PRK12402 337 replication factor C small subunit 2; Reviewed 97.59
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.59
PRK06835329 DNA replication protein DnaC; Validated 97.58
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.58
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 97.58
PRK09435 332 membrane ATPase/protein kinase; Provisional 97.57
PLN02796 347 D-glycerate 3-kinase 97.57
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 97.57
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.57
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.57
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.56
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.56
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 97.56
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.56
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.55
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.55
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.55
cd01394218 radB RadB. The archaeal protein radB shares simila 97.54
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.54
PRK09302 509 circadian clock protein KaiC; Reviewed 97.53
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.53
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 97.52
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.52
PRK08116268 hypothetical protein; Validated 97.51
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 97.51
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.5
PRK10416318 signal recognition particle-docking protein FtsY; 97.5
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.5
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.5
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.5
PHA02244 383 ATPase-like protein 97.5
CHL00176 638 ftsH cell division protein; Validated 97.5
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.49
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 97.49
PRK05642234 DNA replication initiation factor; Validated 97.49
TIGR00064272 ftsY signal recognition particle-docking protein F 97.48
PRK06620214 hypothetical protein; Validated 97.47
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 97.47
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 97.47
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 97.47
PRK13342 413 recombination factor protein RarA; Reviewed 97.47
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.47
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.47
PRK08084235 DNA replication initiation factor; Provisional 97.46
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.46
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.45
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.44
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 97.44
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 97.44
PRK15455 644 PrkA family serine protein kinase; Provisional 97.43
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.43
PLN02318 656 phosphoribulokinase/uridine kinase 97.43
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.43
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.42
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.42
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.42
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.42
PRK08939306 primosomal protein DnaI; Reviewed 97.42
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.42
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.42
CHL00206 2281 ycf2 Ycf2; Provisional 97.41
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 97.41
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 97.41
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.41
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.4
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.4
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 97.4
PRK06893229 DNA replication initiation factor; Validated 97.39
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.39
PLN03025 319 replication factor C subunit; Provisional 97.38
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.38
cd03234226 ABCG_White The White subfamily represents ABC tran 97.37
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.37
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.37
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.37
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.37
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.37
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.36
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.36
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.35
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.35
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 97.35
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.35
cd03115173 SRP The signal recognition particle (SRP) mediates 97.35
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.34
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.34
PRK10646153 ADP-binding protein; Provisional 97.34
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.34
PLN03046 460 D-glycerate 3-kinase; Provisional 97.34
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.34
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 97.34
PF07726131 AAA_3: ATPase family associated with various cellu 97.34
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.33
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.33
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 97.33
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.33
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.33
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.33
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.32
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.32
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.32
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 97.32
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.32
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.32
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.32
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 97.32
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.32
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.32
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.32
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.32
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 97.31
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.31
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 97.31
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.31
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 97.31
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.3
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 97.3
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.3
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.3
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.3
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 97.3
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 97.3
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.3
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.29
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.29
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.29
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.29
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.29
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.29
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.29
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.29
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.28
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 97.28
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.28
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.28
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.28
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.28
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.27
PRK05973237 replicative DNA helicase; Provisional 97.27
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.27
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 97.27
KOG3877 393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 97.26
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.26
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.26
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 97.26
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.26
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.26
cd02029 277 PRK_like Phosphoribulokinase-like (PRK-like) is a 97.25
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.25
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.25
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.25
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.25
PRK13695174 putative NTPase; Provisional 97.25
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.24
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.24
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 97.24
COG4639168 Predicted kinase [General function prediction only 97.24
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 97.24
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.24
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 97.23
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.23
PRK14974336 cell division protein FtsY; Provisional 97.23
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.23
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 97.23
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.23
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.23
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.23
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 97.23
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 97.23
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.23
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.23
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.23
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 97.22
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.22
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.22
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.22
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.22
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.22
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.22
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.22
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 97.21
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 97.21
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 97.21
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.21
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 97.2
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.2
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 97.2
PRK14086 617 dnaA chromosomal replication initiation protein; P 97.2
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 97.2
PRK10908222 cell division protein FtsE; Provisional 97.2
PRK04301 317 radA DNA repair and recombination protein RadA; Va 97.2
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 97.2
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.2
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 97.2
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.2
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 97.2
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 97.2
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.2
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.19
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 97.19
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.19
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 97.19
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.18
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.18
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.18
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 97.18
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 97.18
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.18
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 97.18
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.18
cd03246173 ABCC_Protease_Secretion This family represents the 97.17
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.17
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 97.17
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 97.17
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 97.17
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.17
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.17
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.17
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.17
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.17
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 97.17
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 97.16
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.16
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.16
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 97.16
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.15
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.15
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.15
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.15
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 97.15
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 97.15
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.15
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.15
COG1855 604 ATPase (PilT family) [General function prediction 97.15
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.15
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.15
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.14
PRK13341 725 recombination factor protein RarA/unknown domain f 97.14
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 97.14
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.14
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 97.14
PRK10867 433 signal recognition particle protein; Provisional 97.14
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.14
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.14
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.14
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 97.13
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.13
COG0802149 Predicted ATPase or kinase [General function predi 97.13
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.13
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.13
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.13
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 97.13
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 97.13
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.13
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.13
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 97.12
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.12
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 97.12
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 97.12
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 97.12
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.12
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 97.12
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.11
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 97.11
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.11
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 97.11
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 97.11
COG4598 256 HisP ABC-type histidine transport system, ATPase c 97.1
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.1
COG3911183 Predicted ATPase [General function prediction only 97.1
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.1
>PLN02674 adenylate kinase Back     alignment and domain information
Probab=99.98  E-value=8.6e-32  Score=204.56  Aligned_cols=129  Identities=93%  Similarity=1.376  Sum_probs=122.1

