Citrus Sinensis ID: 032464
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| 225425224 | 139 | PREDICTED: acyl carrier protein 4, chlor | 0.964 | 0.971 | 0.751 | 2e-47 | |
| 356527612 | 142 | PREDICTED: acyl carrier protein 1, chlor | 0.992 | 0.978 | 0.645 | 7e-42 | |
| 255540085 | 137 | acyl carrier protein, putative [Ricinus | 0.978 | 1.0 | 0.669 | 2e-40 | |
| 224119790 | 138 | predicted protein [Populus trichocarpa] | 0.964 | 0.978 | 0.664 | 1e-38 | |
| 356513457 | 143 | PREDICTED: acyl carrier protein 4, chlor | 0.992 | 0.972 | 0.612 | 1e-37 | |
| 388516599 | 136 | unknown [Lotus japonicus] | 0.957 | 0.985 | 0.611 | 7e-36 | |
| 357520563 | 137 | Acyl carrier protein [Medicago truncatul | 0.971 | 0.992 | 0.579 | 9e-36 | |
| 284808855 | 140 | acyl carrier protein 4 [Arachis hypogaea | 0.914 | 0.914 | 0.603 | 1e-35 | |
| 224134124 | 139 | predicted protein [Populus trichocarpa] | 0.957 | 0.964 | 0.614 | 1e-35 | |
| 189498314 | 141 | plastid acyl carrier protein [Camellia o | 0.685 | 0.680 | 0.75 | 2e-35 |
| >gi|225425224|ref|XP_002267614.1| PREDICTED: acyl carrier protein 4, chloroplastic [Vitis vinifera] gi|296088168|emb|CBI35660.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 193 bits (491), Expect = 2e-47, Method: Compositional matrix adjust.
Identities = 103/137 (75%), Positives = 115/137 (83%), Gaps = 2/137 (1%)
Query: 1 MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKP 60
MA SA TSV F SLK L + I + S+LKM GW K+ FPSL+T+RF VSCSAKP
Sbjct: 1 MAAVSA-TSVTFGSSLKL-LKSRQITGKASSLKMVTVGWTKSGFPSLRTSRFRVSCSAKP 58
Query: 61 ETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLEEEFGIGVEEENSQN 120
ETVQKVCEIV++QLALPAE+ELT ESKF+ALGADSLDTVEIVMSLEEEFGI VEEE+SQN
Sbjct: 59 ETVQKVCEIVKKQLALPAESELTPESKFAALGADSLDTVEIVMSLEEEFGISVEEESSQN 118
Query: 121 ITTVQEAADLIEKLVEK 137
ITTVQEAADLIEKLV+K
Sbjct: 119 ITTVQEAADLIEKLVQK 135
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356527612|ref|XP_003532402.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255540085|ref|XP_002511107.1| acyl carrier protein, putative [Ricinus communis] gi|223550222|gb|EEF51709.1| acyl carrier protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224119790|ref|XP_002318163.1| predicted protein [Populus trichocarpa] gi|222858836|gb|EEE96383.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356513457|ref|XP_003525430.1| PREDICTED: acyl carrier protein 4, chloroplastic [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388516599|gb|AFK46361.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|357520563|ref|XP_003630570.1| Acyl carrier protein [Medicago truncatula] gi|355524592|gb|AET05046.1| Acyl carrier protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|284808855|gb|ADB94675.1| acyl carrier protein 4 [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|224134124|ref|XP_002321742.1| predicted protein [Populus trichocarpa] gi|118488773|gb|ABK96197.1| unknown [Populus trichocarpa] gi|222868738|gb|EEF05869.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|189498314|gb|ACE06753.1| plastid acyl carrier protein [Camellia oleifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| TAIR|locus:2199461 | 136 | ACP2 "AT1G54580" [Arabidopsis | 0.95 | 0.977 | 0.422 | 4.4e-20 | |
| TAIR|locus:2181216 | 139 | ACP5 "AT5G27200" [Arabidopsis | 0.907 | 0.913 | 0.424 | 5.7e-20 | |
| TAIR|locus:2199517 | 136 | ACP3 "acyl carrier protein 3" | 0.728 | 0.75 | 0.5 | 5.1e-19 | |
| TAIR|locus:2114820 | 137 | ACP1 "acyl carrier protein 1" | 0.664 | 0.678 | 0.473 | 7.5e-18 | |
| GENEDB_PFALCIPARUM|PFB0385w | 137 | PFB0385w "acyl carrier protein | 0.828 | 0.846 | 0.317 | 4.2e-08 | |
| UNIPROTKB|Q7KWJ1 | 137 | PFB0385w "Apicoplast ACP" [Pla | 0.828 | 0.846 | 0.317 | 4.2e-08 | |
| TIGR_CMR|CBU_0496 | 84 | CBU_0496 "acyl carrier protein | 0.492 | 0.821 | 0.408 | 4.8e-07 | |
| UNIPROTKB|Q9KQH8 | 78 | acpP "Acyl carrier protein" [V | 0.478 | 0.858 | 0.420 | 6.1e-07 | |
| TIGR_CMR|VC_2020 | 78 | VC_2020 "acyl carrier protein" | 0.478 | 0.858 | 0.420 | 6.1e-07 | |
| UNIPROTKB|P0A6A8 | 78 | acpP [Escherichia coli K-12 (t | 0.478 | 0.858 | 0.420 | 7.8e-07 |
| TAIR|locus:2199461 ACP2 "AT1G54580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 238 (88.8 bits), Expect = 4.4e-20, P = 4.4e-20