Q ss_pred             chhhhhcCCCCchhHHHHHHHHhhhcCCCCeEEEEECCCCCChhhHHHHHHhhhCccccchHHHHHHHHHccCcchHHHH
Q 032438            3 SSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAK   82 (141)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~i~G~pgsGKstla~~La~~~~~~~is~~~ll~~~~~~~~~~g~~i~   82 (141)
                      ++||+.+.++|..|++.++..++....+++++|+|+|||||||+|+|+.|+++||+.|+|++++++++++.++++|..++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~G~PGsGKgT~a~~La~~~~~~his~GdllR~~i~~~s~~g~~i~   81 (244)
T PLN02674          2 SAAAANLEDVPSVDLMTELLRRMKCSSKPDKRLILIGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAK   81 (244)
T ss_pred             cccccccccCchHHHHHHHHHHHhhccccCceEEEECCCCCCHHHHHHHHHHHcCCcEEchhHHHHHHHhccChhhHHHH
Confidence            67888999999999999999998766677789999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCcchHHHHHHHHHHHhcCCCCCCeEEEeCCCCCHHHHHhcccc
Q 032438           83 EAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKVSPS  131 (141)
Q Consensus        83 ~~l~~g~~ip~~~~~~ll~~~l~~~~~~~g~IldG~P~~~~q~~~l~~~  131 (141)
                      +++..|.++|++++.+++.+++.+.++..|||||||||+..|++.|++.
T Consensus        82 ~~~~~G~lvpd~iv~~lv~~~l~~~~~~~g~ilDGfPRt~~Qa~~l~~~  130 (244)
T PLN02674         82 EAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVVQAQKLDEM  130 (244)
T ss_pred             HHHHcCCccCHHHHHHHHHHHHhCcCcCCcEEEeCCCCCHHHHHHHHHH
Confidence            9999999999999999999999998888999999999999999988764



>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3tlx_A 243 Crystal Structure Of Pf10_0086, Adenylate Kinase Fr 5e-36
3aky_A 220 Stability, Activity And Structure Of Adenylate Kina 3e-28
1aky_A 220 High-Resolution Structures Of Adenylate Kinase From 3e-28
2c9y_A 242 Structure Of Human Adenylate Kinase 2 Length = 242 3e-28
1ak2_A 233 Adenylate Kinase Isoenzyme-2 Length = 233 9e-28
1dvr_A 220 Structure Of A Mutant Adenylate Kinase Ligated With 4e-27
1zin_A 217 Adenylate Kinase With Bound Ap5a Length = 217 4e-25
2qaj_A 217 Crystal Structure Of A Thermostable Mutant Of Bacil 7e-25
2p3s_A 217 Crystal Structure Of A Thermostable Mutant Of Bacil 7e-25
2eu8_A 216 Crystal Structure Of A Thermostable Mutant Of Bacil 7e-25
2oo7_A 217 Crystal Structure Of A Thermostable Mutant Of Bacil 7e-25
1p3j_A 217 Adenylate Kinase From Bacillus Subtilis Length = 21 8e-25
3fb4_A 216 Crystal Structure Of Adenylate Kinase From Mariniba 8e-25
2ori_A 216 Crystal Structure Of A Thermostable Mutant Of Bacil 8e-25
3dkv_A 217 Crystal Structure Of Adenylate Kinase Variant Aklse 9e-25
3gmt_A 230 Crystal Structure Of Adenylate Kinase From Burkhold 1e-24
3dl0_A 216 Crystal Structure Of Adenylate Kinase Variant Aklse 1e-24
2osb_A 216 Crystal Structure Of A Thermostable Mutant Of Bacil 7e-24
3be4_A 217 Crystal Structure Of Cryptosporidium Parvum Adenyla 2e-23
1ake_A 214 Structure Of The Complex Between Adenylate Kinase F 3e-23
3hpr_A 214 Crystal Structure Of V148g Adenylate Kinase From E. 3e-23
1s3g_A 217 Crystal Structure Of Adenylate Kinase From Bacillus 3e-23
1e4v_A 214 Mutant G10v Of Adenylate Kinase From E. Coli, Modif 4e-22
2rgx_A206 Crystal Structure Of Adenylate Kinase From Aquifex 2e-21
1zak_A 222 Adenylate Kinase From Maize In Complex With The Inh 5e-21
1e4y_A 214 Mutant P9l Of Adenylate Kinase From E. Coli, Modifi 5e-21
3l0p_A 223 Crystal Structures Of Iron Containing Adenylate Kin 1e-20
2xb4_A 223 Crystal Structures Of Zinc Containing Adenylate Kin 1e-20
1p4s_A181 Solution Structure Of Mycobacterium Tuberculosis Ad 4e-18
2cdn_A201 Crystal Structure Of Mycobacterium Tuberculosis Ade 5e-18
3cm0_A186 Crystal Structure Of Adenylate Kinase From Thermus 2e-16
1z83_A196 Crystal Structure Of Human Ak1a In Complex With Ap5 4e-16
3adk_A195 Refined Structure Of Porcine Cytosolic Adenylate Ki 1e-15
2ak3_A 226 The Three-Dimensional Structure Of The Complex Betw 1e-14
1zd8_A 227 Structure Of Human Adenylate Kinase 3 Like 1 Length 1e-14
2ar7_A 246 Crystal Structure Of Human Adenylate Kinase 4, Ak4 2e-14
3umf_A217 Schistosoma Mansoni Adenylate Kinase Length = 217 5e-14
3ndp_A 231 Crystal Structure Of Human Ak4(L171p) Length = 231 5e-13
2bwj_A199 Structure Of Adenylate Kinase 5 Length = 199 8e-13
1uky_A203 Substrate Specificity And Assembly Of Catalytic Cen 5e-09
1qf9_A194 Ph Influences Fluoride Coordination Number Of The A 1e-08
1tev_A196 Crystal Structure Of The Human UmpCMP KINASE IN OPE 2e-07
1q3t_A 236 Solution Structure And Function Of An Essential Cmp 6e-04
>pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From Plasmodium Falciparum Length = 243 Back     alignment and structure