Identities = 57/135 (42%), Positives = 81/135 (60%)
Query: 7 ITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKT--NRFCVSCSAKPETVQ 64
+ S+ + S+ +A S +K G R + +L+ R VSC+AKPETV
Sbjct: 1 MASIAASASISLQARPRQLAIAASQVKSFSNGRRSSLSFNLRQLPTRLTVSCAAKPETVD 60
Query: 65 KVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLXXXXXXXXXXXNSQNITTV 124
KVC +VR+QL+L E+T+ +KF+ALGADSLDTVEIVM L +Q+I TV
Sbjct: 61 KVCAVVRKQLSLKEADEITAATKFAALGADSLDTVEIVMGLEEEFGIEMAEEKAQSIATV 120
Query: 125 QEAADLIEKLVEKKA 139
++AA LIE+L+ +KA
Sbjct: 121 EQAAALIEELLFEKA 135
|
|
| TAIR|locus:2181216 ACP5 "AT5G27200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199517 ACP3 "acyl carrier protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2114820 ACP1 "acyl carrier protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PFB0385w PFB0385w "acyl carrier protein, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7KWJ1 PFB0385w "Apicoplast ACP" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0496 CBU_0496 "acyl carrier protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQH8 acpP "Acyl carrier protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2020 VC_2020 "acyl carrier protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6A8 acpP [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| PRK00982 | 78 | PRK00982, acpP, acyl carrier protein; Provisional | 8e-20 | |
| CHL00124 | 82 | CHL00124, acpP, acyl carrier protein; Validated | 6e-19 | |
| TIGR00517 | 77 | TIGR00517, acyl_carrier, acyl carrier protein | 6e-18 | |
| COG0236 | 80 | COG0236, AcpP, Acyl carrier protein [Lipid metabol | 2e-14 | |
| PTZ00171 | 148 | PTZ00171, PTZ00171, acyl carrier protein; Provisio | 2e-13 | |
| pfam00550 | 66 | pfam00550, PP-binding, Phosphopantetheine attachme | 2e-09 | |
| PRK12449 | 80 | PRK12449, PRK12449, acyl carrier protein; Provisio | 4e-07 | |
| smart00823 | 86 | smart00823, PKS_PP, Phosphopantetheine attachment | 4e-05 | |
| PRK08172 | 82 | PRK08172, PRK08172, putative acyl carrier protein | 4e-05 | |
| PRK05828 | 84 | PRK05828, PRK05828, acyl carrier protein; Validate | 6e-05 |
| >gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional | Back alignment and domain information |
|---|
Score = 77.1 bits (191), Expect = 8e-20
Identities = 39/76 (51%), Positives = 53/76 (69%), Gaps = 2/76 (2%)
Query: 59 KPETVQKVCEIVRRQLALPAETELTSESKFSA-LGADSLDTVEIVMSLEEEFGIGVEEEN 117
E +KV +I+ QL + E E+T E+ F LGADSLDTVE+VM+LEEEFGI + +E+
Sbjct: 1 MSEIFEKVKKIIVEQLGVDEE-EVTPEASFVDDLGADSLDTVELVMALEEEFGIEIPDED 59
Query: 118 SQNITTVQEAADLIEK 133
++ I TV +A D IEK
Sbjct: 60 AEKIKTVGDAVDYIEK 75
|
Length = 78 |
| >gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213536 TIGR00517, acyl_carrier, acyl carrier protein | Back alignment and domain information |
|---|
| >gnl|CDD|223314 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240304 PTZ00171, PTZ00171, acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site | Back alignment and domain information |
|---|
| >gnl|CDD|183533 PRK12449, PRK12449, acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site | Back alignment and domain information |
|---|
| >gnl|CDD|181266 PRK08172, PRK08172, putative acyl carrier protein IacP; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180278 PRK05828, PRK05828, acyl carrier protein; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| KOG1748 | 131 | consensus Acyl carrier protein/NADH-ubiquinone oxi | 99.85 | |
| PRK07117 | 79 | acyl carrier protein; Validated | 99.84 | |
| PRK05828 | 84 | acyl carrier protein; Validated | 99.83 | |
| PRK05350 | 82 | acyl carrier protein; Provisional | 99.81 | |
| CHL00124 | 82 | acpP acyl carrier protein; Validated | 99.8 | |
| PRK07639 | 86 | acyl carrier protein; Provisional | 99.8 | |
| PRK08172 | 82 | putative acyl carrier protein IacP; Validated | 99.79 | |
| PRK05883 | 91 | acyl carrier protein; Validated | 99.79 | |
| PRK12449 | 80 | acyl carrier protein; Provisional | 99.79 | |
| PTZ00171 | 148 | acyl carrier protein; Provisional | 99.78 | |
| TIGR00517 | 77 | acyl_carrier acyl carrier protein. S (Ser) at posi | 99.73 | |
| PRK06508 | 93 | acyl carrier protein; Provisional | 99.73 | |