Iteration: 1

Score = 145 bits (367), Expect = 5e-36, Method: Compositional matrix adjust. Identities = 64/122 (52%), Positives = 88/122 (72%) Query: 8 NLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDML 67 NLE+ ++DL+ EL RR C SKPD R I +G PGSGKGTQS +K +C CHL+TGD+L Sbjct: 5 NLENFSTIDLLNELKRRYACLSKPDGRYIFLGAPGSGKGTQSLNLKKSHCYCHLSTGDLL 64 Query: 68 RAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQK 127 R A KT LG+K K +++G+LV D +V+ ++DE +K P C+KGFILDG+PR QA+ Sbjct: 65 REAAEKKTELGLKIKNIINEGKLVDDQMVLSLVDEKLKTPQCKKGFILDGYPRNVKQAED 124 Query: 128 VS 129 ++ Sbjct: 125 LN 126
>pdb|3AKY|A Chain A, Stability, Activity And Structure Of Adenylate Kinase Mutants Length = 220 Back     alignment and structure
>pdb|1AKY|A Chain A, High-Resolution Structures Of Adenylate Kinase From Yeast Ligated With Inhibitor Ap5a, Showing The Pathway Of Phosphoryl Transfer Length = 220 Back     alignment and structure
>pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2 Length = 242 Back     alignment and structure
>pdb|1AK2|A Chain A, Adenylate Kinase Isoenzyme-2 Length = 233 Back     alignment and structure
>pdb|1DVR|A Chain A, Structure Of A Mutant Adenylate Kinase Ligated With An Atp- Analogue Showing Domain Closure Over Atp Length = 220 Back     alignment and structure
>pdb|1ZIN|A Chain A, Adenylate Kinase With Bound Ap5a Length = 217 Back     alignment and structure
>pdb|2QAJ|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199rG213E) Length = 217 Back     alignment and structure
>pdb|2P3S|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (G214rQ199R) Length = 217 Back     alignment and structure
>pdb|2EU8|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199r) Length = 216 Back     alignment and structure
>pdb|2OO7|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (T179iQ199R) Length = 217 Back     alignment and structure
>pdb|1P3J|A Chain A, Adenylate Kinase From Bacillus Subtilis Length = 217 Back     alignment and structure
>pdb|3FB4|A Chain A, Crystal Structure Of Adenylate Kinase From Marinibacillus Marinus Length = 216 Back     alignment and structure
>pdb|2ORI|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (A193vQ199R) Length = 216 Back     alignment and structure
>pdb|3DKV|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse1 Length = 217 Back     alignment and structure
>pdb|3GMT|A Chain A, Crystal Structure Of Adenylate Kinase From Burkholderia Pseu Length = 230 Back     alignment and structure
>pdb|3DL0|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse3 Length = 216 Back     alignment and structure
>pdb|2OSB|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (q16l/q199r/) Length = 216 Back     alignment and structure
>pdb|3BE4|A Chain A, Crystal Structure Of Cryptosporidium Parvum Adenylate Kinase Cgd5_3360 Length = 217 Back     alignment and structure
>pdb|1AKE|A Chain A, Structure Of The Complex Between Adenylate Kinase From Escherichia Coli And The Inhibitor Ap5a Refined At 1.9 Angstroms Resolution: A Model For A Catalytic Transition State Length = 214 Back     alignment and structure
>pdb|3HPR|A Chain A, Crystal Structure Of V148g Adenylate Kinase From E. Coli, In Complex With Ap5a Length = 214 Back     alignment and structure
>pdb|1S3G|A Chain A, Crystal Structure Of Adenylate Kinase From Bacillus Globisporus Length = 217 Back     alignment and structure
>pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|2RGX|A Chain A, Crystal Structure Of Adenylate Kinase From Aquifex Aeolicus In Complex With Ap5a Length = 206 Back     alignment and structure
>pdb|1ZAK|A Chain A, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) Length = 222 Back     alignment and structure
>pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|3L0P|A Chain A, Crystal Structures Of Iron Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 Back     alignment and structure
>pdb|2XB4|A Chain A, Crystal Structures Of Zinc Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 Back     alignment and structure
>pdb|1P4S|A Chain A, Solution Structure Of Mycobacterium Tuberculosis Adenylate Kinase Length = 181 Back     alignment and structure
>pdb|2CDN|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Adenylate Kinase Complexed With Two Molecules Of Adp And Mg Length = 201 Back     alignment and structure
>pdb|3CM0|A Chain A, Crystal Structure Of Adenylate Kinase From Thermus Thermophilus Hb8 Length = 186 Back     alignment and structure
>pdb|1Z83|A Chain A, Crystal Structure Of Human Ak1a In Complex With Ap5a Length = 196 Back     alignment and structure
>pdb|3ADK|A Chain A, Refined Structure Of Porcine Cytosolic Adenylate Kinase At 2.1 Angstroms Resolution Length = 195 Back     alignment and structure
>pdb|2AK3|A Chain A, The Three-Dimensional Structure Of The Complex Between Mitochondrial Matrix Adenylate Kinase And Its Substrate Amp At 1.85 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1ZD8|A Chain A, Structure Of Human Adenylate Kinase 3 Like 1 Length = 227 Back     alignment and structure
>pdb|2AR7|A Chain A, Crystal Structure Of Human Adenylate Kinase 4, Ak4 Length = 246 Back     alignment and structure
>pdb|3UMF|A Chain A, Schistosoma Mansoni Adenylate Kinase Length = 217 Back     alignment and structure
>pdb|3NDP|A Chain A, Crystal Structure Of Human Ak4(L171p) Length = 231 Back     alignment and structure
>pdb|2BWJ|A Chain A, Structure Of Adenylate Kinase 5 Length = 199 Back     alignment and structure
>pdb|1UKY|A Chain A, Substrate Specificity And Assembly Of Catalytic Center Derived From Two Structures Of Ligated Uridylate Kinase Length = 203 Back     alignment and structure
>pdb|1QF9|A Chain A, Ph Influences Fluoride Coordination Number Of The Alfx Phosphoryl Transfer Transition State Analog In UmpCMP Kinase Length = 194 Back     alignment and structure
>pdb|1TEV|A Chain A, Crystal Structure Of The Human UmpCMP KINASE IN OPEN Conformation Length = 196 Back     alignment and structure
>pdb|1Q3T|A Chain A, Solution Structure And Function Of An Essential Cmp Kinase Of Streptococcus Pneumoniae Length = 236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 1e-69
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 7e-59
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 7e-59
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 1e-58
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 2e-58
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 2e-58
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 3e-58
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 9e-58
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 7e-57
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 9e-57
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 3e-56
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 7e-56
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 1e-54
2rgx_A206 Adenylate kinase; transferase(phosphotransferase), 1e-54
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 4e-50
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 1e-48
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 5e-48
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 2e-46
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 7e-44
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 4e-43
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 7e-21
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 1e-12
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 2e-04
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 8e-04
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Length = 243 Back     alignment and structure
 Score =  209 bits (533), Expect = 1e-69
 Identities = 64/122 (52%), Positives = 86/122 (70%)

Query: 6   AANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGD 65
             NLE+  ++DL+ EL RR  C SKPD R I +G PGSGKGTQS  +K  +C CHL+TGD
Sbjct: 3   NENLENFSTIDLLNELKRRYACLSKPDGRYIFLGAPGSGKGTQSLNLKKSHCYCHLSTGD 62

Query: 66  MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 125
           +LR A   KT LG+K K  +++G+LV D +V+ ++DE +K P C+KGFILDG+PR   QA
Sbjct: 63  LLREAAEKKTELGLKIKNIINEGKLVDDQMVLSLVDEKLKTPQCKKGFILDGYPRNVKQA 122

Query: 126 QK 127
           + 
Sbjct: 123 ED 124


>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Length = 217 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Length = 246 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Length = 216 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Length = 214 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Length = 216 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Length = 233 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 230 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Length = 201 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Length = 220 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Length = 223 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Length = 222 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Length = 227 Back     alignment and structure
>2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, nucleo binding, transferase; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Length = 206 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Length = 186 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Length = 196 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Length = 199 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Length = 194 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Length = 203 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Length = 196 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Length = 179 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Length = 184 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 99.96
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 99.95
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 99.92
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 99.91
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 99.84
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 99.83
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 99.83
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 99.83
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 99.82
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 99.81
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.78
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.78
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 99.77
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 99.76
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.74
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.73
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.72
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.72
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.71
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.7
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.61
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.45
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.36
3vaa_A199 Shikimate kinase, SK; structural genomics, center 99.2
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.2
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 99.13
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 99.09
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.08
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.06
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 99.04
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 99.03
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 99.01
1via_A175 Shikimate kinase; structural genomics, transferase 99.0
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.99
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.98
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.98
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.97
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.96
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 98.95
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.94
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.91
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.87
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 98.85
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.82
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.81
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.8
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 98.79
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 98.79
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.79
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.78
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.77
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.75
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 98.73
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 98.73
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 98.72
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.72
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.71
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.71
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 98.71
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 98.68
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.66
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.65
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 98.65
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.65
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 98.65
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 98.64
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 98.62
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.62
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 98.58
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 98.53
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 98.52
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 98.5
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 98.45
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 98.43
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.43
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.38
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.37
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.36
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.31
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.29
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.28
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.27
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 98.26
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.26
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.24
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 98.24
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 98.21
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.2
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 98.18
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.18
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 98.17
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 98.16
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 98.15
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 98.15
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.15
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.13
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 98.12
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 98.12
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 98.11
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.1
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 98.1
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 98.09
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 98.09
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.05
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.04
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 98.04
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 98.04
1dek_A 241 Deoxynucleoside monophosphate kinase; transferase, 98.03
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.03
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.02
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 98.02
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.01
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.0
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.99
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.97
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.97
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.97
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.96
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.96
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.95
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.95
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.93
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.93
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 97.93
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.92
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 97.92
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.91
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.89
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.89
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.89
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 97.88
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.87
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.87
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.86
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.86
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.86
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.85
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 97.85
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.85
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 97.83
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.83
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.82
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.82
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.82
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 97.82
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 97.81
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.81
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 97.8
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.79
3tmk_A 216 Thymidylate kinase; phosphotransferase; HET: T5A; 97.78
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.78
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.78
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 97.77
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.76
3co5_A143 Putative two-component system transcriptional RES 97.76
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.76
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.75
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.75
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.75
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.74
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 97.74
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.74
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.74
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.73
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.73
3bos_A242 Putative DNA replication factor; P-loop containing 97.73
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 97.73
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.73
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.71
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.7
1tue_A212 Replication protein E1; helicase, replication, E1E 97.68
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 97.68
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.67
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.67
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 97.66
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.64
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.63
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.63
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.62
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.62
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 97.61
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.61
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.59
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.58
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.58
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.57
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.57
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.57
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.56
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.55
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.55
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.54
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.52
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.51
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.51
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.5
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.5
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.49
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.48
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.47
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.47
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.47
2qgz_A308 Helicase loader, putative primosome component; str 97.46
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.46
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.45
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.45
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.45
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.44
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.42
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.42
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.41
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.41
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.41
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.41
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.4
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.38
3pvs_A 447 Replication-associated recombination protein A; ma 97.38
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.37
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.35
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 97.35
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.35
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.33
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.32
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.32
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.31
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.31
2r44_A 331 Uncharacterized protein; putative ATPase, structur 97.3
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.28
2og2_A359 Putative signal recognition particle receptor; nuc 97.27
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.25
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.23
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 97.23
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.23
1b0u_A 262 Histidine permease; ABC transporter, transport pro 97.21
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.21