| COG0236 | 80 | AcpP Acyl carrier protein [Lipid metabolism / Seco | 99.72 | |
| PRK09184 | 89 | acyl carrier protein; Provisional | 99.71 | |
| PRK07081 | 83 | acyl carrier protein; Provisional | 99.67 | |
| PRK00982 | 78 | acpP acyl carrier protein; Provisional | 99.66 | |
| PF00550 | 67 | PP-binding: Phosphopantetheine attachment site; In | 99.59 | |
| PRK05087 | 78 | D-alanine--poly(phosphoribitol) ligase subunit 2; | 99.58 | |
| PF14573 | 96 | PP-binding_2: Acyl-carrier; PDB: 3CE7_A. | 99.35 | |
| TIGR01688 | 73 | dltC D-alanine--poly(phosphoribitol) ligase, subun | 99.35 | |
| smart00823 | 86 | PKS_PP Phosphopantetheine attachment site. Phospho | 98.86 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 98.8 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 98.53 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 98.23 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 98.13 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 98.05 | |
| COG3433 | 74 | Aryl carrier domain [Secondary metabolites biosynt | 98.05 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 98.02 | |
| PRK05691 | 4334 | peptide synthase; Validated | 97.85 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 97.8 | |
| PRK05691 | 4334 | peptide synthase; Validated | 97.77 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 97.73 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 97.66 | |
| PF07377 | 111 | DUF1493: Protein of unknown function (DUF1493); In | 97.45 | |
| KOG1202 | 2376 | consensus Animal-type fatty acid synthase and rela | 96.59 | |
| PF10501 | 112 | Ribosomal_L50: Ribosomal subunit 39S; InterPro: IP | 95.57 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 95.16 | |
| KOG2452 | 881 | consensus Formyltetrahydrofolate dehydrogenase [Nu | 92.3 | |
| KOG1178 | 1032 | consensus Non-ribosomal peptide synthetase/alpha-a | 82.09 |
| >KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
Probab=99.85 E-value=4.6e-22 Score=144.87 Aligned_cols=82 Identities=48% Similarity=0.725 Sum_probs=78.4
Q ss_pred CCChHHHHHHHHHHHHHHhCCCCCCCCCCCCCcc-ccCCChHHHHHHHHHHHHHhCCCcCccccccCCCHHHHHHHHHHH
Q 032464 56 CSAKPETVQKVCEIVRRQLALPAETELTSESKFS-ALGADSLDTVEIVMSLEEEFGIGVEEENSQNITTVQEAADLIEKL 134 (140)
Q Consensus 56 ~m~~~ei~~~V~~il~~~l~i~~~~eI~~ds~l~-dLGlDSLd~vELv~~LEeeFgI~i~~~~l~~~~TV~dl~~~I~~~ 134 (140)
|.+++++.++|..+++.+..+++ +.++++++|. |||+||||.|||+|+|||||||+||+++.+++.|++++++||+++
T Consensus 48 ~l~k~~v~~RVl~VVk~~dki~~-~k~~~~s~f~~DLGlDSLD~VEiVMAlEEEFgiEIpd~dAdki~t~~da~~yI~~~ 126 (131)
T KOG1748|consen 48 CLAKKEVVDRVLDVVKKFDKIDP-SKLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIEIPDEDADKIKTVRDAADYIADK 126 (131)
T ss_pred hhhHHHHHHHHHHHHHHhhcCCc-cccchhhHHHHhcCCcccccchhhhhhHHHhCCccCcchhhhhCCHHHHHHHHHhc
Confidence 89999999999999999999999 6899999998 999999999999999999999999999999999999999999988
Q ss_pred HHhh
Q 032464 135 VEKK 138 (140)
Q Consensus 135 ~~~k 138 (140)
...+
T Consensus 127 ~d~k 130 (131)
T KOG1748|consen 127 PDVK 130 (131)
T ss_pred cccc
Confidence 7654
|
|
| >PRK07117 acyl carrier protein; Validated | Back alignment and domain information |
|---|
| >PRK05828 acyl carrier protein; Validated | Back alignment and domain information |
|---|
| >PRK05350 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >CHL00124 acpP acyl carrier protein; Validated | Back alignment and domain information |
|---|
| >PRK07639 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >PRK08172 putative acyl carrier protein IacP; Validated | Back alignment and domain information |
|---|
| >PRK05883 acyl carrier protein; Validated | Back alignment and domain information |
|---|
| >PRK12449 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00171 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00517 acyl_carrier acyl carrier protein | Back alignment and domain information |
|---|
| >PRK06508 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK09184 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >PRK07081 acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >PRK00982 acpP acyl carrier protein; Provisional | Back alignment and domain information |
|---|