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 97.2
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.2
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 97.19
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.19
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.19
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.19
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.19
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.18
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 97.18
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.17
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 97.16
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 97.16
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 97.16
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.16
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 97.15
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.15
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 97.15
1g6h_A 257 High-affinity branched-chain amino acid transport 97.15
2ghi_A 260 Transport protein; multidrug resistance protein, M 97.15
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.14
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.13
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.13
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.13
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 97.13
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.12
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.11
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 97.11
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 97.1
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.1
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 97.1
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.1
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.09
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.09
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.09
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.09
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.07
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.07
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 97.06
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.06
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.05
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.05
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 97.05
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 97.04
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.03
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 97.03
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.03
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.02
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 97.02
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.01
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.01
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.01
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.01
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.0
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.0
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.0
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 97.0
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 96.99
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.99
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.98
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.98
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.98
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.98
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.97
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.97
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.97
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.97
2ged_A193 SR-beta, signal recognition particle receptor beta 96.96
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.96
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.96
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.95
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.95
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.95
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.95
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.95
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.95
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 96.95
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.95
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.95
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.94
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.94
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.92
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 96.92
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.92
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.92
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 96.91
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.91
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.91
2z43_A 324 DNA repair and recombination protein RADA; archaea 96.91
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.91
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 96.9
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.89
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 96.89
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 96.88
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.86
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 96.86
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.86
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.85
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.84
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.84
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.84
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 96.84
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.84
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.83
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.83
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 96.82
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.82
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.82
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.81
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.81
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.81
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.81
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.8
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 96.8
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.8
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.8
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 96.79
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.79
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.79
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 96.78
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 96.78
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.78
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 96.77
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 96.77
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.77
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 96.76
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.76
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.76
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 96.75
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 96.75
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 96.75
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.74
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 96.74
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 96.74
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.74
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.74
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 96.73
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 96.73
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 96.73
2r6a_A 454 DNAB helicase, replicative helicase; replication, 96.73
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 96.73
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.72
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 96.72
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.71
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.71
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.71
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.71
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.7
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 96.7
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.7
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 96.69
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 96.68
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 96.68
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 96.68
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.66
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.66
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 96.65
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 96.64
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.64
1p6x_A 334 Thymidine kinase; P-loop, LID, transferase; HET: T 96.64
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.64
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 96.63
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.62
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 96.62
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 96.62
2fh5_B214 SR-beta, signal recognition particle receptor beta 96.62
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.62
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.61
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.61
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 96.61
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.6
2fna_A 357 Conserved hypothetical protein; structural genomic 96.6
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 96.6
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.6
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.6
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.58
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 96.57
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 96.56
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 96.56
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.55
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 96.54
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 96.52
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.52
1xp8_A 366 RECA protein, recombinase A; recombination, radior 96.51
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 96.5
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.5
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.5
3io5_A 333 Recombination and repair protein; storage dimer, i 96.5
2xxa_A 433 Signal recognition particle protein; protein trans 96.49
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.49
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 96.49
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.48
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 96.48
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.48
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 96.47
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 96.47
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.47
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 96.46
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 96.45
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.45
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 96.44
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.42
3llu_A196 RAS-related GTP-binding protein C; structural geno 96.42
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.41
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 96.41
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 96.41
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.4
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 96.4
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.39
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 96.38
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 96.38
3kta_A182 Chromosome segregation protein SMC; structural mai 96.38
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.38
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.36
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.36
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 96.35
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.34
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.33
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 96.33
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 96.32
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 96.31
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 96.3
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.3
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 96.29
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 96.28
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 96.28
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.27
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 96.26
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 96.25
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.24
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 96.24
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.21
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 96.21
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 96.21
1e2k_A 331 Thymidine kinase; transferase, antiviral drug, enz 96.2
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 96.19
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.19
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 96.19
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 96.18
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 96.15
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.15
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 96.15
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.14
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 96.13
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 96.11
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 96.1
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 96.09
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 96.07
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 96.05
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 96.04
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.04
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 96.03
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.98
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 95.97
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.97
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.96
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.96
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 95.95
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 95.92
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.92
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 95.9
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 95.9
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.89
3bs4_A 260 Uncharacterized protein PH0321; structural genomic 95.89
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.87
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
Probab=99.96  E-value=7.5e-29  Score=184.86  Aligned_cols=105  Identities=36%  Similarity=0.603  Sum_probs=97.7

Q ss_pred             cCCCCeEEEEECCCCCChhhHHHHHHhhhCccccchHHHHHHHHHccCcchHHHHHHhhcCCcchHHHHHHHHHHHhcCC
Q 032438           28 ASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKP  107 (141)
Q Consensus        28 ~~~~~~~I~i~G~pgsGKstla~~La~~~~~~~is~~~ll~~~~~~~~~~g~~i~~~l~~g~~ip~~~~~~ll~~~l~~~  107 (141)
                      .-+++++|+|+|||||||+|+|+.|+++||+.|+|++|++|+++..++++|+.++.+++.|.++|++++.+++.+++.+.
T Consensus        25 ~~~k~kiI~llGpPGsGKgTqa~~L~~~~g~~hIstGdllR~~i~~~t~lg~~~~~~~~~G~lVpde~~~~lv~~~l~~~  104 (217)
T 3umf_A           25 KLAKAKVIFVLGGPGSGKGTQCEKLVQKFHFNHLSSGDLLRAEVQSGSPKGKELKAMMERGELVPLEVVLALLKEAMIKL  104 (217)
T ss_dssp             CTTSCEEEEEECCTTCCHHHHHHHHHHHHCCEEECHHHHHHHHHTTCCHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHH
T ss_pred             hccCCcEEEEECCCCCCHHHHHHHHHHHHCCceEcHHHHHHHHHHcCCchHHHHHHHHhcCCCCCHHHHHHHHHHHHhhc
Confidence            45667899999999999999999999999999999999999999999999999999999999999999999999999764


Q ss_pred             -CCCCeEEEeCCCCCHHHHHhccccc
Q 032438          108 -SCQKGFILDGFPRTEVQAQKVSPSS  132 (141)
Q Consensus       108 -~~~~g~IldG~P~~~~q~~~l~~~~  132 (141)
                       ++..|||+|||||+..|++.|++.+
T Consensus       105 ~~~~~g~ilDGfPRt~~Qa~~l~~~~  130 (217)
T 3umf_A          105 VDKNCHFLIDGYPRELDQGIKFEKEV  130 (217)
T ss_dssp             TTTCSEEEEETBCSSHHHHHHHHHHT
T ss_pred             cccccCcccccCCCcHHHHHHHHHhC
Confidence             4568999999999999999998754



>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d1zina1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 3e-26
d1s3ga1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 1e-25
d1e4va1179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 6e-24
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 5e-22
d1ak2a1190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 5e-21
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 3e-20
d1akya1180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 5e-19
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 9e-18
d1teva_194 c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) 2e-17
d2ak3a1189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 9e-17
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 1e-15
d1ukza_196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 5e-15
d1ckea_ 225 c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 4e-10
d1q3ta_ 223 c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae 9e-10
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 2e-09
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 2e-08
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 2e-08
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 8e-08
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 2e-07
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 1e-06
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 5e-05
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.001
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.003
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus stearothermophilus [TaxId: 1422]
 Score = 95.0 bits (235), Expect = 3e-26
 Identities = 49/93 (52%), Positives = 69/93 (74%)

Query: 34  RLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSD 93
            L+L+G PG+GKGTQ+  I   Y + H++TGDM RAA+   TPLG++AK+ MD+G+LV D
Sbjct: 2   NLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPD 61

Query: 94  DLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQ 126
           ++ +GI+ E + K  CQ GF+LDGFPRT  QA+
Sbjct: 62  EVTIGIVRERLSKDDCQNGFLLDGFPRTVAQAE 94