| >PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] | Back alignment and domain information |
|---|
| >PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated | Back alignment and domain information |
|---|
| >PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A | Back alignment and domain information |
|---|
| >TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 | Back alignment and domain information |
|---|
| >smart00823 PKS_PP Phosphopantetheine attachment site | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length | Back alignment and domain information |
|---|
| >KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10501 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IPR018305 This entry represents the L50 protein from the mitochondrial 39S ribosomal subunit | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 140 | ||||
| 2ava_A | 82 | Solution Structure Of Stearoyl-Acyl Carrier Protein | 3e-18 | ||
| 2xz0_D | 82 | The Structure Of The 2:1 (Partially Occupied) Compl | 1e-17 | ||
| 2k92_A | 77 | Structural Modification Of Acyl Carrier Protein By | 5e-06 | ||
| 3ejb_A | 97 | Crystal Structure Of P450bioi In Complex With Tetra | 6e-06 | ||
| 1t8k_A | 77 | Crystal Structure Of Apo Acyl Carrier Protein From | 7e-06 | ||
| 1l0h_A | 78 | Crystal Structure Of Butyryl-Acp From E.Coli Length | 7e-06 | ||
| 2l0q_A | 80 | Nmr Solution Structure Of Vibrio Harveyi Acyl Carri | 1e-05 | ||
| 1l0i_A | 78 | Crystal Structure Of Butyryl-Acp I62m Mutant Length | 2e-05 | ||
| 2fq0_A | 79 | Solution Structure Of Major Conformation Of Holo-Ac | 2e-05 | ||
| 3gzl_A | 81 | Crystal Structure Of Holo Pfacp Disulfide-Linked Di | 2e-05 | ||
| 2ehs_A | 77 | Crystal Structure Of Acyl Carrier Protein From Aqui | 2e-04 | ||
| 2l3v_A | 79 | Nmr Structure Of Acyl Carrier Protein From Brucella | 2e-04 |
| >pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 | Back alignment and structure |
|
| >pdb|2XZ0|D Chain D, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. Length = 82 | Back alignment and structure |
| >pdb|2K92|A Chain A, Structural Modification Of Acyl Carrier Protein By Butyryl Group Length = 77 | Back alignment and structure |
| >pdb|3EJB|A Chain A, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 97 | Back alignment and structure |
| >pdb|1T8K|A Chain A, Crystal Structure Of Apo Acyl Carrier Protein From E. Coli Length = 77 | Back alignment and structure |
| >pdb|1L0H|A Chain A, Crystal Structure Of Butyryl-Acp From E.Coli Length = 78 | Back alignment and structure |
| >pdb|2L0Q|A Chain A, Nmr Solution Structure Of Vibrio Harveyi Acyl Carrier Protein (Acp) Length = 80 | Back alignment and structure |
| >pdb|1L0I|A Chain A, Crystal Structure Of Butyryl-Acp I62m Mutant Length = 78 | Back alignment and structure |
| >pdb|2FQ0|A Chain A, Solution Structure Of Major Conformation Of Holo-Acyl Carrier Protein From Malaria Parasite Plasmodium Falciparum Length = 79 | Back alignment and structure |
| >pdb|3GZL|A Chain A, Crystal Structure Of Holo Pfacp Disulfide-Linked Dimer Length = 81 | Back alignment and structure |
| >pdb|2EHS|A Chain A, Crystal Structure Of Acyl Carrier Protein From Aquifex Aeolicus (Form 1) Length = 77 | Back alignment and structure |
| >pdb|2L3V|A Chain A, Nmr Structure Of Acyl Carrier Protein From Brucella Melitensis Length = 79 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| 2ava_A | 82 | ACP I, acyl carrier protein I, chloroplast; four-h | 2e-30 | |
| 1vku_A | 100 | Acyl carrier protein; TM0175, structural genomics, | 3e-25 | |
| 2kw2_A | 101 | Specialized acyl carrier protein; structural genom | 1e-20 | |
| 3gzm_A | 81 | Acyl carrier protein; helix bundle, phosphopanteth | 2e-20 | |
| 3ejb_A | 97 | Acyl carrier protein; protein-protein complex, cyt | 3e-20 | |
| 1l0i_A | 78 | Acyl carrier protein; acyl chain binding, fatty ac | 5e-20 | |
| 1x3o_A | 80 | Acyl carrier protein; structural genomics, riken s | 6e-20 | |
| 4dxe_H | 101 | ACP, acyl carrier protein; acyl-carrier-protein sy | 9e-20 | |
| 2kwl_A | 84 | ACP, acyl carrier protein; structural genomics, se | 1e-19 | |
| 2ehs_A | 77 | ACP, acyl carrier protein; lipid transport, struct | 1e-19 | |
| 2qnw_A | 82 | Acyl carrier protein; malaria, SGC, structural gen | 1e-19 | |
| 2l3v_A | 79 | ACP, acyl carrier protein; structural genomi seatt | 1e-19 | |
| 2lol_A | 81 | ACP, acyl carrier protein; lipid transport; NMR {R | 2e-19 | |
| 2cnr_A | 82 | FAS, ACP, acyl carrier protein; polykdetide, phosp | 2e-19 | |
| 2dnw_A | 99 | Acyl carrier protein; ACP, fatty acid biosynthesis | 2e-19 | |
| 2l4b_A | 88 | Acyl carrier protein; infectious disease, human gr | 4e-19 | |
| 2cgq_A | 113 | Acyl carrier protein ACPA; RV0033, protein transpo | 6e-19 | |
| 1klp_A | 115 | ACP, ACPM, meromycolate extension acyl carrier pro | 9e-19 | |
| 3ce7_A | 107 | Specific mitochodrial acyl carrier protein; malari | 1e-17 | |
| 1f80_D | 81 | Acyl carrier protein; transferase; HET: PN2; 2.30A | 4e-16 | |
| 2jq4_A | 105 | AGR_C_4658P, hypothetical protein ATU2571; ATC2521 | 3e-13 | |
| 2kci_A | 87 | Putative acyl carrier protein; alpha, ACP, PCP, st | 3e-12 | |
| 1nq4_A | 95 | Oxytetracycline polyketide synthase acyl carrier p | 3e-12 | |
| 2lte_A | 103 | Specialized acyl carrier protein; APO protein, tra | 9e-12 | |
| 1af8_A | 86 | Actinorhodin polyketide synthase acyl carrier Pro; | 7e-11 | |
| 1or5_A | 83 | Acyl carrier protein; ACP, biosynthesis, frenolici | 8e-11 | |
| 2kr5_A | 89 | PKS, aflatoxin biosynthesis polyketide synthase; a | 1e-08 | |
| 2lki_A | 105 | Putative uncharacterized protein; helical bundle, | 4e-08 | |
| 1fh1_A | 92 | NODF, nodulation protein F; ROOT nodulation factor | 2e-07 | |
| 2amw_A | 83 | Hypothetical protein NE2163; all helical protein, | 2e-05 | |
| 2afd_A | 88 | Protein ASL1650; twisted antiparallel helical bund | 3e-05 | |
| 1dv5_A | 80 | APO-DCP, APO-D-alanyl carrier protein; 3-helix bun | 3e-05 | |
| 2cg5_B | 91 | Fatty acid synthase; transferase-hydrolase complex | 8e-05 | |
| 2l22_A | 212 | Mupirocin didomain acyl carrier protein; biosynthe | 2e-04 | |
| 2l22_A | 212 | Mupirocin didomain acyl carrier protein; biosynthe | 2e-04 |
| >2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 | Back alignment and structure |
|---|
Score = 104 bits (261), Expect = 2e-30
Identities = 52/82 (63%), Positives = 71/82 (86%)
Query: 58 AKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLEEEFGIGVEEEN 117
AK ET+ KV +IV+ +LAL A+ +T++S+FS LGADSLDTVEIVM+LEEEFGI V+E+
Sbjct: 1 AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDK 60
Query: 118 SQNITTVQEAADLIEKLVEKKA 139
+Q+I+T+Q+AAD+IE L+EKKA
Sbjct: 61 AQDISTIQQAADVIEGLLEKKA 82
|
| >1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 | Back alignment and structure |
|---|
| >2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Length = 101 | Back alignment and structure |
|---|
| >3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 | Back alignment and structure |
|---|
| >3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 | Back alignment and structure |
|---|
| >1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Length = 78 | Back alignment and structure |
|---|
| >1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Length = 80 | Back alignment and structure |
|---|
| >4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Length = 101 | Back alignment and structure |
|---|
| >2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 | Back alignment and structure |
|---|
| >2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Length = 77 | Back alignment and structure |
|---|
| >2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Length = 82 | Back alignment and structure |
|---|
| >2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 | Back alignment and structure |
|---|
| >2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Length = 81 | Back alignment and structure |
|---|
| >2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Length = 82 | Back alignment and structure |
|---|
| >2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 | Back alignment and structure |
|---|
| >2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Length = 113 | Back alignment and structure |
|---|
| >1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Length = 115 | Back alignment and structure |
|---|
| >3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Length = 107 | Back alignment and structure |
|---|
| >1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Length = 81 | Back alignment and structure |
|---|
| >2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 | Back alignment and structure |
|---|
| >1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 | Back alignment and structure |
|---|
| >2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Length = 103 | Back alignment and structure |
|---|
| >1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Length = 86 | Back alignment and structure |
|---|
| >1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Length = 83 | Back alignment and structure |
|---|
| >2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 | Back alignment and structure |
|---|
| >2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Length = 105 | Back alignment and structure |
|---|
| >1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Length = 92 | Back alignment and structure |
|---|
| >2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 | Back alignment and structure |
|---|
| >1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Length = 80 | Back alignment and structure |
|---|
| >2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Length = 91 | Back alignment and structure |
|---|
| >2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 | Back alignment and structure |
|---|
| >2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| 2kci_A | 87 | Putative acyl carrier protein; alpha, ACP, PCP, st | 99.81 | |
| 2l9f_A | 102 | CALE8, meacp; transferase, acyl carrier protein; N | 99.8 | |
| 2ava_A | 82 | ACP I, acyl carrier protein I, chloroplast; four-h | 99.78 | |
| 2kjs_A | 87 | Putative acyl carrier protein; alpha, ACP, PNS, st | 99.78 | |
| 2kwl_A | 84 | ACP, acyl carrier protein; structural genomics, se | 99.77 | |
| 3gzm_A | 81 | Acyl carrier protein; helix bundle, phosphopanteth | 99.77 | |
| 1vku_A | 100 | Acyl carrier protein; TM0175, structural genomics, | 99.77 | |
| 2dnw_A | 99 | Acyl carrier protein; ACP, fatty acid biosynthesis | 99.76 | |
| 1af8_A | 86 | Actinorhodin polyketide synthase acyl carrier Pro; | 99.76 | |
| 2lol_A | 81 | ACP, acyl carrier protein; lipid transport; NMR {R | 99.76 | |
| 3ejb_A | 97 | Acyl carrier protein; protein-protein complex, cyt | 99.76 | |
| 4dxe_H | 101 | ACP, acyl carrier protein; acyl-carrier-protein sy | 99.76 | |
| 2l4b_A | 88 | Acyl carrier protein; infectious disease, human gr | 99.76 | |
| 1x3o_A | 80 | Acyl carrier protein; structural genomics, riken s | 99.75 | |
| 3ce7_A | 107 | Specific mitochodrial acyl carrier protein; malari | 99.74 | |
| 1f80_D | 81 | Acyl carrier protein; transferase; HET: PN2; 2.30A | 99.74 | |
| 2cnr_A | 82 | FAS, ACP, acyl carrier protein; polykdetide, phosp | 99.74 | |
| 2lki_A | 105 | Putative uncharacterized protein; helical bundle, | 99.74 | |
| 1dv5_A | 80 | APO-DCP, APO-D-alanyl carrier protein; 3-helix bun | 99.73 | |
| 2qnw_A | 82 | Acyl carrier protein; malaria, SGC, structural gen | 99.73 | |
| 1klp_A | 115 | ACP, ACPM, meromycolate extension acyl carrier pro | 99.73 | |
| 2kw2_A | 101 | Specialized acyl carrier protein; structural genom | 99.73 | |
| 2jq4_A | 105 | AGR_C_4658P, hypothetical protein ATU2571; ATC2521 | 99.72 | |
| 2cgq_A | 113 | Acyl carrier protein ACPA; RV0033, protein transpo | 99.71 | |
| 2lte_A | 103 | Specialized acyl carrier protein; APO protein, tra | 99.54 | |
| 2amw_A | 83 | Hypothetical protein NE2163; all helical protein, | 99.68 | |
| 1l0i_A | 78 | Acyl carrier protein; acyl chain binding, fatty ac | 99.68 | |
| 1nq4_A | 95 | Oxytetracycline polyketide synthase acyl carrier p | 99.68 | |
| 1or5_A | 83 | Acyl carrier protein; ACP, biosynthesis, frenolici | 99.65 | |
| 2ehs_A | 77 | ACP, acyl carrier protein; lipid transport, struct | 99.65 | |
| 1fh1_A | 92 | NODF, nodulation protein F; ROOT nodulation factor | 99.62 | |
| 2l3v_A | 79 | ACP, acyl carrier protein; structural genomi seatt | 99.61 | |
| 2liu_A | 99 | CURA; holo state, transferase; NMR {Lyngbya majusc | 99.57 | |
| 2afd_A | 88 | Protein ASL1650; twisted antiparallel helical bund | 99.56 | |
| 2kr5_A | 89 | PKS, aflatoxin biosynthesis polyketide synthase; a | 99.52 | |
| 2cg5_B | 91 | Fatty acid synthase; transferase-hydrolase complex | 99.46 | |
| 2ju1_A | 95 | Erythronolide synthase; carrier protein domain, mo | 99.45 | |
| 2l22_A | 212 | Mupirocin didomain acyl carrier protein; biosynthe | 99.42 | |
| 4i4d_A | 93 | Peptide synthetase NRPS type II-PCP; structural ge | 99.39 | |
| 1dny_A | 91 | Non-ribosomal peptide synthetase peptidyl carrier | 99.35 | |
| 2l22_A | 212 | Mupirocin didomain acyl carrier protein; biosynthe | 99.35 | |
| 2cq8_A | 110 | 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH | 99.01 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 98.87 | |
| 2jgp_A | 520 | Tyrocidine synthetase 3; multifunctional enzyme, a | 98.6 | |
| 2fq1_A | 287 | Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy | 98.46 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 98.35 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 98.28 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 98.04 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 97.97 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 97.48 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 89.51 | |
| 1dd4_C | 40 | 50S ribosomal protein L7/L12; dimer formation, fle | 82.45 |
| >2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* | Back alignment and structure |
|---|
| >2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* | Back alignment and structure |
|---|
| >1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 | Back alignment and structure |
|---|
| >2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* | Back alignment and structure |
|---|
| >2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} | Back alignment and structure |
|---|
| >3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* | Back alignment and structure |
|---|
| >4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} | Back alignment and structure |
|---|
| >1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A | Back alignment and structure |
|---|
| >2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* | Back alignment and structure |
|---|
| >2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A | Back alignment and structure |
|---|
| >2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 | Back alignment and structure |
|---|
| >2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A | Back alignment and structure |
|---|
| >2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 | Back alignment and structure |
|---|
| >2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A | Back alignment and structure |
|---|
| >1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 | Back alignment and structure |
|---|
| >1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 | Back alignment and structure |
|---|
| >2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A | Back alignment and structure |
|---|
| >1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* | Back alignment and structure |
|---|
| >2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A | Back alignment and structure |
|---|
| >2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A | Back alignment and structure |
|---|
| >2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A | Back alignment and structure |
|---|
| >2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} | Back alignment and structure |
|---|
| >1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A | Back alignment and structure |
|---|
| >2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} | Back alignment and structure |
|---|
| >2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 140 | ||||
| d1f80d_ | 74 | a.28.1.1 (D:) Acyl carrier protein {Bacillus subti | 9e-17 | |
| d1t8ka_ | 77 | a.28.1.1 (A:) Acyl carrier protein {Escherichia co | 9e-16 | |
| d1dv5a_ | 80 | a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob | 7e-12 | |
| d1or5a_ | 82 | a.28.1.1 (A:) Frenolicin polyketide synthase acyl | 2e-11 | |
| d1klpa_ | 115 | a.28.1.1 (A:) Acyl carrier protein {Mycobacterium | 2e-11 | |
| d1vkua_ | 85 | a.28.1.1 (A:) Acyl carrier protein {Thermotoga mar | 5e-11 | |
| d2af8a_ | 86 | a.28.1.1 (A:) Actinorhodin polyketide synthase acy | 2e-08 | |
| d1nq4a_ | 95 | a.28.1.1 (A:) Oxytetracycline polyketide synthase | 1e-07 | |
| d2jq4a1 | 83 | a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Ag | 2e-06 | |
| d2pnga1 | 76 | a.28.1.1 (A:1-76) Type I fatty acid synthase ACP d | 7e-06 |
| >d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Acyl carrier protein-like superfamily: ACP-like family: Acyl-carrier protein (ACP) domain: Acyl carrier protein species: Bacillus subtilis [TaxId: 1423]
Score = 67.5 bits (165), Expect = 9e-17
Identities = 25/72 (34%), Positives = 44/72 (61%)
Query: 61 ETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLEEEFGIGVEEENSQN 120
+T+++V +I+ +L + S LGAD LD VE+VM LE+EF + + +E+++
Sbjct: 3 DTLERVTKIIVDRLGVDEADVKLEASFKEDLGADXLDVVELVMELEDEFDMEISDEDAEK 62
Query: 121 ITTVQEAADLIE 132
I TV +A + I+
Sbjct: 63 IATVGDAVNYIQ 74
|
| >d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 | Back information, alignment and structure |
|---|
| >d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 | Back information, alignment and structure |
|---|
| >d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 | Back information, alignment and structure |
|---|
| >d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 | Back information, alignment and structure |
|---|
| >d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Length = 85 | Back information, alignment and structure |
|---|
| >d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 | Back information, alignment and structure |
|---|
| >d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Length = 95 | Back information, alignment and structure |
|---|
| >d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Length = 83 | Back information, alignment and structure |
|---|
| >d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| d1t8ka_ | 77 | Acyl carrier protein {Escherichia coli [TaxId: 562 | 99.81 | |
| d1vkua_ | 85 | Acyl carrier protein {Thermotoga maritima [TaxId: | 99.79 | |
| d1f80d_ | 74 | Acyl carrier protein {Bacillus subtilis [TaxId: 14 | 99.77 | |
| d1klpa_ | 115 | Acyl carrier protein {Mycobacterium tuberculosis [ | 99.71 | |
| d2af8a_ | 86 | Actinorhodin polyketide synthase acyl carrier prot | 99.69 | |
| d1dv5a_ | 80 | apo-D-alanyl carrier protein {Lactobacillus casei | 99.68 | |
| d1nq4a_ | 95 | Oxytetracycline polyketide synthase acyl carrier { | 99.66 | |
| d2jq4a1 | 83 | Hypothetical protein Atu2571 {Agrobacterium tumefa | 99.64 | |
| d1or5a_ | 82 | Frenolicin polyketide synthase acyl carrier protei | 99.53 | |
| d2gdwa1 | 76 | Peptidyl carrier protein (PCP), thioester domain { | 99.38 | |
| d2pnga1 | 76 | Type I fatty acid synthase ACP domain {Rat (Rattus | 99.28 | |
| d2gyc31 | 47 | Ribosomal protein L7/12, oligomerisation (N-termin | 90.22 |
| >d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Acyl carrier protein-like superfamily: ACP-like family: Acyl-carrier protein (ACP) domain: Acyl carrier protein species: Escherichia coli [TaxId: 562]
Probab=99.81 E-value=2.4e-20 Score=122.12 Aligned_cols=74 Identities=45% Similarity=0.632 Sum_probs=70.3
Q ss_pred HHHHHHHHHHHHHhCCCCCCCCCCCCCcc-ccCCChHHHHHHHHHHHHHhCCCcCccccccCCCHHHHHHHHHHHH
Q 032464 61 ETVQKVCEIVRRQLALPAETELTSESKFS-ALGADSLDTVEIVMSLEEEFGIGVEEENSQNITTVQEAADLIEKLV 135 (140)
Q Consensus 61 ei~~~V~~il~~~l~i~~~~eI~~ds~l~-dLGlDSLd~vELv~~LEeeFgI~i~~~~l~~~~TV~dl~~~I~~~~ 135 (140)
+|.++|+++|++.+++++ ++|+++++|. |||+|||+.+||++.||++|||+||++++.++.||+++++||+++.
T Consensus 2 ~I~~~v~~iia~~l~i~~-~~i~~~~~l~~dLg~DSl~~~el~~~iE~~f~i~i~~~~~~~~~Tv~dlv~~i~~~~ 76 (77)
T d1t8ka_ 2 TIEERVKKIIGEQLGVKQ-EEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ 76 (77)
T ss_dssp CHHHHHHHHHHHHHTCCG-GGCCTTCBTTTTTCCCHHHHHHHHHHHHHHHTCCCCHHHHTTCCBHHHHHHHHHHTC
T ss_pred cHHHHHHHHHHHHHCCCH-HHcCCCCcchhccccchhHHHHHHHHHHHHhCCCCCHHHHHhCCCHHHHHHHHHHcc
Confidence 478999999999999998 6999999997 8999999999999999999999999999999999999999999864
|
| >d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} | Back information, alignment and structure |
|---|
| >d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} | Back information, alignment and structure |
|---|
| >d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|