>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.92
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.92
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 99.92
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 99.91
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.89
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.88
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.88
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 99.88
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.87
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 99.86
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.86
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.85
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 99.37
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 99.27
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 99.21
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.19
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 99.19
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 99.18
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 99.16
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 99.14
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 99.06
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.03
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.94
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.93
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.91
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.89
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.81
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.79
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.74
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 98.73
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.72
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.72
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 98.67
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.67
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.61
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 98.61
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 98.54
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.47
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.46
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.44
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 98.41
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.37
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.32
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 98.29
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.28
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.27
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 98.24
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 98.23
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.23
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.21
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.21
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.2
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.2
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.19
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.16
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.13
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 98.12
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.08
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.07
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.07
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.07
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.02
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.96
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.95
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 97.91
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.88
d1vmaa2213 GTPase domain of the signal recognition particle r 97.85
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.84
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.84
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.84
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 97.81
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 97.77
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.76
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.76
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.76
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.75
d2qy9a2211 GTPase domain of the signal recognition particle r 97.73
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 97.72
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.72
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.72
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.71
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 97.7
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.66
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.65
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 97.65
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.64
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.6
d1okkd2207 GTPase domain of the signal recognition particle r 97.6
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.54
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.54
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.52
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 97.52
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.51
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 97.5
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.5
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 97.49
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 97.46
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.42
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.4
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.35
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.34
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.33
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.32
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 97.3
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.29
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 97.29
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.27
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 97.27
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 97.26
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.25
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 97.24
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 97.22
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.21
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.19
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.17
d1g2912 240 Maltose transport protein MalK, N-terminal domain 97.17
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.15
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.15
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.11
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 97.11
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.1
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 97.1
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.09
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.07
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 97.05
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 97.04
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.03
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 97.03
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 97.02
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.02
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.98
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 96.94
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.93
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.91
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.9
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.89
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.89
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.89
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.84
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.82
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.81
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.8
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 96.78
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.77
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.76
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.75
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.74
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.73
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.73
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.72
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.71
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.71
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.7
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 96.69
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.69
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.69
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.66
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.66
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.66
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.65
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.63
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 96.63
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.61
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 96.6
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.57
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 96.56
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.55
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.54
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 96.54
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.54
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.53
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.53
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.53
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.52
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.51
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.49
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.45
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.45
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 96.44
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.43
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.43
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.43
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.43
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.43
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 96.42
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.42
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 96.42
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 96.41
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.4
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.37
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.34
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.32
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.32
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.29
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 96.27
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.26
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.25
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 96.22
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.21
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.2
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.16
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 96.13
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 96.13
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.1
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 96.07
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.04
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.0
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.99
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.97
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.9
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 95.81
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.77
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.75
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.73
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.7
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.69
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.54
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.44
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.43
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 95.29
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.21
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.13
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.1
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 95.01
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 94.96
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 94.95
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 94.85
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.82
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.75
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.7
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 94.64
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.63
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.62
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.61
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.45
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 94.25
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 94.08
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 94.07
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 94.05
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 93.98
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 93.9
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 93.86
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 93.86
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 93.81
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 93.77
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 93.75
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.74
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.64
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.63
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 93.51
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 93.51
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 93.28
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 93.16
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.12
d1xpua3 289 Transcription termination factor Rho, ATPase domai 92.97
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 92.61
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 92.5
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 92.34
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.32
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 92.17
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 92.01
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 91.97
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 91.64
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 90.85
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.66
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 90.6
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 90.59
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.25
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 90.21
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 90.05
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 89.54
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 87.92
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 87.33
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 86.92
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 86.7
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 86.58
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.94
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.44
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 85.15
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 85.07
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 83.95
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 83.82
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 83.52
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 82.25
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 81.29
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]
Probab=99.92  E-value=1.9e-25  Score=159.88  Aligned_cols=103  Identities=50%  Similarity=0.948  Sum_probs=96.8

Q ss_pred             CCCeEEEEECCCCCChhhHHHHHHhhhCccccchHHHHHHHHHccCcchHHHHHHhhcCCcchHHHHHHHHHHHhcCCCC
Q 032438           30 KPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSC  109 (141)
Q Consensus        30 ~~~~~I~i~G~pgsGKstla~~La~~~~~~~is~~~ll~~~~~~~~~~g~~i~~~l~~g~~ip~~~~~~ll~~~l~~~~~  109 (141)
                      +++.+|+|+|||||||||+|+.||++||+.|++++++++++...+++.+..+..++..|..+|++.+..++..++.....
T Consensus         1 p~~~riil~G~pGSGKsT~a~~La~~~g~~~i~~gdllr~~~~~~~~~g~~~~~~~~~g~~~~~~~v~~~~~~~l~~~~~   80 (190)
T d1ak2a1           1 PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPC   80 (190)
T ss_dssp             CCCCEEEEECCTTSSHHHHHHHHHHHHTCEEEEHHHHHHHHHHHTCHHHHHHHHHHHTTCCCCHHHHHHHHHHHHTSGGG
T ss_pred             CCccEEEEECCCCCCHHHHHHHHHHHhCCeEEeHHHHHHHHHhccCcccchhhhhhccCCccccceeeeeehhhhccccc
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999988777


Q ss_pred             CCeEEEeCCCCCHHHHHhccccc
Q 032438          110 QKGFILDGFPRTEVQAQKVSPSS  132 (141)
Q Consensus       110 ~~g~IldG~P~~~~q~~~l~~~~  132 (141)
                      .+|||+||||++..|++.|.+.+
T Consensus        81 ~~g~ii~g~pr~~~qa~~l~~~~  103 (190)
T d1ak2a1          81 KNGFLLDGFPRTVRQAEMLDDLM  103 (190)
T ss_dssp             TTCEEEESCCCSHHHHHHHHHHH
T ss_pred             cCceeecccccchhHHHHHHHHh
Confidence            89999999999999999987643



>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure